1LDKE

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords CULLIN HOMOLOG
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2002-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1ldkE00
2E31A 3OGLB 1P22A 3C6PB 3OGMB 4I6JB 3C6OB 3V7DB 2P1QB 1FS1A 2OVQB 2OVPB 2E32A 2OVRB 2P1NB 3L2OB 3OGKB 1LDKE 3C6NB 5IBKB 2P1OB 1NEXB 2P1MB 2P1PB 3MKSB 3WSOA
chains in the Genus database with same CATH superfamily
1FZ2E 4FJGA 2MZWB 4DTSA 3RMBA 4FJIA 1FYZE 4I9LA 2JH8A 3BVOA 3OGMB 3V7DB 3SUPA 2B7MA 3CFOA 3J2PA 3QNOA 2JHAA 2DEBA 2JPNA 4FJ5A 3L0MA 2P5OA 4KHQA 3E4YA 4ICGC 4KHYA 1FZ9E 2P1NB 3N1BA 3SCXA 2H4TA 2RKHA 3TJYA 3UO2A 2JHPA 3NDKA 3TAGA 4FJHA 3TL8B 4HCBA 3LD8A 4RG8A 3SUNA 3QEWA 4IT5A 3LDBA 3SQ2A 3NHGA 3NE6A 3SPYA 3QERA 1WAJA 3QESA 2JQTA 2JHCA 4X5MA 4DTOA 3SQ4A 4J2AA 2LF3A 4ADOA 2B1EA 4J2EA 4KI4A 3UO3A 4EPHA 4M42A 1XU3E 3QEPA 4B08A 4M3UA 3TAEA 2RCUA 4X5NA 2QXFA 3RMAA 1Q9YA 3LZJA 4KHSA 1XVDE 3TAFA 4M3RA 3HP9A 3SUOA 3KD1E 2P1QB 2OVQB 1FZHE 1XU5E 2OVPB 4AKIA 4M41A 2PFTA 1CLQA 2LF6A 1XVGE 2PFVA 4DTNA 4KHUA 4GAMC 4EYWA 4E4BA 1XMFE 4AI6A 1N1CA 3RWUA 4FJNA 2DTUA 4M45A 5H37A 4JS4A 5IREA 1FZIE 4DTMA 3KD5E 1FZ1E 1LDKE 3N1EA 2P1OB 4M3XA 4KI6A 1FZ4E 3QETA 2P5GA 2DY4A 1MMOG 4M3WA 2MW2A 4HCCA 5IZ7A 4DTUA 4I9QA 4AKHA 2K5SA 4RNGA 1FPOA 4RL5A 4M3TA 3NAEA 4DTRA 1Q9XA 3OGLB 1P22A 1WAFA 1XVEE 3C6PB 3E4WA 4FJKA 4M3ZA 4DU4A 4J2BA 3K2OA 4FJMA 2YB5A 1FZ3E 4FK0A 2MMBA 2VJ5A 3SNNA 2JH9A 3L2OB 3QEIA 1IG9A 3SQ0A 1FZ5E 2VIXA 1XVBE 3CFRA 3SQ1A 4FJLA 3SUQA 1MHZG 4M3YA 2B8IA 3QEXA 3NCIA 4J2DA 4EP9A 3C6NB 4KHWA 1FZ0E 4E3SA 3HL8A 2P1MB 3HGLA 1XMGE 2P1PB 3TABA 3SVIA 1FZ6E 4DTXA 2VJ4A 2OYQA 2E31A 2ATQA 3CFPA 4JRPA 2OZMA 4QNCA 3LDSA 4DU1A 4I6JB 3C6OB 3NGIA 4AKGA 4DTJA 1XMHE 1FS1A 3J27A 2FW3A 3C95A 3L1NA 4JRQA 4FJ7A 4DU3A 2E32A 1FXXA 2OVRB 3C94A 4DTPA 4JS5A 1XVFE 1XVCE 3QNNA 4FK4A 3RMDA 3SJJA 4FVMA 1FZ7E 1XL3C 3OGKB 1FZ8E 3SI6A 3HGKE 4QNDA 1MTYG 1JW2A 3QEVA 1IH7A 3S9HA 3UIQA 4FJ8A 3CQ8A 3RMCA 2HD0A 5IBKB 1NEXB 2FYOA 3LZIA 4FJXA 4FJJA 2OZSA 4FK2A 3SPZA 3MKSB 3L8BA 4KHNA 3WSOA 1MHYG 4ADNA 4FJ9A
chains in the Genus database with same CATH topology
1FZ2E 4FJGA 2MZWB 4DTSA 3RMBA 4FJIA 1FYZE 4I9LA 2JH8A 3OGMB 3V7DB 3SUPA 2B7MA 3CFOA 3J2PA 3QNOA 2JHAA 2DEBA 2JPNA 4FJ5A 3L0MA 2P5OA 4KHQA 3E4YA 4KHYA 1FZ9E 2P1NB 3N1BA 3SCXA 2H4TA 3TJYA 2JHPA 3NDKA 3TAGA 4FJHA 3TL8B 4HCBA 3LD8A 4RG8A 3SUNA 3QEWA 3LDBA 3SQ2A 3NHGA 3NE6A 3SPYA 3QERA 1WAJA 3QESA 2JHCA 4DTOA 4X5MA 3SQ4A 4J2AA 4J2EA 2LF3A 4ADOA 2B1EA 4KI4A 4EPHA 4M42A 1XU3E 3QEPA 4B08A 4M3UA 3TAEA 2RCUA 4X5NA 2QXFA 3RMAA 1Q9YA 3LZJA 4KHSA 1XVDE 3TAFA 4M3RA 3HP9A 3SUOA 3KD1E 2P1QB 2OVQB 1FZHE 1XU5E 2OVPB 4AKIA 4M41A 2PFTA 1CLQA 2LF6A 1XVGE 2PFVA 4DTNA 4KHUA 4GAMC 4EYWA 4E4BA 1XMFE 4AI6A 3RWUA 4FJNA 2DTUA 4M45A 5H37A 4JS4A 5IREA 1FZIE 4DTMA 3KD5E 1FZ1E 1LDKE 3N1EA 2P1OB 4M3XA 4KI6A 1FZ4E 3QETA 2P5GA 2DY4A 1MMOG 4M3WA 4HCCA 5IZ7A 4DTUA 4I9QA 4AKHA 4RNGA 4M3TA 4RL5A 3NAEA 4DTRA 1Q9XA 3OGLB 1P22A 1WAFA 1XVEE 3C6PB 3E4WA 4FJKA 4M3ZA 4DU4A 4J2BA 3K2OA 4FJMA 2YB5A 1FZ3E 4FK0A 2MMBA 2VJ5A 3SNNA 2JH9A 3L2OB 3QEIA 1IG9A 3SQ0A 1FZ5E 2VIXA 1XVBE 3CFRA 3SQ1A 4FJLA 3SUQA 1MHZG 4M3YA 2B8IA 3QEXA 3NCIA 4J2DA 4EP9A 3C6NB 4KHWA 1FZ0E 4E3SA 3HL8A 2P1MB 3HGLA 1XMGE 2P1PB 3TABA 3SVIA 1FZ6E 4DTXA 2VJ4A 2OYQA 2E31A 2ATQA 3CFPA 4JRPA 2OZMA 4QNCA 3LDSA 4DU1A 4I6JB 3C6OB 3NGIA 4AKGA 4DTJA 1XMHE 1FS1A 3J27A 3C95A 2FW3A 3L1NA 4JRQA 4FJ7A 4DU3A 2E32A 1FXXA 2OVRB 3C94A 4DTPA 4JS5A 1XVFE 1XVCE 3QNNA 4FK4A 3RMDA 3SJJA 4FVMA 1FZ7E 1XL3C 3OGKB 1FZ8E 3SI6A 3HGKE 4QNDA 1MTYG 3QEVA 1IH7A 3S9HA 3UIQA 4FJ8A 3CQ8A 3RMCA 2HD0A 5IBKB 1NEXB 2FYOA 3LZIA 4FJXA 4FJJA 2OZSA 4FK2A 3SPZA 3MKSB 3L8BA 4KHNA 3WSOA 1MHYG 4ADNA 4FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E31 A;  3OGL B;  1P22 A;  3C6P B;  3OGM B;  4I6J B;  3C6O B;  3V7D B;  2P1Q B;  1FS1 A;  2OVQ B;  2OVP B;  2E32 A;  2OVR B;  2P1N B;  3L2O B;  3OGK B;  1LDK E;  3C6N B;  5IBK B;  2P1O B;  1NEX B;  2P1M B;  2P1P B;  3MKS B;  3WSO A; 
#chains in the Genus database with same CATH topology
 1FZ2 E;  4FJG A;  2MZW B;  4DTS A;  3RMB A;  4FJI A;  1FYZ E;  4I9L A;  2JH8 A;  3BVO A;  3OGM B;  3V7D B;  3SUP A;  2B7M A;  3CFO A;  3J2P A;  3QNO A;  2JHA A;  2DEB A;  2JPN A;  4FJ5 A;  3L0M A;  2P5O A;  4KHQ A;  3E4Y A;  4ICG C;  4KHY A;  1FZ9 E;  2P1N B;  3N1B A;  3SCX A;  2H4T A;  2RKH A;  3TJY A;  3UO2 A;  2JHP A;  3NDK A;  3TAG A;  4FJH A;  3TL8 B;  4HCB A;  3LD8 A;  4RG8 A;  3SUN A;  3QEW A;  4IT5 A;  3LDB A;  3SQ2 A;  3NHG A;  3NE6 A;  3SPY A;  3QER A;  1WAJ A;  3QES A;  2JQT A;  2JHC A;  4X5M A;  4DTO A;  3SQ4 A;  4J2A A;  2LF3 A;  4ADO A;  2B1E A;  4J2E A;  4KI4 A;  3UO3 A;  4EPH A;  4M42 A;  1XU3 E;  3QEP A;  4B08 A;  4M3U A;  3TAE A;  2RCU A;  4X5N A;  2QXF A;  3RMA A;  1Q9Y A;  3LZJ A;  4KHS A;  1XVD E;  3TAF A;  4M3R A;  3HP9 A;  3SUO A;  3KD1 E;  2P1Q B;  2OVQ B;  1FZH E;  1XU5 E;  2OVP B;  4AKI A;  4M41 A;  2PFT A;  1CLQ A;  2LF6 A;  1XVG E;  2PFV A;  4DTN A;  4KHU A;  4GAM C;  4EYW A;  4E4B A;  1XMF E;  4AI6 A;  1N1C A;  3RWU A;  4FJN A;  2DTU A;  4M45 A;  5H37 A;  4JS4 A;  5IRE A;  1FZI E;  4DTM A;  3KD5 E;  1FZ1 E;  1LDK E;  3N1E A;  2P1O B;  4M3X A;  4KI6 A;  1FZ4 E;  3QET A;  2P5G A;  2DY4 A;  1MMO G;  4M3W A;  2MW2 A;  4HCC A;  5IZ7 A;  4DTU A;  4I9Q A;  4AKH A;  2K5S A;  4RNG A;  1FPO A;  4RL5 A;  4M3T A;  3NAE A;  4DTR A;  1Q9X A;  3OGL B;  1P22 A;  1WAF A;  1XVE E;  3C6P B;  3E4W A;  4FJK A;  4M3Z A;  4DU4 A;  4J2B A;  3K2O A;  4FJM A;  2YB5 A;  1FZ3 E;  4FK0 A;  2MMB A;  2VJ5 A;  3SNN A;  2JH9 A;  3L2O B;  3QEI A;  1IG9 A;  3SQ0 A;  1FZ5 E;  2VIX A;  1XVB E;  3CFR A;  3SQ1 A;  4FJL A;  3SUQ A;  1MHZ G;  4M3Y A;  2B8I A;  3QEX A;  3NCI A;  4J2D A;  4EP9 A;  3C6N B;  4KHW A;  1FZ0 E;  4E3S A;  3HL8 A;  2P1M B;  3HGL A;  1XMG E;  2P1P B;  3TAB A;  3SVI A;  1FZ6 E;  4DTX A;  2VJ4 A;  2OYQ A;  2E31 A;  2ATQ A;  3CFP A;  4JRP A;  2OZM A;  4QNC A;  3LDS A;  4DU1 A;  4I6J B;  3C6O B;  3NGI A;  4AKG A;  4DTJ A;  1XMH E;  1FS1 A;  3J27 A;  2FW3 A;  3C95 A;  3L1N A;  4JRQ A;  4FJ7 A;  4DU3 A;  2E32 A;  1FXX A;  2OVR B;  3C94 A;  4DTP A;  4JS5 A;  1XVF E;  1XVC E;  3QNN A;  4FK4 A;  3RMD A;  3SJJ A;  4FVM A;  1FZ7 E;  1XL3 C;  3OGK B;  1FZ8 E;  3SI6 A;  3HGK E;  4QND A;  1MTY G;  1JW2 A;  3QEV A;  1IH7 A;  3S9H A;  3UIQ A;  4FJ8 A;  3CQ8 A;  3RMC A;  2HD0 A;  5IBK B;  1NEX B;  2FYO A;  3LZI A;  4FJX A;  4FJJ A;  2OZS A;  4FK2 A;  3SPZ A;  3MKS B;  3L8B A;  4KHN A;  3WSO A;  1MHY G;  4ADN A;  4FJ9 A; 
#chains in the Genus database with same CATH homology
 1FZ2 E;  4FJG A;  2MZW B;  4DTS A;  3RMB A;  4FJI A;  1FYZ E;  4I9L A;  2JH8 A;  3OGM B;  3V7D B;  3SUP A;  2B7M A;  3CFO A;  3J2P A;  3QNO A;  2JHA A;  2DEB A;  2JPN A;  4FJ5 A;  3L0M A;  2P5O A;  4KHQ A;  3E4Y A;  4KHY A;  1FZ9 E;  2P1N B;  3N1B A;  3SCX A;  2H4T A;  3TJY A;  2JHP A;  3NDK A;  3TAG A;  4FJH A;  3TL8 B;  4HCB A;  3LD8 A;  4RG8 A;  3SUN A;  3QEW A;  3LDB A;  3SQ2 A;  3NHG A;  3NE6 A;  3SPY A;  3QER A;  1WAJ A;  3QES A;  2JHC A;  4DTO A;  4X5M A;  3SQ4 A;  4J2A A;  4J2E A;  2LF3 A;  4ADO A;  2B1E A;  4KI4 A;  4EPH A;  4M42 A;  1XU3 E;  3QEP A;  4B08 A;  4M3U A;  3TAE A;  2RCU A;  4X5N A;  2QXF A;  3RMA A;  1Q9Y A;  3LZJ A;  4KHS A;  1XVD E;  3TAF A;  4M3R A;  3HP9 A;  3SUO A;  3KD1 E;  2P1Q B;  2OVQ B;  1FZH E;  1XU5 E;  2OVP B;  4AKI A;  4M41 A;  2PFT A;  1CLQ A;  2LF6 A;  1XVG E;  2PFV A;  4DTN A;  4KHU A;  4GAM C;  4EYW A;  4E4B A;  1XMF E;  4AI6 A;  3RWU A;  4FJN A;  2DTU A;  4M45 A;  5H37 A;  4JS4 A;  5IRE A;  1FZI E;  4DTM A;  3KD5 E;  1FZ1 E;  1LDK E;  3N1E A;  2P1O B;  4M3X A;  4KI6 A;  1FZ4 E;  3QET A;  2P5G A;  2DY4 A;  1MMO G;  4M3W A;  4HCC A;  5IZ7 A;  4DTU A;  4I9Q A;  4AKH A;  4RNG A;  4M3T A;  4RL5 A;  3NAE A;  4DTR A;  1Q9X A;  3OGL B;  1P22 A;  1WAF A;  1XVE E;  3C6P B;  3E4W A;  4FJK A;  4M3Z A;  4DU4 A;  4J2B A;  3K2O A;  4FJM A;  2YB5 A;  1FZ3 E;  4FK0 A;  2MMB A;  2VJ5 A;  3SNN A;  2JH9 A;  3L2O B;  3QEI A;  1IG9 A;  3SQ0 A;  1FZ5 E;  2VIX A;  1XVB E;  3CFR A;  3SQ1 A;  4FJL A;  3SUQ A;  1MHZ G;  4M3Y A;  2B8I A;  3QEX A;  3NCI A;  4J2D A;  4EP9 A;  3C6N B;  4KHW A;  1FZ0 E;  4E3S A;  3HL8 A;  2P1M B;  3HGL A;  1XMG E;  2P1P B;  3TAB A;  3SVI A;  1FZ6 E;  4DTX A;  2VJ4 A;  2OYQ A;  2E31 A;  2ATQ A;  3CFP A;  4JRP A;  2OZM A;  4QNC A;  3LDS A;  4DU1 A;  4I6J B;  3C6O B;  3NGI A;  4AKG A;  4DTJ A;  1XMH E;  1FS1 A;  3J27 A;  3C95 A;  2FW3 A;  3L1N A;  4JRQ A;  4FJ7 A;  4DU3 A;  2E32 A;  1FXX A;  2OVR B;  3C94 A;  4DTP A;  4JS5 A;  1XVF E;  1XVC E;  3QNN A;  4FK4 A;  3RMD A;  3SJJ A;  4FVM A;  1FZ7 E;  1XL3 C;  3OGK B;  1FZ8 E;  3SI6 A;  3HGK E;  4QND A;  1MTY G;  3QEV A;  1IH7 A;  3S9H A;  3UIQ A;  4FJ8 A;  3CQ8 A;  3RMC A;  2HD0 A;  5IBK B;  1NEX B;  2FYO A;  3LZI A;  4FJX A;  4FJJ A;  2OZS A;  4FK2 A;  3SPZ A;  3MKS B;  3L8B A;  4KHN A;  3WSO A;  1MHY G;  4ADN A;  4FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...