1LDKE

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
41
structure length
41
Chain Sequence
b'WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CULLIN HOMOLOG
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2002-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1ldkE00
2OVRB 2P1QB 3OGLB 2E32A 2OVPB 5IBKB 3L2OB 3V7DB 2P1OB 1P22A 3WSOA 3OGMB 1LDKE 2P1NB 3MKSB 3OGKB 2OVQB 1FS1A 2P1PB 3C6PB 3C6OB 1NEXB 2E31A 2P1MB 3C6NB 4I6JB
chains in the Genus database with same CATH superfamily
1FZ8E 4QNCA 3SPYA 3HGKE 3UO2A 3OGLB 2E32A 1IG9A 4KHUA 4RL5A 4AKIA 1XL3C 1XVCE 4M45A 1FZ1E 4DTMA 4J2EA 4DTSA 2JQTA 2JHCA 4HCBA 3LDSA 3KD1E 1FZ6E 3NDKA 4DTUA 3SUNA 2MW2A 3TL8B 3J27A 3RMBA 4DTPA 3SUPA 3SUQA 1XMHE 3OGKB 3SI6A 3SJJA 4FJNA 2LF6A 2DTUA 4RG8A 1FZ4E 4B08A 1WAFA 2PFTA 4ADNA 4M3YA 3K2OA 4JS5A 4DTNA 4FJMA 4KI6A 1NEXB 3L0MA 4FJLA 4DTJA 2FYOA 3HL8A 3SQ1A 2E31A 2JHPA 2P1MB 4EYWA 3NCIA 3QEIA 3CQ8A 3SPZA 1FZ2E 1XVFE 1FZIE 4FJ7A 4I9LA 2B7MA 2VIXA 1Q9XA 4J2BA 3L8BA 5IBKB 2OZMA 4DU4A 4FJIA 4M41A 4M3ZA 4E4BA 4JRQA 2H4TA 2JHAA 3BVOA 3E4WA 3RMAA 1FZ9E 1MMOG 1P22A 4DU1A 2P5GA 4KHWA 4M42A 4J2AA 3QETA 4KHNA 3SUOA 3LZIA 1XU3E 2ATQA 4KHQA 3MKSB 2MZWB 1MHYG 2JPNA 3SQ0A 4FK0A 4FJ8A 1FZ5E 4DU3A 2P1PB 2RKHA 4FJXA 3C6OB 3RWUA 4KHYA 1FZ0E 3QERA 1FZ3E 1JW2A 2OZSA 4FVMA 1XVDE 5IZ7A 2FW3A 3QESA 1MTYG 3LZJA 4JRPA 3J2PA 3N1BA 4M3RA 4X5NA 3CFOA 4M3WA 2OVRB 3KD5E 3QEPA 2P1QB 2OVPB 4M3XA 3NAEA 3TJYA 4KHSA 3LD8A 5H37A 4HCCA 1XVGE 2HD0A 3V7DB 1Q9YA 2RCUA 3WSOA 4FJKA 1XMGE 4GAMC 2OYQA 2LF3A 1LDKE 4ICGC 3TAEA 3L1NA 3SNNA 1MHZG 2PFVA 3E4YA 4FJJA 2P1NB 2B1EA 2JH9A 3TAGA 1FPOA 3HP9A 2OVQB 3NGIA 4AKGA 4FK4A 1FS1A 3QNNA 3C95A 3C6PB 4ADOA 2DEBA 1XVEE 3QEVA 1FZ7E 3NE6A 4AKHA 2VJ5A 2QXFA 3SQ2A 2DY4A 3QEWA 4EP9A 4FJGA 3LDBA 4M3TA 1CLQA 3C6NB 3QEXA 3C94A 4I6JB 4RNGA 3SVIA 4M3UA 2P5OA 3SCXA 4JS4A 1WAJA 3CFRA 4EPHA 1XU5E 4QNDA 3L2OB 3CFPA 2YB5A 2P1OB 2K5SA 3RMDA 4FJ9A 4FJ5A 3OGMB 1N1CA 3S9HA 2B8IA 1XMFE 3RMCA 1FXXA 2VJ4A 4J2DA 3HGLA 3NHGA 1IH7A 4E3SA 4FK2A 3TABA 4IT5A 4I9QA 3QNOA 4AI6A 5IREA 4KI4A 3UIQA 3UO3A 3SQ4A 4DTRA 4DTOA 2JH8A 2MMBA 3TAFA 4FJHA 1XVBE 1FYZE 3N1EA 4DTXA 4X5MA 1FZHE
chains in the Genus database with same CATH topology
1FZ8E 4QNCA 3SPYA 3HGKE 3OGLB 2E32A 1IG9A 4KHUA 4RL5A 4AKIA 1XL3C 1XVCE 4M45A 1FZ1E 4DTMA 4J2EA 4DTSA 2JHCA 4HCBA 3LDSA 3KD1E 1FZ6E 3NDKA 4DTUA 3SUNA 3TL8B 3J27A 3RMBA 4DTPA 3SUPA 3SUQA 1XMHE 3OGKB 3SI6A 3SJJA 4FJNA 2LF6A 2DTUA 4RG8A 1FZ4E 4B08A 1WAFA 2PFTA 4ADNA 4M3YA 3K2OA 4JS5A 4DTNA 4FJMA 4KI6A 1NEXB 3L0MA 4FJLA 4DTJA 2FYOA 3HL8A 3SQ1A 2E31A 2JHPA 2P1MB 4EYWA 3NCIA 3QEIA 3CQ8A 3SPZA 1FZ2E 1XVFE 1FZIE 4FJ7A 4I9LA 2B7MA 2VIXA 1Q9XA 4J2BA 3L8BA 5IBKB 2OZMA 4DU4A 4FJIA 4M41A 4M3ZA 4E4BA 4JRQA 2H4TA 2JHAA 3RMAA 3E4WA 1FZ9E 1MMOG 1P22A 4DU1A 2P5GA 4KHWA 4M42A 4J2AA 3QETA 4KHNA 3SUOA 3LZIA 1XU3E 2ATQA 4KHQA 3MKSB 2MZWB 1MHYG 2JPNA 3SQ0A 4FK0A 4FJ8A 1FZ5E 4DU3A 2P1PB 4FJXA 3C6OB 3RWUA 4KHYA 1FZ0E 3QERA 1FZ3E 2OZSA 4FVMA 1XVDE 5IZ7A 2FW3A 3QESA 1MTYG 3LZJA 4JRPA 3J2PA 3N1BA 4M3RA 4X5NA 3CFOA 4M3WA 2OVRB 3KD5E 3QEPA 2P1QB 2OVPB 4M3XA 3NAEA 3TJYA 4KHSA 3LD8A 5H37A 4HCCA 1XVGE 2HD0A 3V7DB 1Q9YA 2RCUA 3WSOA 4FJKA 1XMGE 4GAMC 2OYQA 2LF3A 1LDKE 3TAEA 3SNNA 3L1NA 4FJJA 1MHZG 2PFVA 3E4YA 2P1NB 2B1EA 2JH9A 3TAGA 3HP9A 2OVQB 3NGIA 4AKGA 4FK4A 1FS1A 3QNNA 3C95A 3C6PB 4ADOA 2DEBA 1XVEE 3QEVA 1FZ7E 3NE6A 4AKHA 2VJ5A 2QXFA 3SQ2A 2DY4A 3QEWA 4EP9A 4FJGA 3LDBA 4M3TA 1CLQA 3C6NB 3QEXA 3C94A 4I6JB 4RNGA 3SVIA 4M3UA 2P5OA 3SCXA 4JS4A 1WAJA 3CFRA 4EPHA 1XU5E 4QNDA 3L2OB 3CFPA 2YB5A 2P1OB 3RMDA 4FJ9A 4FJ5A 3OGMB 3S9HA 2B8IA 1XMFE 3RMCA 1FXXA 2VJ4A 4J2DA 3HGLA 3NHGA 1IH7A 4E3SA 4FK2A 3TABA 4I9QA 3QNOA 4AI6A 5IREA 4KI4A 3UIQA 3SQ4A 4DTRA 4DTOA 2JH8A 2MMBA 3TAFA 4FJHA 1XVBE 1FYZE 3N1EA 4DTXA 4X5MA 1FZHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVR B;  2P1Q B;  3OGL B;  2E32 A;  2OVP B;  5IBK B;  3L2O B;  3V7D B;  2P1O B;  1P22 A;  3WSO A;  3OGM B;  1LDK E;  2P1N B;  3MKS B;  3OGK B;  2OVQ B;  1FS1 A;  2P1P B;  3C6P B;  3C6O B;  1NEX B;  2E31 A;  2P1M B;  3C6N B;  4I6J B; 
#chains in the Genus database with same CATH topology
 1FZ8 E;  4QNC A;  3SPY A;  3HGK E;  3UO2 A;  3OGL B;  2E32 A;  1IG9 A;  4KHU A;  4RL5 A;  4AKI A;  1XL3 C;  1XVC E;  4M45 A;  1FZ1 E;  4DTM A;  4J2E A;  4DTS A;  2JQT A;  2JHC A;  4HCB A;  3LDS A;  3KD1 E;  1FZ6 E;  3NDK A;  4DTU A;  3SUN A;  2MW2 A;  3TL8 B;  3J27 A;  3RMB A;  4DTP A;  3SUP A;  3SUQ A;  1XMH E;  3OGK B;  3SI6 A;  3SJJ A;  4FJN A;  2LF6 A;  2DTU A;  4RG8 A;  1FZ4 E;  4B08 A;  1WAF A;  2PFT A;  4ADN A;  4M3Y A;  3K2O A;  4JS5 A;  4DTN A;  4FJM A;  4KI6 A;  1NEX B;  3L0M A;  4FJL A;  4DTJ A;  2FYO A;  3HL8 A;  3SQ1 A;  2E31 A;  2JHP A;  2P1M B;  4EYW A;  3NCI A;  3QEI A;  3CQ8 A;  3SPZ A;  1FZ2 E;  1XVF E;  1FZI E;  4FJ7 A;  4I9L A;  2B7M A;  2VIX A;  1Q9X A;  4J2B A;  3L8B A;  5IBK B;  2OZM A;  4DU4 A;  4FJI A;  4M41 A;  4M3Z A;  4E4B A;  4JRQ A;  2H4T A;  2JHA A;  3BVO A;  3E4W A;  3RMA A;  1FZ9 E;  1MMO G;  1P22 A;  4DU1 A;  2P5G A;  4KHW A;  4M42 A;  4J2A A;  3QET A;  4KHN A;  3SUO A;  3LZI A;  1XU3 E;  2ATQ A;  4KHQ A;  3MKS B;  2MZW B;  1MHY G;  2JPN A;  3SQ0 A;  4FK0 A;  4FJ8 A;  1FZ5 E;  4DU3 A;  2P1P B;  2RKH A;  4FJX A;  3C6O B;  3RWU A;  4KHY A;  1FZ0 E;  3QER A;  1FZ3 E;  1JW2 A;  2OZS A;  4FVM A;  1XVD E;  5IZ7 A;  2FW3 A;  3QES A;  1MTY G;  3LZJ A;  4JRP A;  3J2P A;  3N1B A;  4M3R A;  4X5N A;  3CFO A;  4M3W A;  2OVR B;  3KD5 E;  3QEP A;  2P1Q B;  2OVP B;  4M3X A;  3NAE A;  3TJY A;  4KHS A;  3LD8 A;  5H37 A;  4HCC A;  1XVG E;  2HD0 A;  3V7D B;  1Q9Y A;  2RCU A;  3WSO A;  4FJK A;  1XMG E;  4GAM C;  2OYQ A;  2LF3 A;  1LDK E;  4ICG C;  3TAE A;  3L1N A;  3SNN A;  1MHZ G;  2PFV A;  3E4Y A;  4FJJ A;  2P1N B;  2B1E A;  2JH9 A;  3TAG A;  1FPO A;  3HP9 A;  2OVQ B;  3NGI A;  4AKG A;  4FK4 A;  1FS1 A;  3QNN A;  3C95 A;  3C6P B;  4ADO A;  2DEB A;  1XVE E;  3QEV A;  1FZ7 E;  3NE6 A;  4AKH A;  2VJ5 A;  2QXF A;  3SQ2 A;  2DY4 A;  3QEW A;  4EP9 A;  4FJG A;  3LDB A;  4M3T A;  1CLQ A;  3C6N B;  3QEX A;  3C94 A;  4I6J B;  4RNG A;  3SVI A;  4M3U A;  2P5O A;  3SCX A;  4JS4 A;  1WAJ A;  3CFR A;  4EPH A;  1XU5 E;  4QND A;  3L2O B;  3CFP A;  2YB5 A;  2P1O B;  2K5S A;  3RMD A;  4FJ9 A;  4FJ5 A;  3OGM B;  1N1C A;  3S9H A;  2B8I A;  1XMF E;  3RMC A;  1FXX A;  2VJ4 A;  4J2D A;  3HGL A;  3NHG A;  1IH7 A;  4E3S A;  4FK2 A;  3TAB A;  4IT5 A;  4I9Q A;  3QNO A;  4AI6 A;  5IRE A;  4KI4 A;  3UIQ A;  3UO3 A;  3SQ4 A;  4DTR A;  4DTO A;  2JH8 A;  2MMB A;  3TAF A;  4FJH A;  1XVB E;  1FYZ E;  3N1E A;  4DTX A;  4X5M A;  1FZH E; 
#chains in the Genus database with same CATH homology
 1FZ8 E;  4QNC A;  3SPY A;  3HGK E;  3OGL B;  2E32 A;  1IG9 A;  4KHU A;  4RL5 A;  4AKI A;  1XL3 C;  1XVC E;  4M45 A;  1FZ1 E;  4DTM A;  4J2E A;  4DTS A;  2JHC A;  4HCB A;  3LDS A;  3KD1 E;  1FZ6 E;  3NDK A;  4DTU A;  3SUN A;  3TL8 B;  3J27 A;  3RMB A;  4DTP A;  3SUP A;  3SUQ A;  1XMH E;  3OGK B;  3SI6 A;  3SJJ A;  4FJN A;  2LF6 A;  2DTU A;  4RG8 A;  1FZ4 E;  4B08 A;  1WAF A;  2PFT A;  4ADN A;  4M3Y A;  3K2O A;  4JS5 A;  4DTN A;  4FJM A;  4KI6 A;  1NEX B;  3L0M A;  4FJL A;  4DTJ A;  2FYO A;  3HL8 A;  3SQ1 A;  2E31 A;  2JHP A;  2P1M B;  4EYW A;  3NCI A;  3QEI A;  3CQ8 A;  3SPZ A;  1FZ2 E;  1XVF E;  1FZI E;  4FJ7 A;  4I9L A;  2B7M A;  2VIX A;  1Q9X A;  4J2B A;  3L8B A;  5IBK B;  2OZM A;  4DU4 A;  4FJI A;  4M41 A;  4M3Z A;  4E4B A;  4JRQ A;  2H4T A;  2JHA A;  3RMA A;  3E4W A;  1FZ9 E;  1MMO G;  1P22 A;  4DU1 A;  2P5G A;  4KHW A;  4M42 A;  4J2A A;  3QET A;  4KHN A;  3SUO A;  3LZI A;  1XU3 E;  2ATQ A;  4KHQ A;  3MKS B;  2MZW B;  1MHY G;  2JPN A;  3SQ0 A;  4FK0 A;  4FJ8 A;  1FZ5 E;  4DU3 A;  2P1P B;  4FJX A;  3C6O B;  3RWU A;  4KHY A;  1FZ0 E;  3QER A;  1FZ3 E;  2OZS A;  4FVM A;  1XVD E;  5IZ7 A;  2FW3 A;  3QES A;  1MTY G;  3LZJ A;  4JRP A;  3J2P A;  3N1B A;  4M3R A;  4X5N A;  3CFO A;  4M3W A;  2OVR B;  3KD5 E;  3QEP A;  2P1Q B;  2OVP B;  4M3X A;  3NAE A;  3TJY A;  4KHS A;  3LD8 A;  5H37 A;  4HCC A;  1XVG E;  2HD0 A;  3V7D B;  1Q9Y A;  2RCU A;  3WSO A;  4FJK A;  1XMG E;  4GAM C;  2OYQ A;  2LF3 A;  1LDK E;  3TAE A;  3SNN A;  3L1N A;  4FJJ A;  1MHZ G;  2PFV A;  3E4Y A;  2P1N B;  2B1E A;  2JH9 A;  3TAG A;  3HP9 A;  2OVQ B;  3NGI A;  4AKG A;  4FK4 A;  1FS1 A;  3QNN A;  3C95 A;  3C6P B;  4ADO A;  2DEB A;  1XVE E;  3QEV A;  1FZ7 E;  3NE6 A;  4AKH A;  2VJ5 A;  2QXF A;  3SQ2 A;  2DY4 A;  3QEW A;  4EP9 A;  4FJG A;  3LDB A;  4M3T A;  1CLQ A;  3C6N B;  3QEX A;  3C94 A;  4I6J B;  4RNG A;  3SVI A;  4M3U A;  2P5O A;  3SCX A;  4JS4 A;  1WAJ A;  3CFR A;  4EPH A;  1XU5 E;  4QND A;  3L2O B;  3CFP A;  2YB5 A;  2P1O B;  3RMD A;  4FJ9 A;  4FJ5 A;  3OGM B;  3S9H A;  2B8I A;  1XMF E;  3RMC A;  1FXX A;  2VJ4 A;  4J2D A;  3HGL A;  3NHG A;  1IH7 A;  4E3S A;  4FK2 A;  3TAB A;  4I9Q A;  3QNO A;  4AI6 A;  5IRE A;  4KI4 A;  3UIQ A;  3SQ4 A;  4DTR A;  4DTO A;  2JH8 A;  2MMB A;  3TAF A;  4FJH A;  1XVB E;  1FYZ E;  3N1E A;  4DTX A;  4X5M A;  1FZH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...