1LDKE

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords CULLIN HOMOLOG
total genus 9
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2002-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1ldkE00
3C6OB 2P1OB 4I6JB 3OGKB 1FS1A 1LDKE 2P1QB 3L2OB 2E32A 2P1MB 3C6NB 3V7DB 2E31A 3OGMB 1P22A 5IBKB 2OVPB 2OVQB 2OVRB 1NEXB 2P1PB 3OGLB 3C6PB 3WSOA 2P1NB 3MKSB
chains in the Genus database with same CATH superfamily
3TAFA 1FZ4E 4DU1A 4E4BA 2ATQA 2MZWB 3LD8A 3UO2A 2VJ4A 3TAEA 1FZ6E 3SPZA 1FZIE 3RMAA 3KD1E 5IZ7A 4DU3A 3NHGA 3SUPA 2JHPA 3CQ8A 4DTOA 3QERA 3N1EA 3RWUA 3OGKB 4FJMA 1XMHE 3L2OB 4FJXA 4ADNA 3CFPA 2RCUA 3NCIA 3C6NB 3V7DB 2LF6A 3RMBA 4KI6A 3OGMB 3TABA 2JPNA 4J2BA 3SQ4A 4FJIA 3QEPA 4KHQA 4J2DA 2OVQB 3BVOA 4M3UA 4RL5A 4M41A 3QNOA 3UO3A 1Q9XA 1WAFA 3L8BA 3QETA 3SUQA 4FJ7A 2P5GA 2DY4A 4KHYA 2QXFA 4AKHA 4RNGA 3QEXA 2JH8A 1XVFE 1XU3E 2OZMA 1CLQA 3L0MA 3E4YA 2JQTA 4X5NA 2B1EA 2FYOA 4IT5A 3LZJA 1FYZE 5IREA 3QNNA 2VIXA 3SQ0A 3RMCA 1XVEE 2PFTA 4DTNA 3UIQA 1XVCE 3CFRA 4M3XA 4RG8A 4FJKA 1XL3C 3C95A 2DEBA 1XMGE 3HL8A 2P1MB 3HGLA 1FZ5E 1FZ0E 4ICGC 3TAGA 3SUNA 2E31A 3KD5E 1FPOA 1FZ7E 1P22A 1FZ9E 3N1BA 3NE6A 1MHYG 3LZIA 3S9HA 3SI6A 4AKIA 2K5SA 3NGIA 3C94A 4E3SA 1IG9A 3K2OA 4I9LA 3QEVA 2H4TA 1XVBE 2MMBA 3LDSA 2OVRB 3E4WA 4FVMA 3NAEA 2P1PB 1XMFE 4M3RA 1FZ1E 1N1CA 4DTUA 2FW3A 3HGKE 4ADOA 4J2AA 1FZ3E 4JRQA 4JRPA 3SJJA 4KI4A 2LF3A 4M45A 1WAJA 4FK4A 2HD0A 2MW2A 4I9QA 3SQ2A 4KHWA 4DTJA 3C6OB 2JH9A 4JS4A 1FS1A 4AI6A 4DTXA 3RMDA 4FJ9A 2OYQA 4KHSA 4FJJA 2E32A 3L1NA 1FZ8E 4EPHA 4EP9A 4JS5A 4DU4A 4QNCA 3HP9A 4FK0A 4FK2A 3QEWA 1IH7A 4M3WA 4M3ZA 2OVPB 3SVIA 4M3YA 1XVGE 1FZHE 3J2PA 4QNDA 4EYWA 4FJGA 3NDKA 1FZ2E 1Q9YA 2JHCA 3C6PB 4DTRA 3SNNA 3WSOA 3J27A 3SCXA 3LDBA 1XU5E 3TJYA 3QEIA 3MKSB 4DTSA 2YB5A 1MMOG 1FXXA 4M3TA 4DTPA 4FJ8A 4AKGA 2RKHA 2PFVA 4X5MA 3TL8B 2P1OB 4I6JB 2P1QB 1LDKE 3CFOA 1XVDE 4KHNA 4B08A 3SQ1A 1MTYG 4KHUA 5IBKB 4HCCA 2JHAA 2OZSA 4FJHA 2B8IA 2VJ5A 3QESA 4M42A 2B7MA 4FJNA 4GAMC 1MHZG 1NEXB 1JW2A 4J2EA 3SPYA 2P5OA 3OGLB 4HCBA 5H37A 4FJLA 3SUOA 4DTMA 4FJ5A 2P1NB 2DTUA
chains in the Genus database with same CATH topology
3TAFA 1FZ4E 4DU1A 4E4BA 2ATQA 2MZWB 3LD8A 3TAEA 2VJ4A 1FZ6E 3SPZA 1FZIE 3RMAA 3KD1E 5IZ7A 4DU3A 3NHGA 3SUPA 2JHPA 3CQ8A 4DTOA 3QERA 3N1EA 3RWUA 3OGKB 4FJMA 1XMHE 3L2OB 4FJXA 4ADNA 3CFPA 2RCUA 3NCIA 3C6NB 3V7DB 2LF6A 3RMBA 4KI6A 3OGMB 3TABA 2JPNA 4J2BA 3SQ4A 4FJIA 3QEPA 4KHQA 4J2DA 2OVQB 4M3UA 4RL5A 4M41A 3QNOA 1Q9XA 1WAFA 3L8BA 3QETA 3SUQA 4FJ7A 2P5GA 2DY4A 4KHYA 2QXFA 4AKHA 4RNGA 3QEXA 2JH8A 1XVFE 1XU3E 2OZMA 1CLQA 3L0MA 3E4YA 4X5NA 2B1EA 2FYOA 3LZJA 1FYZE 5IREA 3QNNA 2VIXA 3SQ0A 3RMCA 1XVEE 2PFTA 4DTNA 3UIQA 1XVCE 3CFRA 4M3XA 4RG8A 4FJKA 1XL3C 3C95A 2DEBA 1XMGE 3HL8A 2P1MB 3HGLA 1FZ5E 1FZ0E 3TAGA 3SUNA 2E31A 3KD5E 1FZ7E 1P22A 1FZ9E 3N1BA 3NE6A 1MHYG 3LZIA 3S9HA 3SI6A 4AKIA 3NGIA 3C94A 4E3SA 1IG9A 3K2OA 4I9LA 3QEVA 2H4TA 1XVBE 2MMBA 3LDSA 2OVRB 3E4WA 4FVMA 3NAEA 2P1PB 1XMFE 4M3RA 1FZ1E 4DTUA 2FW3A 3HGKE 4ADOA 4J2AA 1FZ3E 4JRQA 4JRPA 3SJJA 4KI4A 2LF3A 4M45A 1WAJA 4FK4A 2HD0A 4I9QA 3SQ2A 4KHWA 4DTJA 3C6OB 2JH9A 4JS4A 1FS1A 4AI6A 4DTXA 3RMDA 4FJ9A 2OYQA 4KHSA 4FJJA 2E32A 3L1NA 1FZ8E 4EPHA 4EP9A 4JS5A 4DU4A 4QNCA 3HP9A 4FK0A 4FK2A 3QEWA 1IH7A 4M3WA 4M3ZA 2OVPB 3SVIA 4M3YA 1XVGE 1FZHE 3J2PA 4QNDA 4EYWA 4FJGA 3NDKA 1FZ2E 1Q9YA 2JHCA 3C6PB 4DTRA 3SNNA 3WSOA 3J27A 3SCXA 3LDBA 1XU5E 3TJYA 3QEIA 3MKSB 4DTSA 2YB5A 1MMOG 1FXXA 4M3TA 4DTPA 4FJ8A 4AKGA 2PFVA 4X5MA 3TL8B 2P1OB 4I6JB 2P1QB 1LDKE 3CFOA 1XVDE 4KHNA 4B08A 3SQ1A 1MTYG 4KHUA 5IBKB 4HCCA 2JHAA 2OZSA 4FJHA 2B8IA 2VJ5A 3QESA 4M42A 2B7MA 4FJNA 4GAMC 1MHZG 1NEXB 4J2EA 3SPYA 2P5OA 3OGLB 4HCBA 5H37A 4FJLA 3SUOA 4DTMA 4FJ5A 2P1NB 2DTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C6O B;  2P1O B;  4I6J B;  3OGK B;  1FS1 A;  1LDK E;  2P1Q B;  3L2O B;  2E32 A;  2P1M B;  3C6N B;  3V7D B;  2E31 A;  3OGM B;  1P22 A;  5IBK B;  2OVP B;  2OVQ B;  2OVR B;  1NEX B;  2P1P B;  3OGL B;  3C6P B;  3WSO A;  2P1N B;  3MKS B; 
#chains in the Genus database with same CATH topology
 3TAF A;  1FZ4 E;  4DU1 A;  4E4B A;  2ATQ A;  2MZW B;  3LD8 A;  3UO2 A;  2VJ4 A;  3TAE A;  1FZ6 E;  3SPZ A;  1FZI E;  3RMA A;  3KD1 E;  5IZ7 A;  4DU3 A;  3NHG A;  3SUP A;  2JHP A;  3CQ8 A;  4DTO A;  3QER A;  3N1E A;  3RWU A;  3OGK B;  4FJM A;  1XMH E;  3L2O B;  4FJX A;  4ADN A;  3CFP A;  2RCU A;  3NCI A;  3C6N B;  3V7D B;  2LF6 A;  3RMB A;  4KI6 A;  3OGM B;  3TAB A;  2JPN A;  4J2B A;  3SQ4 A;  4FJI A;  3QEP A;  4KHQ A;  4J2D A;  2OVQ B;  3BVO A;  4M3U A;  4RL5 A;  4M41 A;  3QNO A;  3UO3 A;  1Q9X A;  1WAF A;  3L8B A;  3QET A;  3SUQ A;  4FJ7 A;  2P5G A;  2DY4 A;  4KHY A;  2QXF A;  4AKH A;  4RNG A;  3QEX A;  2JH8 A;  1XVF E;  1XU3 E;  2OZM A;  1CLQ A;  3L0M A;  3E4Y A;  2JQT A;  4X5N A;  2B1E A;  2FYO A;  4IT5 A;  3LZJ A;  1FYZ E;  5IRE A;  3QNN A;  2VIX A;  3SQ0 A;  3RMC A;  1XVE E;  2PFT A;  4DTN A;  3UIQ A;  1XVC E;  3CFR A;  4M3X A;  4RG8 A;  4FJK A;  1XL3 C;  3C95 A;  2DEB A;  1XMG E;  3HL8 A;  2P1M B;  3HGL A;  1FZ5 E;  1FZ0 E;  4ICG C;  3TAG A;  3SUN A;  2E31 A;  3KD5 E;  1FPO A;  1FZ7 E;  1P22 A;  1FZ9 E;  3N1B A;  3NE6 A;  1MHY G;  3LZI A;  3S9H A;  3SI6 A;  4AKI A;  2K5S A;  3NGI A;  3C94 A;  4E3S A;  1IG9 A;  3K2O A;  4I9L A;  3QEV A;  2H4T A;  1XVB E;  2MMB A;  3LDS A;  2OVR B;  3E4W A;  4FVM A;  3NAE A;  2P1P B;  1XMF E;  4M3R A;  1FZ1 E;  1N1C A;  4DTU A;  2FW3 A;  3HGK E;  4ADO A;  4J2A A;  1FZ3 E;  4JRQ A;  4JRP A;  3SJJ A;  4KI4 A;  2LF3 A;  4M45 A;  1WAJ A;  4FK4 A;  2HD0 A;  2MW2 A;  4I9Q A;  3SQ2 A;  4KHW A;  4DTJ A;  3C6O B;  2JH9 A;  4JS4 A;  1FS1 A;  4AI6 A;  4DTX A;  3RMD A;  4FJ9 A;  2OYQ A;  4KHS A;  4FJJ A;  2E32 A;  3L1N A;  1FZ8 E;  4EPH A;  4EP9 A;  4JS5 A;  4DU4 A;  4QNC A;  3HP9 A;  4FK0 A;  4FK2 A;  3QEW A;  1IH7 A;  4M3W A;  4M3Z A;  2OVP B;  3SVI A;  4M3Y A;  1XVG E;  1FZH E;  3J2P A;  4QND A;  4EYW A;  4FJG A;  3NDK A;  1FZ2 E;  1Q9Y A;  2JHC A;  3C6P B;  4DTR A;  3SNN A;  3WSO A;  3J27 A;  3SCX A;  3LDB A;  1XU5 E;  3TJY A;  3QEI A;  3MKS B;  4DTS A;  2YB5 A;  1MMO G;  1FXX A;  4M3T A;  4DTP A;  4FJ8 A;  4AKG A;  2RKH A;  2PFV A;  4X5M A;  3TL8 B;  2P1O B;  4I6J B;  2P1Q B;  1LDK E;  3CFO A;  1XVD E;  4KHN A;  4B08 A;  3SQ1 A;  1MTY G;  4KHU A;  5IBK B;  4HCC A;  2JHA A;  2OZS A;  4FJH A;  2B8I A;  2VJ5 A;  3QES A;  4M42 A;  2B7M A;  4FJN A;  4GAM C;  1MHZ G;  1NEX B;  1JW2 A;  4J2E A;  3SPY A;  2P5O A;  3OGL B;  4HCB A;  5H37 A;  4FJL A;  3SUO A;  4DTM A;  4FJ5 A;  2P1N B;  2DTU A; 
#chains in the Genus database with same CATH homology
 3TAF A;  1FZ4 E;  4DU1 A;  4E4B A;  2ATQ A;  2MZW B;  3LD8 A;  3TAE A;  2VJ4 A;  1FZ6 E;  3SPZ A;  1FZI E;  3RMA A;  3KD1 E;  5IZ7 A;  4DU3 A;  3NHG A;  3SUP A;  2JHP A;  3CQ8 A;  4DTO A;  3QER A;  3N1E A;  3RWU A;  3OGK B;  4FJM A;  1XMH E;  3L2O B;  4FJX A;  4ADN A;  3CFP A;  2RCU A;  3NCI A;  3C6N B;  3V7D B;  2LF6 A;  3RMB A;  4KI6 A;  3OGM B;  3TAB A;  2JPN A;  4J2B A;  3SQ4 A;  4FJI A;  3QEP A;  4KHQ A;  4J2D A;  2OVQ B;  4M3U A;  4RL5 A;  4M41 A;  3QNO A;  1Q9X A;  1WAF A;  3L8B A;  3QET A;  3SUQ A;  4FJ7 A;  2P5G A;  2DY4 A;  4KHY A;  2QXF A;  4AKH A;  4RNG A;  3QEX A;  2JH8 A;  1XVF E;  1XU3 E;  2OZM A;  1CLQ A;  3L0M A;  3E4Y A;  4X5N A;  2B1E A;  2FYO A;  3LZJ A;  1FYZ E;  5IRE A;  3QNN A;  2VIX A;  3SQ0 A;  3RMC A;  1XVE E;  2PFT A;  4DTN A;  3UIQ A;  1XVC E;  3CFR A;  4M3X A;  4RG8 A;  4FJK A;  1XL3 C;  3C95 A;  2DEB A;  1XMG E;  3HL8 A;  2P1M B;  3HGL A;  1FZ5 E;  1FZ0 E;  3TAG A;  3SUN A;  2E31 A;  3KD5 E;  1FZ7 E;  1P22 A;  1FZ9 E;  3N1B A;  3NE6 A;  1MHY G;  3LZI A;  3S9H A;  3SI6 A;  4AKI A;  3NGI A;  3C94 A;  4E3S A;  1IG9 A;  3K2O A;  4I9L A;  3QEV A;  2H4T A;  1XVB E;  2MMB A;  3LDS A;  2OVR B;  3E4W A;  4FVM A;  3NAE A;  2P1P B;  1XMF E;  4M3R A;  1FZ1 E;  4DTU A;  2FW3 A;  3HGK E;  4ADO A;  4J2A A;  1FZ3 E;  4JRQ A;  4JRP A;  3SJJ A;  4KI4 A;  2LF3 A;  4M45 A;  1WAJ A;  4FK4 A;  2HD0 A;  4I9Q A;  3SQ2 A;  4KHW A;  4DTJ A;  3C6O B;  2JH9 A;  4JS4 A;  1FS1 A;  4AI6 A;  4DTX A;  3RMD A;  4FJ9 A;  2OYQ A;  4KHS A;  4FJJ A;  2E32 A;  3L1N A;  1FZ8 E;  4EPH A;  4EP9 A;  4JS5 A;  4DU4 A;  4QNC A;  3HP9 A;  4FK0 A;  4FK2 A;  3QEW A;  1IH7 A;  4M3W A;  4M3Z A;  2OVP B;  3SVI A;  4M3Y A;  1XVG E;  1FZH E;  3J2P A;  4QND A;  4EYW A;  4FJG A;  3NDK A;  1FZ2 E;  1Q9Y A;  2JHC A;  3C6P B;  4DTR A;  3SNN A;  3WSO A;  3J27 A;  3SCX A;  3LDB A;  1XU5 E;  3TJY A;  3QEI A;  3MKS B;  4DTS A;  2YB5 A;  1MMO G;  1FXX A;  4M3T A;  4DTP A;  4FJ8 A;  4AKG A;  2PFV A;  4X5M A;  3TL8 B;  2P1O B;  4I6J B;  2P1Q B;  1LDK E;  3CFO A;  1XVD E;  4KHN A;  4B08 A;  3SQ1 A;  1MTY G;  4KHU A;  5IBK B;  4HCC A;  2JHA A;  2OZS A;  4FJH A;  2B8I A;  2VJ5 A;  3QES A;  4M42 A;  2B7M A;  4FJN A;  4GAM C;  1MHZ G;  1NEX B;  4J2E A;  3SPY A;  2P5O A;  3OGL B;  4HCB A;  5H37 A;  4FJL A;  3SUO A;  4DTM A;  4FJ5 A;  2P1N B;  2DTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...