1LDKE

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords CULLIN HOMOLOG
total genus 9
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2002-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1ldkE00
3V7DB 3L2OB 3WSOA 2P1MB 3OGKB 2E31A 2OVQB 2P1QB 3OGMB 2P1PB 1P22A 2P1NB 3C6OB 4I6JB 2E32A 3MKSB 1FS1A 1LDKE 1NEXB 3C6PB 2P1OB 2OVPB 3OGLB 2OVRB 5IBKB 3C6NB
chains in the Genus database with same CATH superfamily
3V7DB 4FJLA 4FJ7A 3QEXA 2DTUA 1XVDE 3LDBA 2OZMA 4M3UA 3HL8A 4FK0A 2E31A 2JHPA 4RG8A 4E4BA 4M3WA 1JW2A 3SQ0A 3SPYA 3NAEA 4KHYA 2P1PB 2LF3A 4AKIA 2H4TA 2OYQA 4FK2A 4KHUA 1FZIE 2MMBA 4FJHA 2P5GA 2OZSA 2E32A 1FZ4E 1MTYG 4QNCA 3TL8B 3SUPA 4QNDA 4FJNA 2YB5A 1LDKE 1MHZG 3C6PB 4DTNA 1FZ8E 4B08A 4FJGA 4DTJA 2FYOA 4JRPA 4JS4A 4DTRA 5H37A 4M41A 3SUQA 2OVRB 1XMFE 3RWUA 1MMOG 4DU4A 3C95A 1FZ5E 4KHWA 3K2OA 3N1BA 4J2DA 3SVIA 4DTPA 1XVBE 4GAMC 3LZJA 4DTXA 4FJ5A 3OGKB 2VJ5A 4J2AA 1FZ1E 2OVQB 3SQ1A 2DEBA 4FJXA 3QEIA 4KI6A 2P1NB 1IG9A 1XMGE 2ATQA 2DY4A 3QEWA 2VJ4A 2K5SA 4EP9A 1FZ7E 2P5OA 3C94A 4FJJA 3QNOA 3UO3A 4FJ9A 2JPNA 3NGIA 1XMHE 2PFVA 4DTMA 3J2PA 3TAEA 4KHSA 3NDKA 4ADNA 2OVPB 3CQ8A 2B8IA 1FZHE 2MW2A 4M3XA 3L8BA 3N1EA 3KD1E 3UIQA 2PFTA 4M3RA 2QXFA 4I9LA 4DU1A 1FZ3E 3HP9A 4IT5A 4FJKA 3RMCA 3WSOA 1XVGE 4M3YA 1CLQA 3KD5E 3HGLA 3J27A 2JH9A 2P1QB 3OGMB 2B7MA 1IH7A 3SUOA 4DTSA 3NE6A 4I6JB 3E4YA 4DTUA 4FJIA 2MZWB 3UO2A 4J2BA 3SPZA 3QNNA 3LD8A 1FXXA 4HCBA 3L1NA 1FS1A 3CFOA 2VIXA 1NEXB 4FJ8A 4DU3A 4AI6A 4HCCA 3TABA 3SQ4A 1FZ0E 5IZ7A 1XVFE 1Q9XA 4M3ZA 4AKGA 2HD0A 4RL5A 1XU3E 4ADOA 3C6NB 3SQ2A 4KHNA 1XVEE 4J2EA 3QESA 3TJYA 2RKHA 3QEVA 1WAFA 2JHCA 3BVOA 3QETA 1XVCE 4EPHA 3L2OB 2P1MB 4I9QA 4FK4A 1XL3C 1XU5E 2LF6A 4AKHA 4E3SA 3SUNA 3CFPA 1P22A 4M45A 3C6OB 4ICGC 3RMAA 4JS5A 1FZ9E 3TAFA 4FVMA 2JQTA 4X5MA 3TAGA 4EYWA 3CFRA 3SI6A 3SNNA 3MKSB 3L0MA 3SCXA 1FPOA 4JRQA 3RMBA 3SJJA 3HGKE 5IREA 1MHYG 3S9HA 2RCUA 4KI4A 3QERA 1N1CA 3RMDA 1WAJA 3NCIA 2P1OB 1FZ2E 4KHQA 4RNGA 1FYZE 3OGLB 3QEPA 4M42A 2FW3A 2B1EA 2JH8A 4X5NA 2JHAA 3NHGA 4FJMA 1FZ6E 3LZIA 5IBKB 3LDSA 1Q9YA 3E4WA 4DTOA 4M3TA
chains in the Genus database with same CATH topology
3V7DB 4FJLA 4FJ7A 3QEXA 2DTUA 1XVDE 3LDBA 2OZMA 4M3UA 3HL8A 4FK0A 2E31A 2JHPA 4RG8A 4E4BA 4M3WA 4AKIA 3SQ0A 3SPYA 3NAEA 4KHYA 2P1PB 2LF3A 2H4TA 2OYQA 4FK2A 4KHUA 1FZIE 2MMBA 4FJHA 2P5GA 2OZSA 2E32A 1FZ4E 1MTYG 4QNCA 3TL8B 3SUPA 4QNDA 4FJNA 2YB5A 1LDKE 1MHZG 3C6PB 4DTNA 1FZ8E 4B08A 4FJGA 4DTJA 2FYOA 4JRPA 4JS4A 4DTRA 5H37A 4M41A 3SUQA 2OVRB 1XMFE 3RWUA 1MMOG 4DU4A 3C95A 1FZ5E 4KHWA 3K2OA 3N1BA 4J2DA 3SVIA 4DTPA 1XVBE 4GAMC 3LZJA 4DTXA 4FJ5A 3OGKB 2VJ5A 4J2AA 1FZ1E 2OVQB 3SQ1A 2DEBA 4FJXA 3QEIA 4KI6A 2P1NB 1IG9A 1XMGE 2ATQA 2DY4A 3QEWA 2VJ4A 4EP9A 1FZ7E 2P5OA 3C94A 4FJJA 3QNOA 4FJ9A 2JPNA 3NGIA 1XMHE 2PFVA 4DTMA 3J2PA 3TAEA 4KHSA 3NDKA 4ADNA 2OVPB 3CQ8A 2B8IA 1FZHE 4M3XA 3L8BA 3N1EA 3KD1E 3UIQA 2PFTA 4M3RA 2QXFA 4I9LA 4DU1A 1FZ3E 3HP9A 4FJKA 3RMCA 3WSOA 1XVGE 4M3YA 1CLQA 3KD5E 3HGLA 3J27A 2JH9A 2P1QB 3OGMB 2B7MA 1IH7A 3SUOA 4DTSA 3NE6A 4I6JB 3E4YA 4DTUA 4FJIA 2MZWB 4J2BA 3SPZA 3QNNA 3LD8A 1FXXA 4HCBA 3L1NA 1FS1A 3CFOA 2VIXA 1NEXB 4FJ8A 4DU3A 4AI6A 4HCCA 3TABA 3SQ4A 1FZ0E 5IZ7A 1XVFE 1Q9XA 4M3ZA 4AKGA 2HD0A 4RL5A 1XU3E 4ADOA 3C6NB 3SQ2A 4KHNA 1XVEE 4J2EA 3QESA 3TJYA 3QEVA 1WAFA 2JHCA 3QETA 1XVCE 4EPHA 3L2OB 2P1MB 4I9QA 4FK4A 1XL3C 1XU5E 2LF6A 4AKHA 4E3SA 3SUNA 3CFPA 1P22A 4M45A 3C6OB 3RMAA 4JS5A 1FZ9E 3TAFA 4FVMA 4X5MA 3TAGA 3SI6A 4EYWA 3CFRA 3SNNA 3MKSB 3L0MA 3SCXA 4JRQA 3RMBA 3SJJA 3HGKE 5IREA 1MHYG 3S9HA 2RCUA 4KI4A 3QERA 3RMDA 1WAJA 3NCIA 2P1OB 1FZ2E 4KHQA 4RNGA 1FYZE 3OGLB 3QEPA 4M42A 2FW3A 2B1EA 2JH8A 4X5NA 2JHAA 3NHGA 4FJMA 1FZ6E 3LZIA 5IBKB 3LDSA 1Q9YA 3E4WA 4DTOA 4M3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7D B;  3L2O B;  3WSO A;  2P1M B;  3OGK B;  2E31 A;  2OVQ B;  2P1Q B;  3OGM B;  2P1P B;  1P22 A;  2P1N B;  3C6O B;  4I6J B;  2E32 A;  3MKS B;  1FS1 A;  1LDK E;  1NEX B;  3C6P B;  2P1O B;  2OVP B;  3OGL B;  2OVR B;  5IBK B;  3C6N B; 
#chains in the Genus database with same CATH topology
 3V7D B;  4FJL A;  4FJ7 A;  3QEX A;  2DTU A;  1XVD E;  3LDB A;  2OZM A;  4M3U A;  3HL8 A;  4FK0 A;  2E31 A;  2JHP A;  4RG8 A;  4E4B A;  4M3W A;  1JW2 A;  3SQ0 A;  3SPY A;  3NAE A;  4KHY A;  2P1P B;  2LF3 A;  4AKI A;  2H4T A;  2OYQ A;  4FK2 A;  4KHU A;  1FZI E;  2MMB A;  4FJH A;  2P5G A;  2OZS A;  2E32 A;  1FZ4 E;  1MTY G;  4QNC A;  3TL8 B;  3SUP A;  4QND A;  4FJN A;  2YB5 A;  1LDK E;  1MHZ G;  3C6P B;  4DTN A;  1FZ8 E;  4B08 A;  4FJG A;  4DTJ A;  2FYO A;  4JRP A;  4JS4 A;  4DTR A;  5H37 A;  4M41 A;  3SUQ A;  2OVR B;  1XMF E;  3RWU A;  1MMO G;  4DU4 A;  3C95 A;  1FZ5 E;  4KHW A;  3K2O A;  3N1B A;  4J2D A;  3SVI A;  4DTP A;  1XVB E;  4GAM C;  3LZJ A;  4DTX A;  4FJ5 A;  3OGK B;  2VJ5 A;  4J2A A;  1FZ1 E;  2OVQ B;  3SQ1 A;  2DEB A;  4FJX A;  3QEI A;  4KI6 A;  2P1N B;  1IG9 A;  1XMG E;  2ATQ A;  2DY4 A;  3QEW A;  2VJ4 A;  2K5S A;  4EP9 A;  1FZ7 E;  2P5O A;  3C94 A;  4FJJ A;  3QNO A;  3UO3 A;  4FJ9 A;  2JPN A;  3NGI A;  1XMH E;  2PFV A;  4DTM A;  3J2P A;  3TAE A;  4KHS A;  3NDK A;  4ADN A;  2OVP B;  3CQ8 A;  2B8I A;  1FZH E;  2MW2 A;  4M3X A;  3L8B A;  3N1E A;  3KD1 E;  3UIQ A;  2PFT A;  4M3R A;  2QXF A;  4I9L A;  4DU1 A;  1FZ3 E;  3HP9 A;  4IT5 A;  4FJK A;  3RMC A;  3WSO A;  1XVG E;  4M3Y A;  1CLQ A;  3KD5 E;  3HGL A;  3J27 A;  2JH9 A;  2P1Q B;  3OGM B;  2B7M A;  1IH7 A;  3SUO A;  4DTS A;  3NE6 A;  4I6J B;  3E4Y A;  4DTU A;  4FJI A;  2MZW B;  3UO2 A;  4J2B A;  3SPZ A;  3QNN A;  3LD8 A;  1FXX A;  4HCB A;  3L1N A;  1FS1 A;  3CFO A;  2VIX A;  1NEX B;  4FJ8 A;  4DU3 A;  4AI6 A;  4HCC A;  3TAB A;  3SQ4 A;  1FZ0 E;  5IZ7 A;  1XVF E;  1Q9X A;  4M3Z A;  4AKG A;  2HD0 A;  4RL5 A;  1XU3 E;  4ADO A;  3C6N B;  3SQ2 A;  4KHN A;  1XVE E;  4J2E A;  3QES A;  3TJY A;  2RKH A;  3QEV A;  1WAF A;  2JHC A;  3BVO A;  3QET A;  1XVC E;  4EPH A;  3L2O B;  2P1M B;  4I9Q A;  4FK4 A;  1XL3 C;  1XU5 E;  2LF6 A;  4AKH A;  4E3S A;  3SUN A;  3CFP A;  1P22 A;  4M45 A;  3C6O B;  4ICG C;  3RMA A;  4JS5 A;  1FZ9 E;  3TAF A;  4FVM A;  2JQT A;  4X5M A;  3TAG A;  4EYW A;  3CFR A;  3SI6 A;  3SNN A;  3MKS B;  3L0M A;  3SCX A;  1FPO A;  4JRQ A;  3RMB A;  3SJJ A;  3HGK E;  5IRE A;  1MHY G;  3S9H A;  2RCU A;  4KI4 A;  3QER A;  1N1C A;  3RMD A;  1WAJ A;  3NCI A;  2P1O B;  1FZ2 E;  4KHQ A;  4RNG A;  1FYZ E;  3OGL B;  3QEP A;  4M42 A;  2FW3 A;  2B1E A;  2JH8 A;  4X5N A;  2JHA A;  3NHG A;  4FJM A;  1FZ6 E;  3LZI A;  5IBK B;  3LDS A;  1Q9Y A;  3E4W A;  4DTO A;  4M3T A; 
#chains in the Genus database with same CATH homology
 3V7D B;  4FJL A;  4FJ7 A;  3QEX A;  2DTU A;  1XVD E;  3LDB A;  2OZM A;  4M3U A;  3HL8 A;  4FK0 A;  2E31 A;  2JHP A;  4RG8 A;  4E4B A;  4M3W A;  4AKI A;  3SQ0 A;  3SPY A;  3NAE A;  4KHY A;  2P1P B;  2LF3 A;  2H4T A;  2OYQ A;  4FK2 A;  4KHU A;  1FZI E;  2MMB A;  4FJH A;  2P5G A;  2OZS A;  2E32 A;  1FZ4 E;  1MTY G;  4QNC A;  3TL8 B;  3SUP A;  4QND A;  4FJN A;  2YB5 A;  1LDK E;  1MHZ G;  3C6P B;  4DTN A;  1FZ8 E;  4B08 A;  4FJG A;  4DTJ A;  2FYO A;  4JRP A;  4JS4 A;  4DTR A;  5H37 A;  4M41 A;  3SUQ A;  2OVR B;  1XMF E;  3RWU A;  1MMO G;  4DU4 A;  3C95 A;  1FZ5 E;  4KHW A;  3K2O A;  3N1B A;  4J2D A;  3SVI A;  4DTP A;  1XVB E;  4GAM C;  3LZJ A;  4DTX A;  4FJ5 A;  3OGK B;  2VJ5 A;  4J2A A;  1FZ1 E;  2OVQ B;  3SQ1 A;  2DEB A;  4FJX A;  3QEI A;  4KI6 A;  2P1N B;  1IG9 A;  1XMG E;  2ATQ A;  2DY4 A;  3QEW A;  2VJ4 A;  4EP9 A;  1FZ7 E;  2P5O A;  3C94 A;  4FJJ A;  3QNO A;  4FJ9 A;  2JPN A;  3NGI A;  1XMH E;  2PFV A;  4DTM A;  3J2P A;  3TAE A;  4KHS A;  3NDK A;  4ADN A;  2OVP B;  3CQ8 A;  2B8I A;  1FZH E;  4M3X A;  3L8B A;  3N1E A;  3KD1 E;  3UIQ A;  2PFT A;  4M3R A;  2QXF A;  4I9L A;  4DU1 A;  1FZ3 E;  3HP9 A;  4FJK A;  3RMC A;  3WSO A;  1XVG E;  4M3Y A;  1CLQ A;  3KD5 E;  3HGL A;  3J27 A;  2JH9 A;  2P1Q B;  3OGM B;  2B7M A;  1IH7 A;  3SUO A;  4DTS A;  3NE6 A;  4I6J B;  3E4Y A;  4DTU A;  4FJI A;  2MZW B;  4J2B A;  3SPZ A;  3QNN A;  3LD8 A;  1FXX A;  4HCB A;  3L1N A;  1FS1 A;  3CFO A;  2VIX A;  1NEX B;  4FJ8 A;  4DU3 A;  4AI6 A;  4HCC A;  3TAB A;  3SQ4 A;  1FZ0 E;  5IZ7 A;  1XVF E;  1Q9X A;  4M3Z A;  4AKG A;  2HD0 A;  4RL5 A;  1XU3 E;  4ADO A;  3C6N B;  3SQ2 A;  4KHN A;  1XVE E;  4J2E A;  3QES A;  3TJY A;  3QEV A;  1WAF A;  2JHC A;  3QET A;  1XVC E;  4EPH A;  3L2O B;  2P1M B;  4I9Q A;  4FK4 A;  1XL3 C;  1XU5 E;  2LF6 A;  4AKH A;  4E3S A;  3SUN A;  3CFP A;  1P22 A;  4M45 A;  3C6O B;  3RMA A;  4JS5 A;  1FZ9 E;  3TAF A;  4FVM A;  4X5M A;  3TAG A;  3SI6 A;  4EYW A;  3CFR A;  3SNN A;  3MKS B;  3L0M A;  3SCX A;  4JRQ A;  3RMB A;  3SJJ A;  3HGK E;  5IRE A;  1MHY G;  3S9H A;  2RCU A;  4KI4 A;  3QER A;  3RMD A;  1WAJ A;  3NCI A;  2P1O B;  1FZ2 E;  4KHQ A;  4RNG A;  1FYZ E;  3OGL B;  3QEP A;  4M42 A;  2FW3 A;  2B1E A;  2JH8 A;  4X5N A;  2JHA A;  3NHG A;  4FJM A;  1FZ6 E;  3LZI A;  5IBK B;  3LDS A;  1Q9Y A;  3E4W A;  4DTO A;  4M3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...