1FZIE

Methane monooxygenase hydroxylase, form i pressurized with xenon gas
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
162
structure length
162
Chain Sequence
LGIHSNDTRDAWVNKIAQLNTLEKAAEMLKQFRMDHTTPFRNSYELDNDYLWIEAKLEEKVAVLKARAFNEVDFRHKTAFGEDAKSVLDGTVAKMNAAKDKWEAEKIHIGFRQAYKPPIMPVNYFLDGERQLGTRLMELRNLNYYDTPLEELRKQRGVRVVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords METHANE MONOOXYGENASE COMPONENT A, ALPHA CHAIN
total genus 61
structure length 162
sequence length 162
chains with identical sequence F
ec nomenclature ec 1.14.13.25: Methane monooxygenase (soluble).
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02964 MeMO_Hyd_G Methane monooxygenase, hydrolase gamma chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.10 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE01
1.20.1280.30 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1fziE02
1FZ1E 1XMFE 1XMGE 1XMHE 1XVEE 1XVFE 1FZ7E 1XVBE 1FZ5E 1XU3E 1FZHE 1MHYG 1MTYG 1FZ0E 1XVGE 1FZ9E 1FZ6E 1FZ3E 1XVDE 1FZ4E 1FZ2E 1FZIE 4GAMC 1MMOG 1FYZE 1XU5E 1FZ8E 1XVCE 1MHZG
chains in the Genus database with same CATH superfamily
4FJ5A 4M3YA 4E3SA 3SUQA 2YB5A 4HCBA 4M3ZA 5IZ7A 2LF3A 4ADNA 4JRQA 3QEXA 3L8BA 4RG8A 3LDSA 4FJXA 2MMBA 2DEBA 3WSOA 3RMCA 2E32A 2P5OA 2VJ5A 4KHYA 3L0MA 1XU3E 4DTPA 1FZ0E 3NCIA 4JRPA 3NAEA 1XL3C 4I6JB 1FZ6E 4X5NA 2FW3A 4M45A 1FZ2E 3SQ0A 2OZSA 4QNDA 3C94A 4KHNA 3HGKE 1P22A 1JW2A 4DTRA 3MKSB 2LF6A 3SCXA 2JHAA 3NDKA 1MMOG 4DU1A 4DTSA 4HCCA 4EYWA 4DTOA 2JHCA 5IBKB 4FJNA 4J2DA 3SUNA 4M42A 3QEPA 4E4BA 4X5MA 3NGIA 2P1OB 3QESA 4M3TA 4AI6A 1XMFE 2OYQA 2VIXA 2JH9A 5H37A 2PFTA 3NHGA 4M3RA 4M3WA 3UO3A 2OZMA 1XMHE 3OGLB 4I9LA 1Q9XA 3SQ2A 1FZ7E 1MHYG 3HGLA 1Q9YA 1XVGE 3E4YA 3SI6A 2E31A 3KD5E 1NEXB 3QEWA 1FZ3E 1XVDE 4FVMA 3TABA 3K2OA 4DU3A 4DU4A 2B8IA 3OGKB 3SUPA 2P1MB 4FJ9A 3LD8A 4GAMC 4ICGC 3C6NB 4J2AA 4M41A 4FJHA 3SNNA 2JPNA 3J2PA 1XU5E 4DTXA 3C6PB 3SQ4A 1CLQA 1FS1A 3SJJA 3TAFA 2P1NB 3V7DB 4B08A 4KI6A 2OVPB 4KHUA 4M3UA 1XMGE 3TAEA 4AKIA 3RMAA 3RMBA 1IG9A 4DTJA 1XVEE 3QNNA 4KHSA 1XVFE 4QNCA 3TAGA 4FJKA 4RL5A 1FPOA 4FK4A 1XVBE 1FZHE 3LDBA 4I9QA 1MTYG 3BVOA 3N1EA 1FZ9E 2MZWB 3E4WA 4J2BA 2ATQA 2B7MA 3CFOA 2JH8A 3RWUA 2FYOA 3RMDA 4FJGA 4FJLA 4FK2A 1N1CA 3L1NA 4FJ8A 2OVQB 2OVRB 2H4TA 4JS4A 4DTMA 2P1PB 4DTNA 2HD0A 3OGMB 4KI4A 3QERA 3C95A 4FJMA 3TL8B 5IREA 1MHZG 3L2OB 4EPHA 1FZ1E 3HP9A 3CFRA 3SUOA 4J2EA 2JHPA 2MW2A 4AKHA 3QETA 1FXXA 2DY4A 1WAFA 4AKGA 2RCUA 4IT5A 2P5GA 3SPZA 4FJJA 3SPYA 3KD1E 1FZ5E 1IH7A 2K5SA 2RKHA 4EP9A 4DTUA 3TJYA 3UO2A 4KHQA 3QEIA 3QNOA 4FK0A 3CFPA 1LDKE 1FZ4E 3SQ1A 1FZIE 3HL8A 3UIQA 3CQ8A 3C6OB 1WAJA 3J27A 4JS5A 4FJIA 2QXFA 3S9HA 3N1BA 4KHWA 2VJ4A 2P1QB 1FYZE 2PFVA 4M3XA 2JQTA 2DTUA 1FZ8E 1XVCE 2B1EA 4FJ7A 4ADOA 3NE6A 3QEVA 3LZJA 3SVIA 4RNGA 3LZIA
chains in the Genus database with same CATH topology
4FJ5A 4M3YA 4E3SA 3SUQA 2YB5A 4HCBA 4M3ZA 5IZ7A 2LF3A 4ADNA 4JRQA 3QEXA 3L8BA 4RG8A 3LDSA 4FJXA 2MMBA 2DEBA 3WSOA 3RMCA 2E32A 2P5OA 2VJ5A 4KHYA 3L0MA 1XU3E 4DTPA 1FZ0E 3NCIA 4JRPA 3NAEA 1XL3C 4I6JB 1FZ6E 4X5NA 2FW3A 4M45A 1FZ2E 3SQ0A 2OZSA 4QNDA 3C94A 4KHNA 3HGKE 1P22A 4DTRA 3MKSB 2LF6A 3SCXA 2JHAA 3NDKA 1MMOG 4DU1A 4DTSA 4HCCA 4EYWA 4DTOA 2JHCA 5IBKB 4FJNA 4J2DA 3SUNA 4M42A 3QEPA 4E4BA 4X5MA 3NGIA 2P1OB 3QESA 4M3TA 4AI6A 1XMFE 2OYQA 2VIXA 2JH9A 5H37A 2PFTA 3NHGA 4M3RA 4M3WA 2OZMA 1XMHE 3OGLB 4I9LA 1Q9XA 3SQ2A 1FZ7E 1MHYG 3HGLA 1Q9YA 1XVGE 3E4YA 3SI6A 2E31A 3KD5E 1NEXB 3QEWA 1FZ3E 1XVDE 4FVMA 3TABA 3K2OA 4DU3A 4DU4A 2B8IA 3OGKB 3SUPA 2P1MB 4FJ9A 3LD8A 4GAMC 3C6NB 4J2AA 4M41A 4FJHA 3SNNA 2JPNA 3J2PA 1XU5E 4DTXA 3C6PB 3SQ4A 1CLQA 1FS1A 3SJJA 3TAFA 2P1NB 3V7DB 4B08A 4KI6A 2OVPB 4KHUA 4M3UA 1XMGE 3TAEA 4AKIA 3RMAA 3RMBA 1IG9A 4DTJA 1XVEE 3QNNA 4KHSA 1XVFE 4QNCA 3TAGA 4FJKA 4RL5A 4FK4A 1XVBE 1FZHE 3LDBA 4I9QA 1MTYG 3N1EA 1FZ9E 2MZWB 3E4WA 4J2BA 2ATQA 2B7MA 3CFOA 2JH8A 3RWUA 2FYOA 3RMDA 4FJGA 4FJLA 4FK2A 3L1NA 4FJ8A 2OVQB 2OVRB 2H4TA 4JS4A 4DTMA 2P1PB 4DTNA 2HD0A 3OGMB 4KI4A 3QERA 3C95A 4FJMA 3TL8B 5IREA 1MHZG 3L2OB 4EPHA 1FZ1E 3HP9A 3CFRA 3SUOA 4J2EA 2JHPA 4AKHA 3QETA 1FXXA 2DY4A 1WAFA 4AKGA 2RCUA 2P5GA 3SPZA 4FJJA 3SPYA 3KD1E 1FZ5E 1IH7A 4EP9A 4DTUA 3TJYA 4KHQA 3QEIA 3QNOA 4FK0A 3CFPA 1LDKE 1FZ4E 3SQ1A 1FZIE 3HL8A 3UIQA 3CQ8A 3C6OB 1WAJA 3J27A 4JS5A 4FJIA 2QXFA 3S9HA 3N1BA 4KHWA 2P1QB 1FYZE 2PFVA 2VJ4A 4M3XA 2DTUA 1FZ8E 1XVCE 2B1EA 4FJ7A 4ADOA 3NE6A 3QEVA 3LZJA 3SVIA 4RNGA 3LZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZ1 E;  1XMF E;  1XMG E;  1XMH E;  1XVE E;  1XVF E;  1FZ7 E;  1XVB E;  1FZ5 E;  1XU3 E;  1FZH E;  1MHY G;  1MTY G;  1FZ0 E;  1XVG E;  1FZ9 E;  1FZ6 E;  1FZ3 E;  1XVD E;  1FZ4 E;  1FZ2 E;  1FZI E;  4GAM C;  1MMO G;  1FYZ E;  1XU5 E;  1FZ8 E;  1XVC E;  1MHZ G; 
#chains in the Genus database with same CATH topology
 4FJ5 A;  4M3Y A;  4E3S A;  3SUQ A;  2YB5 A;  4HCB A;  4M3Z A;  5IZ7 A;  2LF3 A;  4ADN A;  4JRQ A;  3QEX A;  3L8B A;  4RG8 A;  3LDS A;  4FJX A;  2MMB A;  2DEB A;  3WSO A;  3RMC A;  2E32 A;  2P5O A;  2VJ5 A;  4KHY A;  3L0M A;  1XU3 E;  4DTP A;  1FZ0 E;  3NCI A;  4JRP A;  3NAE A;  1XL3 C;  4I6J B;  1FZ6 E;  4X5N A;  2FW3 A;  4M45 A;  1FZ2 E;  3SQ0 A;  2OZS A;  4QND A;  3C94 A;  4KHN A;  3HGK E;  1P22 A;  1JW2 A;  4DTR A;  3MKS B;  2LF6 A;  3SCX A;  2JHA A;  3NDK A;  1MMO G;  4DU1 A;  4DTS A;  4HCC A;  4EYW A;  4DTO A;  2JHC A;  5IBK B;  4FJN A;  4J2D A;  3SUN A;  4M42 A;  3QEP A;  4E4B A;  4X5M A;  3NGI A;  2P1O B;  3QES A;  4M3T A;  4AI6 A;  1XMF E;  2OYQ A;  2VIX A;  2JH9 A;  5H37 A;  2PFT A;  3NHG A;  4M3R A;  4M3W A;  3UO3 A;  2OZM A;  1XMH E;  3OGL B;  4I9L A;  1Q9X A;  3SQ2 A;  1FZ7 E;  1MHY G;  3HGL A;  1Q9Y A;  1XVG E;  3E4Y A;  3SI6 A;  2E31 A;  3KD5 E;  1NEX B;  3QEW A;  1FZ3 E;  1XVD E;  4FVM A;  3TAB A;  3K2O A;  4DU3 A;  4DU4 A;  2B8I A;  3OGK B;  3SUP A;  2P1M B;  4FJ9 A;  3LD8 A;  4GAM C;  4ICG C;  3C6N B;  4J2A A;  4M41 A;  4FJH A;  3SNN A;  2JPN A;  3J2P A;  1XU5 E;  4DTX A;  3C6P B;  3SQ4 A;  1CLQ A;  1FS1 A;  3SJJ A;  3TAF A;  2P1N B;  3V7D B;  4B08 A;  4KI6 A;  2OVP B;  4KHU A;  4M3U A;  1XMG E;  3TAE A;  4AKI A;  3RMA A;  3RMB A;  1IG9 A;  4DTJ A;  1XVE E;  3QNN A;  4KHS A;  1XVF E;  4QNC A;  3TAG A;  4FJK A;  4RL5 A;  1FPO A;  4FK4 A;  1XVB E;  1FZH E;  3LDB A;  4I9Q A;  1MTY G;  3BVO A;  3N1E A;  1FZ9 E;  2MZW B;  3E4W A;  4J2B A;  2ATQ A;  2B7M A;  3CFO A;  2JH8 A;  3RWU A;  2FYO A;  3RMD A;  4FJG A;  4FJL A;  4FK2 A;  1N1C A;  3L1N A;  4FJ8 A;  2OVQ B;  2OVR B;  2H4T A;  4JS4 A;  4DTM A;  2P1P B;  4DTN A;  2HD0 A;  3OGM B;  4KI4 A;  3QER A;  3C95 A;  4FJM A;  3TL8 B;  5IRE A;  1MHZ G;  3L2O B;  4EPH A;  1FZ1 E;  3HP9 A;  3CFR A;  3SUO A;  4J2E A;  2JHP A;  2MW2 A;  4AKH A;  3QET A;  1FXX A;  2DY4 A;  1WAF A;  4AKG A;  2RCU A;  4IT5 A;  2P5G A;  3SPZ A;  4FJJ A;  3SPY A;  3KD1 E;  1FZ5 E;  1IH7 A;  2K5S A;  2RKH A;  4EP9 A;  4DTU A;  3TJY A;  3UO2 A;  4KHQ A;  3QEI A;  3QNO A;  4FK0 A;  3CFP A;  1LDK E;  1FZ4 E;  3SQ1 A;  1FZI E;  3HL8 A;  3UIQ A;  3CQ8 A;  3C6O B;  1WAJ A;  3J27 A;  4JS5 A;  4FJI A;  2QXF A;  3S9H A;  3N1B A;  4KHW A;  2VJ4 A;  2P1Q B;  1FYZ E;  2PFV A;  4M3X A;  2JQT A;  2DTU A;  1FZ8 E;  1XVC E;  2B1E A;  4FJ7 A;  4ADO A;  3NE6 A;  3QEV A;  3LZJ A;  3SVI A;  4RNG A;  3LZI A; 
#chains in the Genus database with same CATH homology
 4FJ5 A;  4M3Y A;  4E3S A;  3SUQ A;  2YB5 A;  4HCB A;  4M3Z A;  5IZ7 A;  2LF3 A;  4ADN A;  4JRQ A;  3QEX A;  3L8B A;  4RG8 A;  3LDS A;  4FJX A;  2MMB A;  2DEB A;  3WSO A;  3RMC A;  2E32 A;  2P5O A;  2VJ5 A;  4KHY A;  3L0M A;  1XU3 E;  4DTP A;  1FZ0 E;  3NCI A;  4JRP A;  3NAE A;  1XL3 C;  4I6J B;  1FZ6 E;  4X5N A;  2FW3 A;  4M45 A;  1FZ2 E;  3SQ0 A;  2OZS A;  4QND A;  3C94 A;  4KHN A;  3HGK E;  1P22 A;  4DTR A;  3MKS B;  2LF6 A;  3SCX A;  2JHA A;  3NDK A;  1MMO G;  4DU1 A;  4DTS A;  4HCC A;  4EYW A;  4DTO A;  2JHC A;  5IBK B;  4FJN A;  4J2D A;  3SUN A;  4M42 A;  3QEP A;  4E4B A;  4X5M A;  3NGI A;  2P1O B;  3QES A;  4M3T A;  4AI6 A;  1XMF E;  2OYQ A;  2VIX A;  2JH9 A;  5H37 A;  2PFT A;  3NHG A;  4M3R A;  4M3W A;  2OZM A;  1XMH E;  3OGL B;  4I9L A;  1Q9X A;  3SQ2 A;  1FZ7 E;  1MHY G;  3HGL A;  1Q9Y A;  1XVG E;  3E4Y A;  3SI6 A;  2E31 A;  3KD5 E;  1NEX B;  3QEW A;  1FZ3 E;  1XVD E;  4FVM A;  3TAB A;  3K2O A;  4DU3 A;  4DU4 A;  2B8I A;  3OGK B;  3SUP A;  2P1M B;  4FJ9 A;  3LD8 A;  4GAM C;  3C6N B;  4J2A A;  4M41 A;  4FJH A;  3SNN A;  2JPN A;  3J2P A;  1XU5 E;  4DTX A;  3C6P B;  3SQ4 A;  1CLQ A;  1FS1 A;  3SJJ A;  3TAF A;  2P1N B;  3V7D B;  4B08 A;  4KI6 A;  2OVP B;  4KHU A;  4M3U A;  1XMG E;  3TAE A;  4AKI A;  3RMA A;  3RMB A;  1IG9 A;  4DTJ A;  1XVE E;  3QNN A;  4KHS A;  1XVF E;  4QNC A;  3TAG A;  4FJK A;  4RL5 A;  4FK4 A;  1XVB E;  1FZH E;  3LDB A;  4I9Q A;  1MTY G;  3N1E A;  1FZ9 E;  2MZW B;  3E4W A;  4J2B A;  2ATQ A;  2B7M A;  3CFO A;  2JH8 A;  3RWU A;  2FYO A;  3RMD A;  4FJG A;  4FJL A;  4FK2 A;  3L1N A;  4FJ8 A;  2OVQ B;  2OVR B;  2H4T A;  4JS4 A;  4DTM A;  2P1P B;  4DTN A;  2HD0 A;  3OGM B;  4KI4 A;  3QER A;  3C95 A;  4FJM A;  3TL8 B;  5IRE A;  1MHZ G;  3L2O B;  4EPH A;  1FZ1 E;  3HP9 A;  3CFR A;  3SUO A;  4J2E A;  2JHP A;  4AKH A;  3QET A;  1FXX A;  2DY4 A;  1WAF A;  4AKG A;  2RCU A;  2P5G A;  3SPZ A;  4FJJ A;  3SPY A;  3KD1 E;  1FZ5 E;  1IH7 A;  4EP9 A;  4DTU A;  3TJY A;  4KHQ A;  3QEI A;  3QNO A;  4FK0 A;  3CFP A;  1LDK E;  1FZ4 E;  3SQ1 A;  1FZI E;  3HL8 A;  3UIQ A;  3CQ8 A;  3C6O B;  1WAJ A;  3J27 A;  4JS5 A;  4FJI A;  2QXF A;  3S9H A;  3N1B A;  4KHW A;  2P1Q B;  1FYZ E;  2PFV A;  2VJ4 A;  4M3X A;  2DTU A;  1FZ8 E;  1XVC E;  2B1E A;  4FJ7 A;  4ADO A;  3NE6 A;  3QEV A;  3LZJ A;  3SVI A;  4RNG A;  3LZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...