1FZIE

Methane monooxygenase hydroxylase, form i pressurized with xenon gas
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
total genus 61
structure length 162
sequence length 162
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE02
1XU3E 1FZ5E 1XVDE 1XMFE 1FZHE 1FZ8E 1FZ9E 1XU5E 1XVBE 1FZ0E 1FZIE 1MHYG 1XVFE 1FZ2E 1MMOG 1XVEE 1XMGE 1FZ1E 1FZ7E 1XMHE 1MTYG 1XVGE 4GAMC 1FZ6E 1FZ3E 1FYZE 1FZ4E 1MHZG 1XVCE
chains in the Genus database with same CATH superfamily
3NCIA 4HCCA 5H37A 1XVDE 3NHGA 2P5OA 4FJ8A 4AKGA 2JH9A 1P22A 2QXFA 3C6PB 3V7DB 3KD1E 4KHSA 3SPZA 1N1CA 1XU5E 1XVBE 2JPNA 4E3SA 2HD0A 4KI4A 4FJKA 3HGKE 1FZ2E 3LDBA 2PFVA 3LZJA 2P1PB 4JS5A 3E4WA 3HP9A 4J2DA 4FJNA 4KHWA 3RMAA 3TAGA 4M3WA 4M3ZA 3L2OB 1FZ7E 3RMBA 2OVPB 2LF3A 2OZSA 4X5MA 1XVGE 2DEBA 2VJ5A 1IG9A 3RMDA 1Q9YA 3LDSA 4DTPA 5IZ7A 2OVQB 1FS1A 3C95A 1FZ4E 3N1EA 2P1MB 2FYOA 1XL3C 1NEXB 3RWUA 4FJ9A 4FJGA 3L0MA 3RMCA 1XMFE 1FZHE 2OVRB 4FJ7A 4FJJA 3E4YA 4M3UA 1FPOA 3OGMB 4DTSA 4DU1A 4M3XA 3NE6A 2RCUA 3LD8A 4EPHA 4ADOA 3SJJA 2P5GA 3TJYA 1FZ0E 4FJXA 2JH8A 4AI6A 3TAEA 2FW3A 3SUQA 1MHYG 2P1OB 3SQ4A 3SUPA 4FJ5A 4FJHA 1MMOG 3QEWA 3TAFA 3CFOA 4I6JB 4AKHA 3SUOA 3SNNA 1XVEE 4ICGC 4FVMA 3QEXA 1XMGE 2B8IA 3CQ8A 1FZ1E 4M3RA 3K2OA 2RKHA 3HGLA 1XMHE 4QNCA 3NAEA 4M41A 4DTMA 3SQ0A 2MW2A 4I9LA 1LDKE 2B7MA 1FZ3E 3UIQA 1FYZE 2VIXA 3BVOA 3WSOA 4EYWA 2ATQA 3QNNA 1MHZG 3MKSB 3SUNA 3SI6A 1FXXA 2OZMA 4J2BA 4RL5A 5IREA 3C6OB 3TABA 3SCXA 4M42A 4KHYA 1WAFA 3CFPA 3TL8B 2E32A 1FZ9E 3OGLB 3KD5E 3HL8A 3L1NA 1CLQA 3CFRA 3SPYA 4FJMA 1FZIE 3N1BA 4RNGA 4FK0A 4IT5A 4E4BA 3NGIA 4FK4A 4M3YA 3C94A 3OGKB 4AKIA 3S9HA 4DU3A 2OYQA 3UO3A 1IH7A 4RG8A 2P1NB 3L8BA 4KHQA 3J27A 3SQ1A 4FK2A 4EP9A 4HCBA 2JHAA 5IBKB 3QERA 3QESA 4FJLA 1FZ6E 4FJIA 3J2PA 4I9QA 4DTOA 2P1QB 4J2AA 1JW2A 2JQTA 2PFTA 2YB5A 1XU3E 1Q9XA 1FZ5E 4M3TA 3NDKA 2DY4A 3UO2A 4M45A 1FZ8E 4JRQA 3C6NB 1WAJA 4JRPA 4ADNA 3QETA 4B08A 3SQ2A 3SVIA 2DTUA 3QEPA 4JS4A 4DTJA 3QEVA 2MZWB 2LF6A 4DU4A 2VJ4A 1XVFE 4X5NA 3QNOA 4QNDA 3LZIA 2JHCA 4J2EA 2E31A 2K5SA 4DTUA 4KHUA 4DTRA 4DTXA 4DTNA 2B1EA 1MTYG 3QEIA 4GAMC 2JHPA 2H4TA 2MMBA 4KI6A 4KHNA 1XVCE
chains in the Genus database with same CATH topology
3NCIA 4HCCA 5H37A 1XVDE 3NHGA 2P5OA 4FJ8A 4AKGA 2JH9A 1P22A 2QXFA 3C6PB 3V7DB 3KD1E 4KHSA 3SPZA 1XU5E 1XVBE 2JPNA 4E3SA 2HD0A 4KI4A 4FJKA 3HGKE 1FZ2E 3LDBA 2PFVA 3LZJA 2P1PB 4JS5A 3E4WA 3HP9A 4J2DA 4FJNA 4KHWA 3RMAA 3TAGA 4M3WA 4M3ZA 3L2OB 1FZ7E 3RMBA 2OVPB 2LF3A 2OZSA 4X5MA 1XVGE 2DEBA 2VJ5A 1IG9A 3RMDA 1Q9YA 3LDSA 4DTPA 5IZ7A 2OVQB 1FS1A 3C95A 1FZ4E 3N1EA 2P1MB 2FYOA 1XL3C 1NEXB 3RWUA 4FJ9A 4FJGA 3L0MA 3RMCA 1XMFE 1FZHE 2OVRB 4FJ7A 4FJJA 3E4YA 4M3UA 3OGMB 4DTSA 4DU1A 4M3XA 3NE6A 2RCUA 3LD8A 4EPHA 4ADOA 3SJJA 2P5GA 3TJYA 1FZ0E 4FJXA 2JH8A 4AI6A 3TAEA 2FW3A 3SUQA 1MHYG 2P1OB 3SQ4A 3SUPA 4FJ5A 4FJHA 1MMOG 3QEWA 3TAFA 3CFOA 4I6JB 4AKHA 3SUOA 3SNNA 1XVEE 3QEXA 4FVMA 1XMGE 2B8IA 3CQ8A 1FZ1E 4M3RA 3K2OA 3HGLA 1XMHE 4QNCA 3NAEA 4M41A 4DTMA 3SQ0A 4I9LA 1LDKE 2B7MA 1FZ3E 3UIQA 1FYZE 2VIXA 3WSOA 4EYWA 2ATQA 3QNNA 1MHZG 3MKSB 3SUNA 3SI6A 1FXXA 2OZMA 4J2BA 4RL5A 5IREA 3C6OB 3TABA 3SCXA 4M42A 4KHYA 1WAFA 3CFPA 3TL8B 2E32A 1FZ9E 3OGLB 3KD5E 3HL8A 3L1NA 1CLQA 3CFRA 3SPYA 4FJMA 1FZIE 3N1BA 4RNGA 4FK0A 4E4BA 3NGIA 4FK4A 4M3YA 3C94A 3OGKB 4AKIA 3S9HA 4DU3A 2OYQA 1IH7A 4RG8A 2P1NB 3L8BA 4KHQA 3J27A 3SQ1A 4FK2A 4EP9A 4HCBA 2JHAA 5IBKB 3QERA 3QESA 4FJLA 1FZ6E 4FJIA 3J2PA 4I9QA 4DTOA 2P1QB 4J2AA 2PFTA 2YB5A 1XU3E 1Q9XA 1FZ5E 4M3TA 3NDKA 2DY4A 4M45A 1FZ8E 4JRQA 3C6NB 1WAJA 4JRPA 4ADNA 3QETA 4B08A 3SQ2A 3SVIA 2DTUA 3QEPA 4JS4A 4DTJA 3QEVA 2MZWB 2LF6A 4DU4A 2VJ4A 1XVFE 4X5NA 3QNOA 4QNDA 3LZIA 2JHCA 4J2EA 2E31A 4DTUA 4KHUA 4DTRA 4DTXA 4DTNA 2B1EA 1MTYG 3QEIA 4GAMC 2JHPA 2H4TA 2MMBA 4KI6A 4KHNA 1XVCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XU3 E;  1FZ5 E;  1XVD E;  1XMF E;  1FZH E;  1FZ8 E;  1FZ9 E;  1XU5 E;  1XVB E;  1FZ0 E;  1FZI E;  1MHY G;  1XVF E;  1FZ2 E;  1MMO G;  1XVE E;  1XMG E;  1FZ1 E;  1FZ7 E;  1XMH E;  1MTY G;  1XVG E;  4GAM C;  1FZ6 E;  1FZ3 E;  1FYZ E;  1FZ4 E;  1MHZ G;  1XVC E; 
#chains in the Genus database with same CATH topology
 3NCI A;  4HCC A;  5H37 A;  1XVD E;  3NHG A;  2P5O A;  4FJ8 A;  4AKG A;  2JH9 A;  1P22 A;  2QXF A;  3C6P B;  3V7D B;  3KD1 E;  4KHS A;  3SPZ A;  1N1C A;  1XU5 E;  1XVB E;  2JPN A;  4E3S A;  2HD0 A;  4KI4 A;  4FJK A;  3HGK E;  1FZ2 E;  3LDB A;  2PFV A;  3LZJ A;  2P1P B;  4JS5 A;  3E4W A;  3HP9 A;  4J2D A;  4FJN A;  4KHW A;  3RMA A;  3TAG A;  4M3W A;  4M3Z A;  3L2O B;  1FZ7 E;  3RMB A;  2OVP B;  2LF3 A;  2OZS A;  4X5M A;  1XVG E;  2DEB A;  2VJ5 A;  1IG9 A;  3RMD A;  1Q9Y A;  3LDS A;  4DTP A;  5IZ7 A;  2OVQ B;  1FS1 A;  3C95 A;  1FZ4 E;  3N1E A;  2P1M B;  2FYO A;  1XL3 C;  1NEX B;  3RWU A;  4FJ9 A;  4FJG A;  3L0M A;  3RMC A;  1XMF E;  1FZH E;  2OVR B;  4FJ7 A;  4FJJ A;  3E4Y A;  4M3U A;  1FPO A;  3OGM B;  4DTS A;  4DU1 A;  4M3X A;  3NE6 A;  2RCU A;  3LD8 A;  4EPH A;  4ADO A;  3SJJ A;  2P5G A;  3TJY A;  1FZ0 E;  4FJX A;  2JH8 A;  4AI6 A;  3TAE A;  2FW3 A;  3SUQ A;  1MHY G;  2P1O B;  3SQ4 A;  3SUP A;  4FJ5 A;  4FJH A;  1MMO G;  3QEW A;  3TAF A;  3CFO A;  4I6J B;  4AKH A;  3SUO A;  3SNN A;  1XVE E;  4ICG C;  4FVM A;  3QEX A;  1XMG E;  2B8I A;  3CQ8 A;  1FZ1 E;  4M3R A;  3K2O A;  2RKH A;  3HGL A;  1XMH E;  4QNC A;  3NAE A;  4M41 A;  4DTM A;  3SQ0 A;  2MW2 A;  4I9L A;  1LDK E;  2B7M A;  1FZ3 E;  3UIQ A;  1FYZ E;  2VIX A;  3BVO A;  3WSO A;  4EYW A;  2ATQ A;  3QNN A;  1MHZ G;  3MKS B;  3SUN A;  3SI6 A;  1FXX A;  2OZM A;  4J2B A;  4RL5 A;  5IRE A;  3C6O B;  3TAB A;  3SCX A;  4M42 A;  4KHY A;  1WAF A;  3CFP A;  3TL8 B;  2E32 A;  1FZ9 E;  3OGL B;  3KD5 E;  3HL8 A;  3L1N A;  1CLQ A;  3CFR A;  3SPY A;  4FJM A;  1FZI E;  3N1B A;  4RNG A;  4FK0 A;  4IT5 A;  4E4B A;  3NGI A;  4FK4 A;  4M3Y A;  3C94 A;  3OGK B;  4AKI A;  3S9H A;  4DU3 A;  2OYQ A;  3UO3 A;  1IH7 A;  4RG8 A;  2P1N B;  3L8B A;  4KHQ A;  3J27 A;  3SQ1 A;  4FK2 A;  4EP9 A;  4HCB A;  2JHA A;  5IBK B;  3QER A;  3QES A;  4FJL A;  1FZ6 E;  4FJI A;  3J2P A;  4I9Q A;  4DTO A;  2P1Q B;  4J2A A;  1JW2 A;  2JQT A;  2PFT A;  2YB5 A;  1XU3 E;  1Q9X A;  1FZ5 E;  4M3T A;  3NDK A;  2DY4 A;  3UO2 A;  4M45 A;  1FZ8 E;  4JRQ A;  3C6N B;  1WAJ A;  4JRP A;  4ADN A;  3QET A;  4B08 A;  3SQ2 A;  3SVI A;  2DTU A;  3QEP A;  4JS4 A;  4DTJ A;  3QEV A;  2MZW B;  2LF6 A;  4DU4 A;  2VJ4 A;  1XVF E;  4X5N A;  3QNO A;  4QND A;  3LZI A;  2JHC A;  4J2E A;  2E31 A;  2K5S A;  4DTU A;  4KHU A;  4DTR A;  4DTX A;  4DTN A;  2B1E A;  1MTY G;  3QEI A;  4GAM C;  2JHP A;  2H4T A;  2MMB A;  4KI6 A;  4KHN A;  1XVC E; 
#chains in the Genus database with same CATH homology
 3NCI A;  4HCC A;  5H37 A;  1XVD E;  3NHG A;  2P5O A;  4FJ8 A;  4AKG A;  2JH9 A;  1P22 A;  2QXF A;  3C6P B;  3V7D B;  3KD1 E;  4KHS A;  3SPZ A;  1XU5 E;  1XVB E;  2JPN A;  4E3S A;  2HD0 A;  4KI4 A;  4FJK A;  3HGK E;  1FZ2 E;  3LDB A;  2PFV A;  3LZJ A;  2P1P B;  4JS5 A;  3E4W A;  3HP9 A;  4J2D A;  4FJN A;  4KHW A;  3RMA A;  3TAG A;  4M3W A;  4M3Z A;  3L2O B;  1FZ7 E;  3RMB A;  2OVP B;  2LF3 A;  2OZS A;  4X5M A;  1XVG E;  2DEB A;  2VJ5 A;  1IG9 A;  3RMD A;  1Q9Y A;  3LDS A;  4DTP A;  5IZ7 A;  2OVQ B;  1FS1 A;  3C95 A;  1FZ4 E;  3N1E A;  2P1M B;  2FYO A;  1XL3 C;  1NEX B;  3RWU A;  4FJ9 A;  4FJG A;  3L0M A;  3RMC A;  1XMF E;  1FZH E;  2OVR B;  4FJ7 A;  4FJJ A;  3E4Y A;  4M3U A;  3OGM B;  4DTS A;  4DU1 A;  4M3X A;  3NE6 A;  2RCU A;  3LD8 A;  4EPH A;  4ADO A;  3SJJ A;  2P5G A;  3TJY A;  1FZ0 E;  4FJX A;  2JH8 A;  4AI6 A;  3TAE A;  2FW3 A;  3SUQ A;  1MHY G;  2P1O B;  3SQ4 A;  3SUP A;  4FJ5 A;  4FJH A;  1MMO G;  3QEW A;  3TAF A;  3CFO A;  4I6J B;  4AKH A;  3SUO A;  3SNN A;  1XVE E;  3QEX A;  4FVM A;  1XMG E;  2B8I A;  3CQ8 A;  1FZ1 E;  4M3R A;  3K2O A;  3HGL A;  1XMH E;  4QNC A;  3NAE A;  4M41 A;  4DTM A;  3SQ0 A;  4I9L A;  1LDK E;  2B7M A;  1FZ3 E;  3UIQ A;  1FYZ E;  2VIX A;  3WSO A;  4EYW A;  2ATQ A;  3QNN A;  1MHZ G;  3MKS B;  3SUN A;  3SI6 A;  1FXX A;  2OZM A;  4J2B A;  4RL5 A;  5IRE A;  3C6O B;  3TAB A;  3SCX A;  4M42 A;  4KHY A;  1WAF A;  3CFP A;  3TL8 B;  2E32 A;  1FZ9 E;  3OGL B;  3KD5 E;  3HL8 A;  3L1N A;  1CLQ A;  3CFR A;  3SPY A;  4FJM A;  1FZI E;  3N1B A;  4RNG A;  4FK0 A;  4E4B A;  3NGI A;  4FK4 A;  4M3Y A;  3C94 A;  3OGK B;  4AKI A;  3S9H A;  4DU3 A;  2OYQ A;  1IH7 A;  4RG8 A;  2P1N B;  3L8B A;  4KHQ A;  3J27 A;  3SQ1 A;  4FK2 A;  4EP9 A;  4HCB A;  2JHA A;  5IBK B;  3QER A;  3QES A;  4FJL A;  1FZ6 E;  4FJI A;  3J2P A;  4I9Q A;  4DTO A;  2P1Q B;  4J2A A;  2PFT A;  2YB5 A;  1XU3 E;  1Q9X A;  1FZ5 E;  4M3T A;  3NDK A;  2DY4 A;  4M45 A;  1FZ8 E;  4JRQ A;  3C6N B;  1WAJ A;  4JRP A;  4ADN A;  3QET A;  4B08 A;  3SQ2 A;  3SVI A;  2DTU A;  3QEP A;  4JS4 A;  4DTJ A;  3QEV A;  2MZW B;  2LF6 A;  4DU4 A;  2VJ4 A;  1XVF E;  4X5N A;  3QNO A;  4QND A;  3LZI A;  2JHC A;  4J2E A;  2E31 A;  4DTU A;  4KHU A;  4DTR A;  4DTX A;  4DTN A;  2B1E A;  1MTY G;  3QEI A;  4GAM C;  2JHP A;  2H4T A;  2MMB A;  4KI6 A;  4KHN A;  1XVC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...