1LDKE

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
41
structure length
41
Chain Sequence
WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CULLIN HOMOLOG
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 9
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2002-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1ldkE00
1NEXB 1LDKE 3OGKB 3L2OB 2E31A 2P1NB 3C6PB 2OVRB 3WSOA 2E32A 3OGLB 3C6OB 3MKSB 5IBKB 2OVPB 3V7DB 2P1PB 4I6JB 3C6NB 2OVQB 2P1MB 2P1OB 1FS1A 3OGMB 2P1QB 1P22A
chains in the Genus database with same CATH superfamily
4AKIA 2OYQA 3UIQA 3SQ2A 3QETA 3RMBA 1WAJA 4HCBA 2H4TA 1MHZG 1WAFA 4KHUA 1XMHE 4M42A 3N1BA 1FZHE 1FYZE 2YB5A 3L2OB 2E31A 4DTRA 3TAGA 2P1NB 2OVRB 3TAFA 4DTNA 1IG9A 4DU1A 3C95A 3HGLA 2JH9A 3NGIA 4JRPA 3K2OA 3QNOA 3C6OB 2P5OA 4DTXA 4DU3A 4KHNA 4ADOA 4DTSA 1JW2A 4I9LA 3RMDA 2MW2A 4FJLA 2B8IA 4M3XA 2JHPA 3QEIA 4E3SA 4RNGA 5H37A 3UO2A 3NHGA 1FXXA 3QESA 1FZ9E 1XVEE 3HL8A 2P1OB 4ICGC 1XVDE 2MMBA 4DTPA 1XVGE 4FJ9A 4FJHA 2FYOA 2P1QB 4DTOA 1P22A 4FJMA 3SQ4A 1XMFE 3CFOA 4I9QA 3HGKE 2VIXA 3NCIA 2ATQA 1NEXB 1Q9XA 1LDKE 4B08A 4EP9A 4KHYA 1FZ0E 4M3UA 3QEPA 3N1EA 2JHCA 3TL8B 4HCCA 4AKGA 2MZWB 2VJ5A 1FPOA 2B7MA 4FJ7A 1Q9YA 3SPZA 3SNNA 1FZ5E 3SCXA 4M3WA 1FZ8E 3TJYA 2HD0A 5IZ7A 4ADNA 3LZJA 3SQ0A 4KI4A 4J2AA 4FJNA 2VJ4A 2DY4A 2P1PB 3E4WA 3LZIA 4FJIA 3SPYA 2P1MB 4QNDA 4FJJA 3SUPA 3LDSA 2QXFA 4GAMC 3NAEA 2RCUA 3OGMB 4FK2A 3HP9A 4QNCA 3LDBA 3UO3A 2P5GA 3SQ1A 4DU4A 3KD5E 3C94A 3E4YA 3QEWA 1MMOG 1N1CA 2LF3A 4X5NA 3QNNA 2JH8A 1FZ2E 4RG8A 4J2EA 1MTYG 4KHWA 3L8BA 3OGKB 4KI6A 4X5MA 3CFRA 4AKHA 3C6PB 3CFPA 2E32A 3SUOA 4FJGA 4DTMA 3BVOA 1FZ7E 3J27A 2K5SA 3SUNA 3RMAA 1CLQA 4M3YA 4KHSA 2OZSA 4DTJA 4I6JB 1XMGE 3SVIA 2OZMA 3S9HA 3QERA 1FZ3E 3TAEA 2JPNA 4M45A 4M3ZA 1FZ4E 4IT5A 4JS5A 3CQ8A 4J2BA 4AI6A 2DTUA 2JQTA 1FZ1E 1XU3E 1XVCE 1XVFE 2DEBA 4FJ8A 4FVMA 1FZ6E 4JS4A 3SUQA 3TABA 1MHYG 4M3TA 2PFVA 3J2PA 3WSOA 1IH7A 4RL5A 4M41A 2JHAA 1FZIE 3OGLB 4FK0A 2B1EA 4E4BA 4FJ5A 4EPHA 2FW3A 2PFTA 3QEVA 3MKSB 5IBKB 2RKHA 3RMCA 4J2DA 5IREA 4M3RA 3QEXA 2LF6A 2OVPB 4FJKA 3V7DB 4FJXA 4KHQA 1XU5E 3C6NB 3LD8A 4JRQA 3SJJA 2OVQB 4DTUA 3RWUA 4EYWA 3L1NA 3KD1E 4FK4A 3L0MA 1FS1A 1XVBE 3SI6A 3NE6A 3NDKA 1XL3C
chains in the Genus database with same CATH topology
4AKIA 2OYQA 3UIQA 3SQ2A 3QETA 3RMBA 1WAJA 4HCBA 2H4TA 1MHZG 1WAFA 4KHUA 1XMHE 4M42A 3N1BA 1FZHE 1FYZE 2YB5A 3L2OB 2E31A 4DTRA 3TAGA 2P1NB 2OVRB 3TAFA 4DTNA 1IG9A 4DU1A 3C95A 3HGLA 2JH9A 3NGIA 4JRPA 3K2OA 3QNOA 3C6OB 2P5OA 4DTXA 4DU3A 4KHNA 4ADOA 4DTSA 4I9LA 3RMDA 4FJLA 4M3XA 2B8IA 2JHPA 3QEIA 4E3SA 4RNGA 5H37A 3NHGA 1FXXA 3QESA 1FZ9E 1XVEE 3HL8A 2P1OB 4DTPA 1XVDE 2MMBA 1XVGE 4FJ9A 4FJHA 2FYOA 2P1QB 4DTOA 1P22A 4FJMA 3SQ4A 1XMFE 3CFOA 4I9QA 3HGKE 2VIXA 3NCIA 2ATQA 1NEXB 1Q9XA 1LDKE 4B08A 4EP9A 4KHYA 1FZ0E 4M3UA 3QEPA 3N1EA 2JHCA 3TL8B 4HCCA 4AKGA 2MZWB 2VJ5A 4FJ7A 2B7MA 1Q9YA 3SPZA 3SNNA 1FZ5E 3SCXA 4M3WA 1FZ8E 3TJYA 2HD0A 5IZ7A 4ADNA 3LZJA 3SQ0A 4KI4A 4J2AA 4FJNA 2VJ4A 2DY4A 2P1PB 3E4WA 3LZIA 4FJIA 3SPYA 2P1MB 4QNDA 4FJJA 3SUPA 3LDSA 2QXFA 4GAMC 3NAEA 2RCUA 3OGMB 4FK2A 3HP9A 4QNCA 3LDBA 2P5GA 3SQ1A 4DU4A 3KD5E 3C94A 3E4YA 3QEWA 1MMOG 2LF3A 4X5NA 3QNNA 2JH8A 1FZ2E 4RG8A 4J2EA 1MTYG 4KHWA 3L8BA 3OGKB 4KI6A 4X5MA 3CFRA 4AKHA 3C6PB 3CFPA 2E32A 3SUOA 4FJGA 4DTMA 1FZ7E 3J27A 3RMAA 3SUNA 1CLQA 4M3YA 4KHSA 2OZSA 4DTJA 4I6JB 1XMGE 3SVIA 2OZMA 3S9HA 3QERA 1FZ3E 3TAEA 2JPNA 4M45A 4M3ZA 1FZ4E 4JS5A 3CQ8A 4J2BA 4AI6A 2DTUA 1FZ1E 1XU3E 1XVCE 1XVFE 2DEBA 4FJ8A 4FVMA 1FZ6E 4JS4A 3SUQA 3TABA 1MHYG 4M3TA 2PFVA 3J2PA 3WSOA 1IH7A 4RL5A 4M41A 2JHAA 1FZIE 3OGLB 4FK0A 2B1EA 4E4BA 4FJ5A 4EPHA 2FW3A 2PFTA 3QEVA 3MKSB 5IBKB 3RMCA 4J2DA 5IREA 4M3RA 3QEXA 2LF6A 2OVPB 4FJKA 3V7DB 4FJXA 4KHQA 1XU5E 3C6NB 3LD8A 4JRQA 3SJJA 2OVQB 4DTUA 3RWUA 4EYWA 3L1NA 3KD1E 4FK4A 3L0MA 1FS1A 1XVBE 3SI6A 3NE6A 3NDKA 1XL3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEX B;  1LDK E;  3OGK B;  3L2O B;  2E31 A;  2P1N B;  3C6P B;  2OVR B;  3WSO A;  2E32 A;  3OGL B;  3C6O B;  3MKS B;  5IBK B;  2OVP B;  3V7D B;  2P1P B;  4I6J B;  3C6N B;  2OVQ B;  2P1M B;  2P1O B;  1FS1 A;  3OGM B;  2P1Q B;  1P22 A; 
#chains in the Genus database with same CATH topology
 4AKI A;  2OYQ A;  3UIQ A;  3SQ2 A;  3QET A;  3RMB A;  1WAJ A;  4HCB A;  2H4T A;  1MHZ G;  1WAF A;  4KHU A;  1XMH E;  4M42 A;  3N1B A;  1FZH E;  1FYZ E;  2YB5 A;  3L2O B;  2E31 A;  4DTR A;  3TAG A;  2P1N B;  2OVR B;  3TAF A;  4DTN A;  1IG9 A;  4DU1 A;  3C95 A;  3HGL A;  2JH9 A;  3NGI A;  4JRP A;  3K2O A;  3QNO A;  3C6O B;  2P5O A;  4DTX A;  4DU3 A;  4KHN A;  4ADO A;  4DTS A;  1JW2 A;  4I9L A;  3RMD A;  2MW2 A;  4FJL A;  2B8I A;  4M3X A;  2JHP A;  3QEI A;  4E3S A;  4RNG A;  5H37 A;  3UO2 A;  3NHG A;  1FXX A;  3QES A;  1FZ9 E;  1XVE E;  3HL8 A;  2P1O B;  4ICG C;  1XVD E;  2MMB A;  4DTP A;  1XVG E;  4FJ9 A;  4FJH A;  2FYO A;  2P1Q B;  4DTO A;  1P22 A;  4FJM A;  3SQ4 A;  1XMF E;  3CFO A;  4I9Q A;  3HGK E;  2VIX A;  3NCI A;  2ATQ A;  1NEX B;  1Q9X A;  1LDK E;  4B08 A;  4EP9 A;  4KHY A;  1FZ0 E;  4M3U A;  3QEP A;  3N1E A;  2JHC A;  3TL8 B;  4HCC A;  4AKG A;  2MZW B;  2VJ5 A;  1FPO A;  2B7M A;  4FJ7 A;  1Q9Y A;  3SPZ A;  3SNN A;  1FZ5 E;  3SCX A;  4M3W A;  1FZ8 E;  3TJY A;  2HD0 A;  5IZ7 A;  4ADN A;  3LZJ A;  3SQ0 A;  4KI4 A;  4J2A A;  4FJN A;  2VJ4 A;  2DY4 A;  2P1P B;  3E4W A;  3LZI A;  4FJI A;  3SPY A;  2P1M B;  4QND A;  4FJJ A;  3SUP A;  3LDS A;  2QXF A;  4GAM C;  3NAE A;  2RCU A;  3OGM B;  4FK2 A;  3HP9 A;  4QNC A;  3LDB A;  3UO3 A;  2P5G A;  3SQ1 A;  4DU4 A;  3KD5 E;  3C94 A;  3E4Y A;  3QEW A;  1MMO G;  1N1C A;  2LF3 A;  4X5N A;  3QNN A;  2JH8 A;  1FZ2 E;  4RG8 A;  4J2E A;  1MTY G;  4KHW A;  3L8B A;  3OGK B;  4KI6 A;  4X5M A;  3CFR A;  4AKH A;  3C6P B;  3CFP A;  2E32 A;  3SUO A;  4FJG A;  4DTM A;  3BVO A;  1FZ7 E;  3J27 A;  2K5S A;  3SUN A;  3RMA A;  1CLQ A;  4M3Y A;  4KHS A;  2OZS A;  4DTJ A;  4I6J B;  1XMG E;  3SVI A;  2OZM A;  3S9H A;  3QER A;  1FZ3 E;  3TAE A;  2JPN A;  4M45 A;  4M3Z A;  1FZ4 E;  4IT5 A;  4JS5 A;  3CQ8 A;  4J2B A;  4AI6 A;  2DTU A;  2JQT A;  1FZ1 E;  1XU3 E;  1XVC E;  1XVF E;  2DEB A;  4FJ8 A;  4FVM A;  1FZ6 E;  4JS4 A;  3SUQ A;  3TAB A;  1MHY G;  4M3T A;  2PFV A;  3J2P A;  3WSO A;  1IH7 A;  4RL5 A;  4M41 A;  2JHA A;  1FZI E;  3OGL B;  4FK0 A;  2B1E A;  4E4B A;  4FJ5 A;  4EPH A;  2FW3 A;  2PFT A;  3QEV A;  3MKS B;  5IBK B;  2RKH A;  3RMC A;  4J2D A;  5IRE A;  4M3R A;  3QEX A;  2LF6 A;  2OVP B;  4FJK A;  3V7D B;  4FJX A;  4KHQ A;  1XU5 E;  3C6N B;  3LD8 A;  4JRQ A;  3SJJ A;  2OVQ B;  4DTU A;  3RWU A;  4EYW A;  3L1N A;  3KD1 E;  4FK4 A;  3L0M A;  1FS1 A;  1XVB E;  3SI6 A;  3NE6 A;  3NDK A;  1XL3 C; 
#chains in the Genus database with same CATH homology
 4AKI A;  2OYQ A;  3UIQ A;  3SQ2 A;  3QET A;  3RMB A;  1WAJ A;  4HCB A;  2H4T A;  1MHZ G;  1WAF A;  4KHU A;  1XMH E;  4M42 A;  3N1B A;  1FZH E;  1FYZ E;  2YB5 A;  3L2O B;  2E31 A;  4DTR A;  3TAG A;  2P1N B;  2OVR B;  3TAF A;  4DTN A;  1IG9 A;  4DU1 A;  3C95 A;  3HGL A;  2JH9 A;  3NGI A;  4JRP A;  3K2O A;  3QNO A;  3C6O B;  2P5O A;  4DTX A;  4DU3 A;  4KHN A;  4ADO A;  4DTS A;  4I9L A;  3RMD A;  4FJL A;  4M3X A;  2B8I A;  2JHP A;  3QEI A;  4E3S A;  4RNG A;  5H37 A;  3NHG A;  1FXX A;  3QES A;  1FZ9 E;  1XVE E;  3HL8 A;  2P1O B;  4DTP A;  1XVD E;  2MMB A;  1XVG E;  4FJ9 A;  4FJH A;  2FYO A;  2P1Q B;  4DTO A;  1P22 A;  4FJM A;  3SQ4 A;  1XMF E;  3CFO A;  4I9Q A;  3HGK E;  2VIX A;  3NCI A;  2ATQ A;  1NEX B;  1Q9X A;  1LDK E;  4B08 A;  4EP9 A;  4KHY A;  1FZ0 E;  4M3U A;  3QEP A;  3N1E A;  2JHC A;  3TL8 B;  4HCC A;  4AKG A;  2MZW B;  2VJ5 A;  4FJ7 A;  2B7M A;  1Q9Y A;  3SPZ A;  3SNN A;  1FZ5 E;  3SCX A;  4M3W A;  1FZ8 E;  3TJY A;  2HD0 A;  5IZ7 A;  4ADN A;  3LZJ A;  3SQ0 A;  4KI4 A;  4J2A A;  4FJN A;  2VJ4 A;  2DY4 A;  2P1P B;  3E4W A;  3LZI A;  4FJI A;  3SPY A;  2P1M B;  4QND A;  4FJJ A;  3SUP A;  3LDS A;  2QXF A;  4GAM C;  3NAE A;  2RCU A;  3OGM B;  4FK2 A;  3HP9 A;  4QNC A;  3LDB A;  2P5G A;  3SQ1 A;  4DU4 A;  3KD5 E;  3C94 A;  3E4Y A;  3QEW A;  1MMO G;  2LF3 A;  4X5N A;  3QNN A;  2JH8 A;  1FZ2 E;  4RG8 A;  4J2E A;  1MTY G;  4KHW A;  3L8B A;  3OGK B;  4KI6 A;  4X5M A;  3CFR A;  4AKH A;  3C6P B;  3CFP A;  2E32 A;  3SUO A;  4FJG A;  4DTM A;  1FZ7 E;  3J27 A;  3RMA A;  3SUN A;  1CLQ A;  4M3Y A;  4KHS A;  2OZS A;  4DTJ A;  4I6J B;  1XMG E;  3SVI A;  2OZM A;  3S9H A;  3QER A;  1FZ3 E;  3TAE A;  2JPN A;  4M45 A;  4M3Z A;  1FZ4 E;  4JS5 A;  3CQ8 A;  4J2B A;  4AI6 A;  2DTU A;  1FZ1 E;  1XU3 E;  1XVC E;  1XVF E;  2DEB A;  4FJ8 A;  4FVM A;  1FZ6 E;  4JS4 A;  3SUQ A;  3TAB A;  1MHY G;  4M3T A;  2PFV A;  3J2P A;  3WSO A;  1IH7 A;  4RL5 A;  4M41 A;  2JHA A;  1FZI E;  3OGL B;  4FK0 A;  2B1E A;  4E4B A;  4FJ5 A;  4EPH A;  2FW3 A;  2PFT A;  3QEV A;  3MKS B;  5IBK B;  3RMC A;  4J2D A;  5IRE A;  4M3R A;  3QEX A;  2LF6 A;  2OVP B;  4FJK A;  3V7D B;  4FJX A;  4KHQ A;  1XU5 E;  3C6N B;  3LD8 A;  4JRQ A;  3SJJ A;  2OVQ B;  4DTU A;  3RWU A;  4EYW A;  3L1N A;  3KD1 E;  4FK4 A;  3L0M A;  1FS1 A;  1XVB E;  3SI6 A;  3NE6 A;  3NDK A;  1XL3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...