1FZIE

Methane monooxygenase hydroxylase, form i pressurized with xenon gas
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 162
sequence length 162
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE02
1FZIE 1XVDE 1MHZG 4GAMC 1FZ2E 1MHYG 1FZ0E 1XVEE 1XU3E 1XMHE 1MTYG 1FZ4E 1XMFE 1FZ6E 1FYZE 1FZ3E 1FZHE 1XVGE 1XVFE 1XVCE 1XMGE 1FZ7E 1MMOG 1XVBE 1XU5E 1FZ5E 1FZ9E 1FZ8E 1FZ1E
chains in the Genus database with same CATH superfamily
4X5MA 4FJMA 3E4YA 2E32A 3TAGA 2OZMA 3SUNA 2P1QB 4KHNA 4JRQA 4FJ7A 3SI6A 2LF3A 3RMAA 3RMBA 1XU3E 4FK0A 4M3XA 2P1MB 4ADOA 4DU1A 2OYQA 3SPZA 3RWUA 4I9QA 4FJ8A 3LDBA 3CFRA 3LZIA 3QNNA 1FZ4E 3L2OB 4JS4A 4DTXA 3C95A 1XVGE 1FZHE 4M3RA 3CQ8A 3QEPA 2B1EA 4J2AA 3CFPA 4FJ9A 2E31A 2OVPB 2VJ4A 3SQ4A 1LDKE 4DTOA 1JW2A 2P1NB 3C6PB 4FK4A 4M41A 2JQTA 3HGLA 3LD8A 3BVOA 3OGMB 3SUPA 3LDSA 3SQ2A 4KHWA 1CLQA 1MHZG 4FJNA 4KHYA 1WAJA 2OVRB 3HGKE 3UO3A 4GAMC 3C94A 3UO2A 4M45A 3QEWA 4ADNA 2LF6A 3SPYA 3QETA 2MZWB 3NCIA 2DY4A 4JRPA 3TJYA 4EYWA 2VIXA 1IG9A 3L8BA 3RMCA 3SQ0A 3K2OA 3LZJA 3L1NA 3SVIA 3C6OB 4DU4A 1WAFA 3HP9A 4FJKA 1FZ3E 3V7DB 3QERA 3MKSB 2P1PB 4DTNA 4RNGA 3SNNA 1XVFE 1XVCE 5H37A 3SUQA 3UIQA 3QEIA 1XMGE 4M3ZA 4FJIA 1XVBE 4HCBA 2JH9A 1NEXB 4HCCA 4KI6A 4FJLA 1FZ1E 3SUOA 2DTUA 3QNOA 4KHUA 4M42A 1FS1A 1FZ2E 4KHQA 1FZ0E 2YB5A 2JH8A 4X5NA 2OVQB 1P22A 3KD1E 2MW2A 3TL8B 3S9HA 4DU3A 4FJGA 2JHPA 1FXXA 3E4WA 4I9LA 1XMHE 3QEXA 2MMBA 1Q9XA 4DTSA 4KI4A 4RG8A 1FZ6E 1IH7A 4RL5A 1FPOA 4EPHA 3QESA 2FW3A 4QNCA 3L0MA 3RMDA 4FJXA 3NGIA 2JHCA 4B08A 3KD5E 4AKIA 3QEVA 2PFVA 4AKGA 4FJJA 2HD0A 3N1BA 4JS5A 4IT5A 1XU5E 4DTMA 2P5GA 2VJ5A 1FZ9E 2QXFA 4QNDA 4KHSA 4M3UA 4DTJA 1FZIE 1XVDE 4DTRA 4E4BA 3HL8A 2K5SA 3TAEA 3OGKB 2P5OA 4FJHA 4J2EA 4ICGC 3NDKA 4AI6A 1MHYG 2DEBA 2JPNA 4M3YA 2RKHA 4J2DA 4EP9A 2B7MA 5IZ7A 4FVMA 3TABA 3NAEA 2JHAA 3CFOA 3J27A 3OGLB 3NE6A 3TAFA 5IREA 2H4TA 2B8IA 3N1EA 1MTYG 4FK2A 3SJJA 5IBKB 4AKHA 4I6JB 2RCUA 4M3WA 4DTPA 1XMFE 3C6NB 1FYZE 3WSOA 2FYOA 3NHGA 1N1CA 2PFTA 4E3SA 4M3TA 4J2BA 2OZSA 1FZ7E 2ATQA 1MMOG 4DTUA 3SQ1A 2P1OB 1Q9YA 1XL3C 4FJ5A 3J2PA 1FZ5E 3SCXA 1FZ8E 1XVEE
chains in the Genus database with same CATH topology
4X5MA 4FJMA 3E4YA 2E32A 3TAGA 2OZMA 3SUNA 2P1QB 4KHNA 4JRQA 4FJ7A 3SI6A 2LF3A 3RMAA 3RMBA 1XU3E 4FK0A 4M3XA 2P1MB 4ADOA 4DU1A 2OYQA 3SPZA 3RWUA 4I9QA 4FJ8A 3LDBA 3CFRA 3LZIA 3QNNA 1FZ4E 3L2OB 4JS4A 4DTXA 3C95A 1XVGE 1FZHE 4M3RA 3CQ8A 3QEPA 2B1EA 4J2AA 3CFPA 4FJ9A 2E31A 2OVPB 2VJ4A 3SQ4A 1LDKE 4DTOA 2P1NB 3C6PB 4FK4A 4M41A 3HGLA 3LD8A 3OGMB 3SUPA 3LDSA 3SQ2A 4KHWA 1CLQA 1MHZG 4FJNA 4KHYA 1WAJA 2OVRB 3HGKE 4GAMC 3C94A 4M45A 3QEWA 4ADNA 2LF6A 3SPYA 3QETA 2MZWB 3NCIA 2DY4A 4JRPA 3TJYA 4EYWA 2VIXA 1IG9A 3L8BA 3RMCA 3SQ0A 3K2OA 3LZJA 3L1NA 3SVIA 3C6OB 4DU4A 1WAFA 3HP9A 4FJKA 1FZ3E 3V7DB 3QERA 3MKSB 2P1PB 4DTNA 4RNGA 3SNNA 1XVFE 1XVCE 5H37A 3SUQA 3UIQA 3QEIA 1XMGE 4M3ZA 4FJIA 1XVBE 4HCBA 2JH9A 1NEXB 4HCCA 4KI6A 4FJLA 1FZ1E 3SUOA 2DTUA 3QNOA 4KHUA 4M42A 1FZ2E 1FS1A 4KHQA 1FZ0E 2YB5A 2JH8A 4X5NA 2OVQB 1P22A 3KD1E 3TL8B 3S9HA 4DU3A 4FJGA 2JHPA 1FXXA 3E4WA 4I9LA 1XMHE 3QEXA 2MMBA 1Q9XA 4DTSA 4KI4A 4RG8A 1FZ6E 1IH7A 4RL5A 4EPHA 3QESA 3RMDA 2FW3A 4QNCA 3L0MA 3SJJA 4FJXA 3NGIA 2JHCA 4B08A 3KD5E 4AKIA 3QEVA 2PFVA 4AKGA 4FJJA 2HD0A 3N1BA 4JS5A 4DTMA 1XU5E 2P5GA 2VJ5A 1FZ9E 2QXFA 4QNDA 4KHSA 4M3UA 4DTJA 1FZIE 1XVDE 4DTRA 4E4BA 3HL8A 3TAEA 4FJHA 3OGKB 2P5OA 4J2EA 3NDKA 4AI6A 1MHYG 2DEBA 2JPNA 4M3YA 4J2DA 4EP9A 2B7MA 5IZ7A 4FVMA 3TABA 3NAEA 2JHAA 3CFOA 3J27A 3OGLB 3NE6A 3TAFA 5IREA 2H4TA 2B8IA 3N1EA 1MTYG 4FK2A 4AKHA 5IBKB 4I6JB 2RCUA 4M3WA 4DTPA 1XMFE 3C6NB 1FYZE 3WSOA 2FYOA 3NHGA 2PFTA 4E3SA 4M3TA 4J2BA 2OZSA 1FZ7E 2ATQA 1MMOG 4DTUA 3SQ1A 2P1OB 1Q9YA 1XL3C 4FJ5A 3J2PA 1FZ5E 3SCXA 1FZ8E 1XVEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZI E;  1XVD E;  1MHZ G;  4GAM C;  1FZ2 E;  1MHY G;  1FZ0 E;  1XVE E;  1XU3 E;  1XMH E;  1MTY G;  1FZ4 E;  1XMF E;  1FZ6 E;  1FYZ E;  1FZ3 E;  1FZH E;  1XVG E;  1XVF E;  1XVC E;  1XMG E;  1FZ7 E;  1MMO G;  1XVB E;  1XU5 E;  1FZ5 E;  1FZ9 E;  1FZ8 E;  1FZ1 E; 
#chains in the Genus database with same CATH topology
 4X5M A;  4FJM A;  3E4Y A;  2E32 A;  3TAG A;  2OZM A;  3SUN A;  2P1Q B;  4KHN A;  4JRQ A;  4FJ7 A;  3SI6 A;  2LF3 A;  3RMA A;  3RMB A;  1XU3 E;  4FK0 A;  4M3X A;  2P1M B;  4ADO A;  4DU1 A;  2OYQ A;  3SPZ A;  3RWU A;  4I9Q A;  4FJ8 A;  3LDB A;  3CFR A;  3LZI A;  3QNN A;  1FZ4 E;  3L2O B;  4JS4 A;  4DTX A;  3C95 A;  1XVG E;  1FZH E;  4M3R A;  3CQ8 A;  3QEP A;  2B1E A;  4J2A A;  3CFP A;  4FJ9 A;  2E31 A;  2OVP B;  2VJ4 A;  3SQ4 A;  1LDK E;  4DTO A;  1JW2 A;  2P1N B;  3C6P B;  4FK4 A;  4M41 A;  2JQT A;  3HGL A;  3LD8 A;  3BVO A;  3OGM B;  3SUP A;  3LDS A;  3SQ2 A;  4KHW A;  1CLQ A;  1MHZ G;  4FJN A;  4KHY A;  1WAJ A;  2OVR B;  3HGK E;  3UO3 A;  4GAM C;  3C94 A;  3UO2 A;  4M45 A;  3QEW A;  4ADN A;  2LF6 A;  3SPY A;  3QET A;  2MZW B;  3NCI A;  2DY4 A;  4JRP A;  3TJY A;  4EYW A;  2VIX A;  1IG9 A;  3L8B A;  3RMC A;  3SQ0 A;  3K2O A;  3LZJ A;  3L1N A;  3SVI A;  3C6O B;  4DU4 A;  1WAF A;  3HP9 A;  4FJK A;  1FZ3 E;  3V7D B;  3QER A;  3MKS B;  2P1P B;  4DTN A;  4RNG A;  3SNN A;  1XVF E;  1XVC E;  5H37 A;  3SUQ A;  3UIQ A;  3QEI A;  1XMG E;  4M3Z A;  4FJI A;  1XVB E;  4HCB A;  2JH9 A;  1NEX B;  4HCC A;  4KI6 A;  4FJL A;  1FZ1 E;  3SUO A;  2DTU A;  3QNO A;  4KHU A;  4M42 A;  1FS1 A;  1FZ2 E;  4KHQ A;  1FZ0 E;  2YB5 A;  2JH8 A;  4X5N A;  2OVQ B;  1P22 A;  3KD1 E;  2MW2 A;  3TL8 B;  3S9H A;  4DU3 A;  4FJG A;  2JHP A;  1FXX A;  3E4W A;  4I9L A;  1XMH E;  3QEX A;  2MMB A;  1Q9X A;  4DTS A;  4KI4 A;  4RG8 A;  1FZ6 E;  1IH7 A;  4RL5 A;  1FPO A;  4EPH A;  3QES A;  2FW3 A;  4QNC A;  3L0M A;  3RMD A;  4FJX A;  3NGI A;  2JHC A;  4B08 A;  3KD5 E;  4AKI A;  3QEV A;  2PFV A;  4AKG A;  4FJJ A;  2HD0 A;  3N1B A;  4JS5 A;  4IT5 A;  1XU5 E;  4DTM A;  2P5G A;  2VJ5 A;  1FZ9 E;  2QXF A;  4QND A;  4KHS A;  4M3U A;  4DTJ A;  1FZI E;  1XVD E;  4DTR A;  4E4B A;  3HL8 A;  2K5S A;  3TAE A;  3OGK B;  2P5O A;  4FJH A;  4J2E A;  4ICG C;  3NDK A;  4AI6 A;  1MHY G;  2DEB A;  2JPN A;  4M3Y A;  2RKH A;  4J2D A;  4EP9 A;  2B7M A;  5IZ7 A;  4FVM A;  3TAB A;  3NAE A;  2JHA A;  3CFO A;  3J27 A;  3OGL B;  3NE6 A;  3TAF A;  5IRE A;  2H4T A;  2B8I A;  3N1E A;  1MTY G;  4FK2 A;  3SJJ A;  5IBK B;  4AKH A;  4I6J B;  2RCU A;  4M3W A;  4DTP A;  1XMF E;  3C6N B;  1FYZ E;  3WSO A;  2FYO A;  3NHG A;  1N1C A;  2PFT A;  4E3S A;  4M3T A;  4J2B A;  2OZS A;  1FZ7 E;  2ATQ A;  1MMO G;  4DTU A;  3SQ1 A;  2P1O B;  1Q9Y A;  1XL3 C;  4FJ5 A;  3J2P A;  1FZ5 E;  3SCX A;  1FZ8 E;  1XVE E; 
#chains in the Genus database with same CATH homology
 4X5M A;  4FJM A;  3E4Y A;  2E32 A;  3TAG A;  2OZM A;  3SUN A;  2P1Q B;  4KHN A;  4JRQ A;  4FJ7 A;  3SI6 A;  2LF3 A;  3RMA A;  3RMB A;  1XU3 E;  4FK0 A;  4M3X A;  2P1M B;  4ADO A;  4DU1 A;  2OYQ A;  3SPZ A;  3RWU A;  4I9Q A;  4FJ8 A;  3LDB A;  3CFR A;  3LZI A;  3QNN A;  1FZ4 E;  3L2O B;  4JS4 A;  4DTX A;  3C95 A;  1XVG E;  1FZH E;  4M3R A;  3CQ8 A;  3QEP A;  2B1E A;  4J2A A;  3CFP A;  4FJ9 A;  2E31 A;  2OVP B;  2VJ4 A;  3SQ4 A;  1LDK E;  4DTO A;  2P1N B;  3C6P B;  4FK4 A;  4M41 A;  3HGL A;  3LD8 A;  3OGM B;  3SUP A;  3LDS A;  3SQ2 A;  4KHW A;  1CLQ A;  1MHZ G;  4FJN A;  4KHY A;  1WAJ A;  2OVR B;  3HGK E;  4GAM C;  3C94 A;  4M45 A;  3QEW A;  4ADN A;  2LF6 A;  3SPY A;  3QET A;  2MZW B;  3NCI A;  2DY4 A;  4JRP A;  3TJY A;  4EYW A;  2VIX A;  1IG9 A;  3L8B A;  3RMC A;  3SQ0 A;  3K2O A;  3LZJ A;  3L1N A;  3SVI A;  3C6O B;  4DU4 A;  1WAF A;  3HP9 A;  4FJK A;  1FZ3 E;  3V7D B;  3QER A;  3MKS B;  2P1P B;  4DTN A;  4RNG A;  3SNN A;  1XVF E;  1XVC E;  5H37 A;  3SUQ A;  3UIQ A;  3QEI A;  1XMG E;  4M3Z A;  4FJI A;  1XVB E;  4HCB A;  2JH9 A;  1NEX B;  4HCC A;  4KI6 A;  4FJL A;  1FZ1 E;  3SUO A;  2DTU A;  3QNO A;  4KHU A;  4M42 A;  1FZ2 E;  1FS1 A;  4KHQ A;  1FZ0 E;  2YB5 A;  2JH8 A;  4X5N A;  2OVQ B;  1P22 A;  3KD1 E;  3TL8 B;  3S9H A;  4DU3 A;  4FJG A;  2JHP A;  1FXX A;  3E4W A;  4I9L A;  1XMH E;  3QEX A;  2MMB A;  1Q9X A;  4DTS A;  4KI4 A;  4RG8 A;  1FZ6 E;  1IH7 A;  4RL5 A;  4EPH A;  3QES A;  3RMD A;  2FW3 A;  4QNC A;  3L0M A;  3SJJ A;  4FJX A;  3NGI A;  2JHC A;  4B08 A;  3KD5 E;  4AKI A;  3QEV A;  2PFV A;  4AKG A;  4FJJ A;  2HD0 A;  3N1B A;  4JS5 A;  4DTM A;  1XU5 E;  2P5G A;  2VJ5 A;  1FZ9 E;  2QXF A;  4QND A;  4KHS A;  4M3U A;  4DTJ A;  1FZI E;  1XVD E;  4DTR A;  4E4B A;  3HL8 A;  3TAE A;  4FJH A;  3OGK B;  2P5O A;  4J2E A;  3NDK A;  4AI6 A;  1MHY G;  2DEB A;  2JPN A;  4M3Y A;  4J2D A;  4EP9 A;  2B7M A;  5IZ7 A;  4FVM A;  3TAB A;  3NAE A;  2JHA A;  3CFO A;  3J27 A;  3OGL B;  3NE6 A;  3TAF A;  5IRE A;  2H4T A;  2B8I A;  3N1E A;  1MTY G;  4FK2 A;  4AKH A;  5IBK B;  4I6J B;  2RCU A;  4M3W A;  4DTP A;  1XMF E;  3C6N B;  1FYZ E;  3WSO A;  2FYO A;  3NHG A;  2PFT A;  4E3S A;  4M3T A;  4J2B A;  2OZS A;  1FZ7 E;  2ATQ A;  1MMO G;  4DTU A;  3SQ1 A;  2P1O B;  1Q9Y A;  1XL3 C;  4FJ5 A;  3J2P A;  1FZ5 E;  3SCX A;  1FZ8 E;  1XVE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...