1FZIE

Methane monooxygenase hydroxylase, form i pressurized with xenon gas
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
b'LGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 162
sequence length 162
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE02
1FZ7E 1MHYG 1XMGE 1FZIE 1FZ6E 1XVFE 1XVEE 1MTYG 1XU3E 1XVBE 1XU5E 1XVGE 1XVCE 1MHZG 1FYZE 1XMFE 1FZ0E 1FZ9E 1MMOG 1FZ8E 4GAMC 1FZHE 1FZ4E 1FZ5E 1XMHE 1FZ2E 1XVDE 1FZ3E 1FZ1E
chains in the Genus database with same CATH superfamily
4FJ8A 2MMBA 2RKHA 4AKHA 4M3YA 2E31A 2HD0A 2JHPA 3OGKB 3WSOA 4E3SA 3SQ0A 3SCXA 4DTSA 3SUOA 2MW2A 3LZIA 3UO3A 1XVGE 3C6PB 4FJ7A 1XVCE 1XMFE 2P1OB 3HGLA 4DTRA 3BVOA 3CQ8A 4EP9A 3UIQA 4M3UA 2JH9A 4FJ5A 4FJNA 4DTXA 3CFRA 4X5NA 1FZHE 4FVMA 4QNDA 3TL8B 4FJKA 1CLQA 3RMDA 3TABA 2P1MB 2PFTA 4DU3A 4DTPA 2LF3A 4B08A 3SPYA 4KHYA 4AKIA 2JPNA 3SI6A 2FYOA 2OYQA 2P1NB 1FPOA 4FK2A 4KHQA 1XMGE 4I9LA 2FW3A 3J27A 3QNOA 4EPHA 4FJGA 4EYWA 4FJ9A 3KD5E 3J2PA 4M3WA 1IH7A 4FK4A 4I6JB 1XVFE 2OVQB 3TAFA 3TAGA 2DY4A 1XU3E 1XVBE 4RG8A 3L0MA 3LDSA 4J2AA 1FYZE 2DEBA 1FZ0E 3KD1E 4KHWA 3NHGA 3SNNA 2OZSA 1XL3C 2JHAA 3QEVA 2H4TA 3RMBA 4ADOA 3SUNA 3HGKE 3QNNA 3SUPA 3MKSB 3NDKA 1WAFA 3HP9A 4JS4A 3QERA 4DTJA 2ATQA 1FZ5E 1XMHE 3L2OB 4FJLA 3NGIA 1FZ2E 3C6OB 1Q9XA 4KHUA 1Q9YA 1FZ3E 4HCBA 1FZ1E 4DTMA 4I9QA 4FJHA 3E4YA 1FZ7E 4FJXA 3QEWA 1IG9A 3C6NB 1LDKE 1N1CA 3QETA 2K5SA 1FZIE 3SQ2A 2B8IA 4JRPA 4KHNA 4FJMA 2QXFA 2RCUA 1XVEE 1MTYG 3K2OA 4JRQA 3N1BA 1MHZG 3NCIA 4M3XA 2JQTA 3L1NA 4RL5A 1FZ9E 3CFOA 4ICGC 5H37A 4M42A 1FXXA 4M3RA 4KHSA 5IBKB 4GAMC 4DTOA 2E32A 3SUQA 3TAEA 2P1QB 3QEXA 3SVIA 1NEXB 3RWUA 2YB5A 3S9HA 1FZ4E 3SQ1A 4J2DA 3OGLB 4KI4A 3RMAA 2OVRB 3E4WA 1XVDE 2JHCA 4DTNA 4M3TA 4J2EA 3NE6A 2P1PB 2DTUA 5IZ7A 1MHYG 4E4BA 4IT5A 4X5MA 2P5GA 4JS5A 1FZ6E 2LF6A 4FK0A 3LDBA 4QNCA 1P22A 3V7DB 4DTUA 3L8BA 4AI6A 3UO2A 3CFPA 3OGMB 2JH8A 5IREA 4DU4A 4FJJA 1XU5E 3SJJA 4HCCA 4KI6A 1WAJA 4FJIA 2OVPB 4DU1A 1FS1A 3QESA 1MMOG 3N1EA 1FZ8E 4M45A 3SQ4A 4M3ZA 4ADNA 1JW2A 3QEIA 3HL8A 4AKGA 3SPZA 3QEPA 2VJ5A 4M41A 4J2BA 4RNGA 2PFVA 3C94A 2B7MA 3LZJA 2VJ4A 3LD8A 2B1EA 3RMCA 2P5OA 3NAEA 2VIXA 2OZMA 3C95A 2MZWB 3TJYA
chains in the Genus database with same CATH topology
4FJ8A 2MMBA 4AKHA 4M3YA 2E31A 2HD0A 2JHPA 3OGKB 3WSOA 4E3SA 3SQ0A 3SCXA 4DTSA 3SUOA 3LZIA 1XVGE 3C6PB 4FJ7A 1XVCE 1XMFE 2P1OB 3HGLA 4DTRA 3CQ8A 3UIQA 4EP9A 4M3UA 2JH9A 4FJ5A 4FJNA 4DTXA 3CFRA 4X5NA 1FZHE 4FVMA 4QNDA 3TL8B 4FJKA 1CLQA 3RMDA 3TABA 2P1MB 2PFTA 4DU3A 4DTPA 2LF3A 4B08A 3SPYA 4KHYA 4AKIA 2JPNA 3SI6A 2FYOA 2OYQA 2P1NB 4FK2A 4KHQA 1XMGE 4I9LA 2FW3A 3J27A 3QNOA 4EPHA 4FJGA 4EYWA 4FJ9A 3KD5E 3J2PA 4M3WA 1IH7A 4FK4A 4I6JB 1XVFE 2OVQB 3TAFA 3TAGA 2DY4A 1XU3E 1XVBE 4RG8A 3L0MA 3LDSA 4J2AA 1FYZE 2DEBA 1FZ0E 3KD1E 4KHWA 3NHGA 3SNNA 2OZSA 1XL3C 2JHAA 3QEVA 2H4TA 3RMBA 4ADOA 3SUNA 3HGKE 3QNNA 3SUPA 3MKSB 3NDKA 1WAFA 3HP9A 4JS4A 3QERA 4DTJA 2ATQA 1FZ5E 1XMHE 3L2OB 4FJLA 3NGIA 1FZ2E 3C6OB 1Q9XA 4KHUA 1Q9YA 1FZ3E 4HCBA 1FZ1E 4DTMA 4I9QA 4FJHA 3E4YA 1FZ7E 4FJXA 3QEWA 1IG9A 3C6NB 1LDKE 3QETA 1FZIE 3SQ2A 2B8IA 4JRPA 4KHNA 4FJMA 2QXFA 2RCUA 1XVEE 1MTYG 3K2OA 4JRQA 3N1BA 1MHZG 3NCIA 4M3XA 3L1NA 4RL5A 1FZ9E 3CFOA 5H37A 4M42A 1FXXA 4M3RA 4KHSA 5IBKB 4GAMC 4DTOA 2E32A 3SUQA 3TAEA 2P1QB 3QEXA 3SVIA 1NEXB 3RWUA 2YB5A 3S9HA 1FZ4E 3SQ1A 4J2DA 3OGLB 4KI4A 3RMAA 2OVRB 3E4WA 1XVDE 2JHCA 4DTNA 4M3TA 4J2EA 3NE6A 2P1PB 2DTUA 5IZ7A 1MHYG 4E4BA 4X5MA 2P5GA 4JS5A 1FZ6E 2LF6A 4FK0A 3LDBA 4QNCA 1P22A 3V7DB 4DTUA 3L8BA 4AI6A 3CFPA 3OGMB 2JH8A 5IREA 4DU4A 4FJJA 1XU5E 3SJJA 4HCCA 4KI6A 1WAJA 4FJIA 2OVPB 4DU1A 1FS1A 3QESA 1MMOG 3N1EA 1FZ8E 4M45A 3SQ4A 4M3ZA 4ADNA 3QEIA 3HL8A 4AKGA 3SPZA 3QEPA 2VJ5A 4M41A 4J2BA 4RNGA 2PFVA 3C94A 2B7MA 3LZJA 2VJ4A 3LD8A 2B1EA 3RMCA 2P5OA 3NAEA 2VIXA 2OZMA 3C95A 2MZWB 3TJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ7 E;  1MHY G;  1XMG E;  1FZI E;  1FZ6 E;  1XVF E;  1XVE E;  1MTY G;  1XU3 E;  1XVB E;  1XU5 E;  1XVG E;  1XVC E;  1MHZ G;  1FYZ E;  1XMF E;  1FZ0 E;  1FZ9 E;  1MMO G;  1FZ8 E;  4GAM C;  1FZH E;  1FZ4 E;  1FZ5 E;  1XMH E;  1FZ2 E;  1XVD E;  1FZ3 E;  1FZ1 E; 
#chains in the Genus database with same CATH topology
 4FJ8 A;  2MMB A;  2RKH A;  4AKH A;  4M3Y A;  2E31 A;  2HD0 A;  2JHP A;  3OGK B;  3WSO A;  4E3S A;  3SQ0 A;  3SCX A;  4DTS A;  3SUO A;  2MW2 A;  3LZI A;  3UO3 A;  1XVG E;  3C6P B;  4FJ7 A;  1XVC E;  1XMF E;  2P1O B;  3HGL A;  4DTR A;  3BVO A;  3CQ8 A;  4EP9 A;  3UIQ A;  4M3U A;  2JH9 A;  4FJ5 A;  4FJN A;  4DTX A;  3CFR A;  4X5N A;  1FZH E;  4FVM A;  4QND A;  3TL8 B;  4FJK A;  1CLQ A;  3RMD A;  3TAB A;  2P1M B;  2PFT A;  4DU3 A;  4DTP A;  2LF3 A;  4B08 A;  3SPY A;  4KHY A;  4AKI A;  2JPN A;  3SI6 A;  2FYO A;  2OYQ A;  2P1N B;  1FPO A;  4FK2 A;  4KHQ A;  1XMG E;  4I9L A;  2FW3 A;  3J27 A;  3QNO A;  4EPH A;  4FJG A;  4EYW A;  4FJ9 A;  3KD5 E;  3J2P A;  4M3W A;  1IH7 A;  4FK4 A;  4I6J B;  1XVF E;  2OVQ B;  3TAF A;  3TAG A;  2DY4 A;  1XU3 E;  1XVB E;  4RG8 A;  3L0M A;  3LDS A;  4J2A A;  1FYZ E;  2DEB A;  1FZ0 E;  3KD1 E;  4KHW A;  3NHG A;  3SNN A;  2OZS A;  1XL3 C;  2JHA A;  3QEV A;  2H4T A;  3RMB A;  4ADO A;  3SUN A;  3HGK E;  3QNN A;  3SUP A;  3MKS B;  3NDK A;  1WAF A;  3HP9 A;  4JS4 A;  3QER A;  4DTJ A;  2ATQ A;  1FZ5 E;  1XMH E;  3L2O B;  4FJL A;  3NGI A;  1FZ2 E;  3C6O B;  1Q9X A;  4KHU A;  1Q9Y A;  1FZ3 E;  4HCB A;  1FZ1 E;  4DTM A;  4I9Q A;  4FJH A;  3E4Y A;  1FZ7 E;  4FJX A;  3QEW A;  1IG9 A;  3C6N B;  1LDK E;  1N1C A;  3QET A;  2K5S A;  1FZI E;  3SQ2 A;  2B8I A;  4JRP A;  4KHN A;  4FJM A;  2QXF A;  2RCU A;  1XVE E;  1MTY G;  3K2O A;  4JRQ A;  3N1B A;  1MHZ G;  3NCI A;  4M3X A;  2JQT A;  3L1N A;  4RL5 A;  1FZ9 E;  3CFO A;  4ICG C;  5H37 A;  4M42 A;  1FXX A;  4M3R A;  4KHS A;  5IBK B;  4GAM C;  4DTO A;  2E32 A;  3SUQ A;  3TAE A;  2P1Q B;  3QEX A;  3SVI A;  1NEX B;  3RWU A;  2YB5 A;  3S9H A;  1FZ4 E;  3SQ1 A;  4J2D A;  3OGL B;  4KI4 A;  3RMA A;  2OVR B;  3E4W A;  1XVD E;  2JHC A;  4DTN A;  4M3T A;  4J2E A;  3NE6 A;  2P1P B;  2DTU A;  5IZ7 A;  1MHY G;  4E4B A;  4IT5 A;  4X5M A;  2P5G A;  4JS5 A;  1FZ6 E;  2LF6 A;  4FK0 A;  3LDB A;  4QNC A;  1P22 A;  3V7D B;  4DTU A;  3L8B A;  4AI6 A;  3UO2 A;  3CFP A;  3OGM B;  2JH8 A;  5IRE A;  4DU4 A;  4FJJ A;  1XU5 E;  3SJJ A;  4HCC A;  4KI6 A;  1WAJ A;  4FJI A;  2OVP B;  4DU1 A;  1FS1 A;  3QES A;  1MMO G;  3N1E A;  1FZ8 E;  4M45 A;  3SQ4 A;  4M3Z A;  4ADN A;  1JW2 A;  3QEI A;  3HL8 A;  4AKG A;  3SPZ A;  3QEP A;  2VJ5 A;  4M41 A;  4J2B A;  4RNG A;  2PFV A;  3C94 A;  2B7M A;  3LZJ A;  2VJ4 A;  3LD8 A;  2B1E A;  3RMC A;  2P5O A;  3NAE A;  2VIX A;  2OZM A;  3C95 A;  2MZW B;  3TJY A; 
#chains in the Genus database with same CATH homology
 4FJ8 A;  2MMB A;  4AKH A;  4M3Y A;  2E31 A;  2HD0 A;  2JHP A;  3OGK B;  3WSO A;  4E3S A;  3SQ0 A;  3SCX A;  4DTS A;  3SUO A;  3LZI A;  1XVG E;  3C6P B;  4FJ7 A;  1XVC E;  1XMF E;  2P1O B;  3HGL A;  4DTR A;  3CQ8 A;  3UIQ A;  4EP9 A;  4M3U A;  2JH9 A;  4FJ5 A;  4FJN A;  4DTX A;  3CFR A;  4X5N A;  1FZH E;  4FVM A;  4QND A;  3TL8 B;  4FJK A;  1CLQ A;  3RMD A;  3TAB A;  2P1M B;  2PFT A;  4DU3 A;  4DTP A;  2LF3 A;  4B08 A;  3SPY A;  4KHY A;  4AKI A;  2JPN A;  3SI6 A;  2FYO A;  2OYQ A;  2P1N B;  4FK2 A;  4KHQ A;  1XMG E;  4I9L A;  2FW3 A;  3J27 A;  3QNO A;  4EPH A;  4FJG A;  4EYW A;  4FJ9 A;  3KD5 E;  3J2P A;  4M3W A;  1IH7 A;  4FK4 A;  4I6J B;  1XVF E;  2OVQ B;  3TAF A;  3TAG A;  2DY4 A;  1XU3 E;  1XVB E;  4RG8 A;  3L0M A;  3LDS A;  4J2A A;  1FYZ E;  2DEB A;  1FZ0 E;  3KD1 E;  4KHW A;  3NHG A;  3SNN A;  2OZS A;  1XL3 C;  2JHA A;  3QEV A;  2H4T A;  3RMB A;  4ADO A;  3SUN A;  3HGK E;  3QNN A;  3SUP A;  3MKS B;  3NDK A;  1WAF A;  3HP9 A;  4JS4 A;  3QER A;  4DTJ A;  2ATQ A;  1FZ5 E;  1XMH E;  3L2O B;  4FJL A;  3NGI A;  1FZ2 E;  3C6O B;  1Q9X A;  4KHU A;  1Q9Y A;  1FZ3 E;  4HCB A;  1FZ1 E;  4DTM A;  4I9Q A;  4FJH A;  3E4Y A;  1FZ7 E;  4FJX A;  3QEW A;  1IG9 A;  3C6N B;  1LDK E;  3QET A;  1FZI E;  3SQ2 A;  2B8I A;  4JRP A;  4KHN A;  4FJM A;  2QXF A;  2RCU A;  1XVE E;  1MTY G;  3K2O A;  4JRQ A;  3N1B A;  1MHZ G;  3NCI A;  4M3X A;  3L1N A;  4RL5 A;  1FZ9 E;  3CFO A;  5H37 A;  4M42 A;  1FXX A;  4M3R A;  4KHS A;  5IBK B;  4GAM C;  4DTO A;  2E32 A;  3SUQ A;  3TAE A;  2P1Q B;  3QEX A;  3SVI A;  1NEX B;  3RWU A;  2YB5 A;  3S9H A;  1FZ4 E;  3SQ1 A;  4J2D A;  3OGL B;  4KI4 A;  3RMA A;  2OVR B;  3E4W A;  1XVD E;  2JHC A;  4DTN A;  4M3T A;  4J2E A;  3NE6 A;  2P1P B;  2DTU A;  5IZ7 A;  1MHY G;  4E4B A;  4X5M A;  2P5G A;  4JS5 A;  1FZ6 E;  2LF6 A;  4FK0 A;  3LDB A;  4QNC A;  1P22 A;  3V7D B;  4DTU A;  3L8B A;  4AI6 A;  3CFP A;  3OGM B;  2JH8 A;  5IRE A;  4DU4 A;  4FJJ A;  1XU5 E;  3SJJ A;  4HCC A;  4KI6 A;  1WAJ A;  4FJI A;  2OVP B;  4DU1 A;  1FS1 A;  3QES A;  1MMO G;  3N1E A;  1FZ8 E;  4M45 A;  3SQ4 A;  4M3Z A;  4ADN A;  3QEI A;  3HL8 A;  4AKG A;  3SPZ A;  3QEP A;  2VJ5 A;  4M41 A;  4J2B A;  4RNG A;  2PFV A;  3C94 A;  2B7M A;  3LZJ A;  2VJ4 A;  3LD8 A;  2B1E A;  3RMC A;  2P5O A;  3NAE A;  2VIX A;  2OZM A;  3C95 A;  2MZW B;  3TJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...