1FZIE

Methane monooxygenase hydroxylase, form i pressurized with xenon gas
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 61
structure length 162
sequence length 162
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE02
1FYZE 1XMFE 1MHYG 1FZ3E 1XVBE 1FZ7E 1FZ5E 4GAMC 1FZ2E 1FZHE 1XU5E 1FZ9E 1XMGE 1FZ1E 1XVGE 1FZ4E 1FZ0E 1XU3E 1XVDE 1FZ6E 1XMHE 1MMOG 1FZIE 1FZ8E 1XVEE 1MTYG 1XVFE 1MHZG 1XVCE
chains in the Genus database with same CATH superfamily
1FYZE 3OGKB 3NAEA 4DTRA 3NCIA 2B8IA 4JRQA 2VIXA 1P22A 2JHAA 4FJGA 4KHUA 4M3RA 4ADOA 2JH8A 4FJ5A 3UO3A 1FZ7E 4FK2A 3SQ4A 3E4YA 1LDKE 3CQ8A 3SQ2A 4M3XA 1FZ5E 4FK4A 1N1CA 2LF6A 1FZ2E 4FJ9A 2VJ5A 4M42A 2DY4A 2MZWB 1XVGE 3QEPA 4J2EA 2OVQB 3SVIA 5IZ7A 4HCCA 4J2BA 3QNNA 4FVMA 3SQ0A 2FW3A 2OVRB 1XMHE 3J27A 3MKSB 2VJ4A 3SI6A 3C6PB 3SNNA 3C6NB 3SUPA 4JS5A 4HCBA 4M45A 4KHSA 4M3WA 4DTJA 4JS4A 3C95A 3CFRA 1XVCE 3SUOA 3KD5E 4E3SA 1XMFE 3SCXA 1NEXB 1MHYG 4FJHA 1FPOA 3HGKE 2YB5A 4RL5A 4FJXA 3K2OA 3LDBA 3QEVA 3RMAA 2OYQA 4ICGC 2LF3A 2P1MB 4J2DA 3V7DB 4KHYA 1FZ9E 1FZ1E 4EYWA 4AI6A 3L1NA 3N1BA 3TAFA 1CLQA 2JQTA 3WSOA 4DU4A 3SUNA 4J2AA 3NDKA 3NE6A 4DU3A 4AKHA 4FJMA 1XVDE 3UIQA 4I9LA 4AKGA 3TABA 1MMOG 4DTOA 3NHGA 3TAGA 3OGLB 2P5GA 2K5SA 2JPNA 3N1EA 1XVEE 2QXFA 4M3YA 3LD8A 2FYOA 1JW2A 3OGMB 1XVFE 1MHZG 3UO2A 4DTUA 4KI6A 1Q9YA 5IBKB 1XL3C 3C94A 3RMBA 1FZ3E 2RCUA 3HGLA 4QNDA 1XVBE 4DTMA 3RMDA 1IH7A 2P1QB 4I9QA 1FS1A 4EPHA 2P5OA 3QEIA 3QERA 4RNGA 3TAEA 3E4WA 3QEWA 4GAMC 3S9HA 3C6OB 2E31A 3LZJA 3RMCA 1WAJA 1XMGE 3SPYA 1IG9A 2JHPA 4DTSA 1FXXA 2P1PB 1FZ4E 2B1EA 3J2PA 4KHWA 2ATQA 3L2OB 4B08A 4DTXA 1WAFA 4RG8A 4KHQA 4FJJA 3L0MA 4X5NA 3TJYA 3QNOA 3QESA 2JHCA 2MW2A 2OZMA 3HL8A 1FZIE 3TL8B 3CFOA 4DTPA 2JH9A 4IT5A 4FJKA 1MTYG 3QEXA 2OZSA 4FJ7A 2DTUA 3SUQA 3SQ1A 2P1OB 4KI4A 4FK0A 2MMBA 3LZIA 2B7MA 3LDSA 3KD1E 5IREA 4M3ZA 3SPZA 2E32A 5H37A 4DTNA 2P1NB 2DEBA 3NGIA 4FJLA 4X5MA 2RKHA 1Q9XA 4M3UA 1FZHE 1XU5E 4E4BA 3L8BA 4AKIA 4FJ8A 3QETA 4M3TA 3SJJA 2HD0A 3BVOA 3HP9A 4M41A 4I6JB 1FZ0E 1XU3E 2PFTA 3RWUA 1FZ6E 4FJIA 4EP9A 4ADNA 4JRPA 3CFPA 2H4TA 4FJNA 1FZ8E 4KHNA 2OVPB 2PFVA 4DU1A 4QNCA
chains in the Genus database with same CATH topology
1FYZE 3OGKB 3NAEA 4DTRA 3NCIA 2B8IA 4JRQA 2VIXA 1P22A 2JHAA 4FJGA 4KHUA 4M3RA 4ADOA 2JH8A 4FJ5A 4FK2A 1FZ7E 3SQ4A 3E4YA 1LDKE 3CQ8A 3SQ2A 4M3XA 1FZ5E 4FK4A 2LF6A 1FZ2E 4FJ9A 2VJ5A 4M42A 2DY4A 2MZWB 1XVGE 3QEPA 4J2EA 2OVQB 3SVIA 5IZ7A 4HCCA 4J2BA 3QNNA 4FVMA 3SQ0A 2FW3A 2OVRB 1XMHE 3J27A 3MKSB 2VJ4A 3SI6A 3C6PB 3SNNA 3C6NB 3SUPA 4JS5A 4HCBA 4M45A 4KHSA 4M3WA 4DTJA 4JS4A 3C95A 3CFRA 1XVCE 3SUOA 3KD5E 4E3SA 1XMFE 3SCXA 1NEXB 1MHYG 4FJHA 3HGKE 2YB5A 4RL5A 4FJXA 3K2OA 3LDBA 3QEVA 3RMAA 2OYQA 2LF3A 2P1MB 4J2DA 3V7DB 4KHYA 1FZ9E 1FZ1E 4EYWA 4AI6A 3L1NA 3N1BA 3TAFA 1CLQA 3WSOA 4DU4A 3SUNA 4J2AA 3NDKA 3NE6A 4DU3A 4AKHA 4FJMA 1XVDE 3UIQA 4I9LA 4AKGA 3TABA 1MMOG 4DTOA 3NHGA 3TAGA 3OGLB 2P5GA 2JPNA 3N1EA 1XVEE 2QXFA 4M3YA 3LD8A 2FYOA 3OGMB 1XVFE 1MHZG 4DTUA 4KI6A 1Q9YA 5IBKB 1XL3C 3C94A 3RMBA 1FZ3E 2RCUA 3HGLA 4QNDA 1XVBE 4DTMA 3RMDA 1IH7A 2P1QB 4I9QA 1FS1A 4EPHA 2P5OA 3QEIA 3QERA 4RNGA 3TAEA 3E4WA 3QEWA 4GAMC 3S9HA 3C6OB 2E31A 3LZJA 3RMCA 1WAJA 1XMGE 3SPYA 1IG9A 2JHPA 4DTSA 1FXXA 2P1PB 1FZ4E 2B1EA 3J2PA 4KHWA 2ATQA 3L2OB 4B08A 4DTXA 1WAFA 4RG8A 4KHQA 4FJJA 3L0MA 4X5NA 3TJYA 3QNOA 3QESA 2JHCA 2OZMA 3HL8A 1FZIE 3TL8B 3CFOA 4DTPA 2JH9A 4FJKA 1MTYG 3QEXA 2OZSA 4FJ7A 2DTUA 3SUQA 3SQ1A 2P1OB 4KI4A 4FK0A 2MMBA 3LZIA 2B7MA 3LDSA 3KD1E 5IREA 4M3ZA 3SPZA 2E32A 5H37A 4DTNA 2P1NB 2DEBA 3NGIA 4FJLA 4X5MA 1Q9XA 4M3UA 1FZHE 1XU5E 4E4BA 3L8BA 4AKIA 4FJ8A 3QETA 4M3TA 3SJJA 2HD0A 4M41A 3HP9A 4I6JB 1FZ0E 1XU3E 2PFTA 3RWUA 1FZ6E 4FJIA 4EP9A 4ADNA 4JRPA 3CFPA 2H4TA 4FJNA 1FZ8E 4KHNA 2OVPB 2PFVA 4DU1A 4QNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYZ E;  1XMF E;  1MHY G;  1FZ3 E;  1XVB E;  1FZ7 E;  1FZ5 E;  4GAM C;  1FZ2 E;  1FZH E;  1XU5 E;  1FZ9 E;  1XMG E;  1FZ1 E;  1XVG E;  1FZ4 E;  1FZ0 E;  1XU3 E;  1XVD E;  1FZ6 E;  1XMH E;  1MMO G;  1FZI E;  1FZ8 E;  1XVE E;  1MTY G;  1XVF E;  1MHZ G;  1XVC E; 
#chains in the Genus database with same CATH topology
 1FYZ E;  3OGK B;  3NAE A;  4DTR A;  3NCI A;  2B8I A;  4JRQ A;  2VIX A;  1P22 A;  2JHA A;  4FJG A;  4KHU A;  4M3R A;  4ADO A;  2JH8 A;  4FJ5 A;  3UO3 A;  1FZ7 E;  4FK2 A;  3SQ4 A;  3E4Y A;  1LDK E;  3CQ8 A;  3SQ2 A;  4M3X A;  1FZ5 E;  4FK4 A;  1N1C A;  2LF6 A;  1FZ2 E;  4FJ9 A;  2VJ5 A;  4M42 A;  2DY4 A;  2MZW B;  1XVG E;  3QEP A;  4J2E A;  2OVQ B;  3SVI A;  5IZ7 A;  4HCC A;  4J2B A;  3QNN A;  4FVM A;  3SQ0 A;  2FW3 A;  2OVR B;  1XMH E;  3J27 A;  3MKS B;  2VJ4 A;  3SI6 A;  3C6P B;  3SNN A;  3C6N B;  3SUP A;  4JS5 A;  4HCB A;  4M45 A;  4KHS A;  4M3W A;  4DTJ A;  4JS4 A;  3C95 A;  3CFR A;  1XVC E;  3SUO A;  3KD5 E;  4E3S A;  1XMF E;  3SCX A;  1NEX B;  1MHY G;  4FJH A;  1FPO A;  3HGK E;  2YB5 A;  4RL5 A;  4FJX A;  3K2O A;  3LDB A;  3QEV A;  3RMA A;  2OYQ A;  4ICG C;  2LF3 A;  2P1M B;  4J2D A;  3V7D B;  4KHY A;  1FZ9 E;  1FZ1 E;  4EYW A;  4AI6 A;  3L1N A;  3N1B A;  3TAF A;  1CLQ A;  2JQT A;  3WSO A;  4DU4 A;  3SUN A;  4J2A A;  3NDK A;  3NE6 A;  4DU3 A;  4AKH A;  4FJM A;  1XVD E;  3UIQ A;  4I9L A;  4AKG A;  3TAB A;  1MMO G;  4DTO A;  3NHG A;  3TAG A;  3OGL B;  2P5G A;  2K5S A;  2JPN A;  3N1E A;  1XVE E;  2QXF A;  4M3Y A;  3LD8 A;  2FYO A;  1JW2 A;  3OGM B;  1XVF E;  1MHZ G;  3UO2 A;  4DTU A;  4KI6 A;  1Q9Y A;  5IBK B;  1XL3 C;  3C94 A;  3RMB A;  1FZ3 E;  2RCU A;  3HGL A;  4QND A;  1XVB E;  4DTM A;  3RMD A;  1IH7 A;  2P1Q B;  4I9Q A;  1FS1 A;  4EPH A;  2P5O A;  3QEI A;  3QER A;  4RNG A;  3TAE A;  3E4W A;  3QEW A;  4GAM C;  3S9H A;  3C6O B;  2E31 A;  3LZJ A;  3RMC A;  1WAJ A;  1XMG E;  3SPY A;  1IG9 A;  2JHP A;  4DTS A;  1FXX A;  2P1P B;  1FZ4 E;  2B1E A;  3J2P A;  4KHW A;  2ATQ A;  3L2O B;  4B08 A;  4DTX A;  1WAF A;  4RG8 A;  4KHQ A;  4FJJ A;  3L0M A;  4X5N A;  3TJY A;  3QNO A;  3QES A;  2JHC A;  2MW2 A;  2OZM A;  3HL8 A;  1FZI E;  3TL8 B;  3CFO A;  4DTP A;  2JH9 A;  4IT5 A;  4FJK A;  1MTY G;  3QEX A;  2OZS A;  4FJ7 A;  2DTU A;  3SUQ A;  3SQ1 A;  2P1O B;  4KI4 A;  4FK0 A;  2MMB A;  3LZI A;  2B7M A;  3LDS A;  3KD1 E;  5IRE A;  4M3Z A;  3SPZ A;  2E32 A;  5H37 A;  4DTN A;  2P1N B;  2DEB A;  3NGI A;  4FJL A;  4X5M A;  2RKH A;  1Q9X A;  4M3U A;  1FZH E;  1XU5 E;  4E4B A;  3L8B A;  4AKI A;  4FJ8 A;  3QET A;  4M3T A;  3SJJ A;  2HD0 A;  3BVO A;  3HP9 A;  4M41 A;  4I6J B;  1FZ0 E;  1XU3 E;  2PFT A;  3RWU A;  1FZ6 E;  4FJI A;  4EP9 A;  4ADN A;  4JRP A;  3CFP A;  2H4T A;  4FJN A;  1FZ8 E;  4KHN A;  2OVP B;  2PFV A;  4DU1 A;  4QNC A; 
#chains in the Genus database with same CATH homology
 1FYZ E;  3OGK B;  3NAE A;  4DTR A;  3NCI A;  2B8I A;  4JRQ A;  2VIX A;  1P22 A;  2JHA A;  4FJG A;  4KHU A;  4M3R A;  4ADO A;  2JH8 A;  4FJ5 A;  4FK2 A;  1FZ7 E;  3SQ4 A;  3E4Y A;  1LDK E;  3CQ8 A;  3SQ2 A;  4M3X A;  1FZ5 E;  4FK4 A;  2LF6 A;  1FZ2 E;  4FJ9 A;  2VJ5 A;  4M42 A;  2DY4 A;  2MZW B;  1XVG E;  3QEP A;  4J2E A;  2OVQ B;  3SVI A;  5IZ7 A;  4HCC A;  4J2B A;  3QNN A;  4FVM A;  3SQ0 A;  2FW3 A;  2OVR B;  1XMH E;  3J27 A;  3MKS B;  2VJ4 A;  3SI6 A;  3C6P B;  3SNN A;  3C6N B;  3SUP A;  4JS5 A;  4HCB A;  4M45 A;  4KHS A;  4M3W A;  4DTJ A;  4JS4 A;  3C95 A;  3CFR A;  1XVC E;  3SUO A;  3KD5 E;  4E3S A;  1XMF E;  3SCX A;  1NEX B;  1MHY G;  4FJH A;  3HGK E;  2YB5 A;  4RL5 A;  4FJX A;  3K2O A;  3LDB A;  3QEV A;  3RMA A;  2OYQ A;  2LF3 A;  2P1M B;  4J2D A;  3V7D B;  4KHY A;  1FZ9 E;  1FZ1 E;  4EYW A;  4AI6 A;  3L1N A;  3N1B A;  3TAF A;  1CLQ A;  3WSO A;  4DU4 A;  3SUN A;  4J2A A;  3NDK A;  3NE6 A;  4DU3 A;  4AKH A;  4FJM A;  1XVD E;  3UIQ A;  4I9L A;  4AKG A;  3TAB A;  1MMO G;  4DTO A;  3NHG A;  3TAG A;  3OGL B;  2P5G A;  2JPN A;  3N1E A;  1XVE E;  2QXF A;  4M3Y A;  3LD8 A;  2FYO A;  3OGM B;  1XVF E;  1MHZ G;  4DTU A;  4KI6 A;  1Q9Y A;  5IBK B;  1XL3 C;  3C94 A;  3RMB A;  1FZ3 E;  2RCU A;  3HGL A;  4QND A;  1XVB E;  4DTM A;  3RMD A;  1IH7 A;  2P1Q B;  4I9Q A;  1FS1 A;  4EPH A;  2P5O A;  3QEI A;  3QER A;  4RNG A;  3TAE A;  3E4W A;  3QEW A;  4GAM C;  3S9H A;  3C6O B;  2E31 A;  3LZJ A;  3RMC A;  1WAJ A;  1XMG E;  3SPY A;  1IG9 A;  2JHP A;  4DTS A;  1FXX A;  2P1P B;  1FZ4 E;  2B1E A;  3J2P A;  4KHW A;  2ATQ A;  3L2O B;  4B08 A;  4DTX A;  1WAF A;  4RG8 A;  4KHQ A;  4FJJ A;  3L0M A;  4X5N A;  3TJY A;  3QNO A;  3QES A;  2JHC A;  2OZM A;  3HL8 A;  1FZI E;  3TL8 B;  3CFO A;  4DTP A;  2JH9 A;  4FJK A;  1MTY G;  3QEX A;  2OZS A;  4FJ7 A;  2DTU A;  3SUQ A;  3SQ1 A;  2P1O B;  4KI4 A;  4FK0 A;  2MMB A;  3LZI A;  2B7M A;  3LDS A;  3KD1 E;  5IRE A;  4M3Z A;  3SPZ A;  2E32 A;  5H37 A;  4DTN A;  2P1N B;  2DEB A;  3NGI A;  4FJL A;  4X5M A;  1Q9X A;  4M3U A;  1FZH E;  1XU5 E;  4E4B A;  3L8B A;  4AKI A;  4FJ8 A;  3QET A;  4M3T A;  3SJJ A;  2HD0 A;  4M41 A;  3HP9 A;  4I6J B;  1FZ0 E;  1XU3 E;  2PFT A;  3RWU A;  1FZ6 E;  4FJI A;  4EP9 A;  4ADN A;  4JRP A;  3CFP A;  2H4T A;  4FJN A;  1FZ8 E;  4KHN A;  2OVP B;  2PFV A;  4DU1 A;  4QNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...