3N1EA

Vps54 c-terminal domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
b'DQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein 54
publication title Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 56
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.130 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3n1eA02
3N1EA 3N1BA
chains in the Genus database with same CATH superfamily
4M41A 3WSOA 3C6OB 3RMDA 4J2EA 1N1CA 4QNCA 4FJMA 2DTUA 2RKHA 3CFRA 2P5OA 1LDKE 1XVCE 3J2PA 3SUNA 3NCIA 4M3UA 4X5MA 3MKSB 2P1QB 3N1EA 4M3YA 3N1BA 4KHYA 3SCXA 2PFVA 3SPZA 4J2BA 4FJ8A 3TL8B 3NE6A 3S9HA 2ATQA 4FK2A 4RG8A 3SPYA 3OGLB 1MHYG 3QEXA 4ADNA 4JRQA 3CFPA 1Q9XA 3C95A 3QETA 3E4WA 4KI6A 4FJKA 1Q9YA 3QEVA 4DTJA 3UO2A 2P1MB 3L0MA 4FJLA 4KHQA 3LZIA 1FZ0E 1CLQA 4AKGA 3RMAA 2FYOA 4EP9A 4FJIA 1XVFE 1XU5E 2JHPA 3NGIA 2JPNA 2QXFA 4ADOA 3TAEA 3SQ4A 3SQ1A 2HD0A 3C6PB 3UO3A 4JRPA 1JW2A 3QEIA 1FZ4E 2MW2A 3L2OB 1FXXA 2VJ5A 3RMCA 4FJGA 3QEPA 4FJ9A 4DTMA 1FZ9E 2P1NB 2K5SA 4DTUA 2B7MA 3CQ8A 1WAJA 4DTNA 4QNDA 4HCBA 3HL8A 3CFOA 4FJHA 3TAFA 4GAMC 4RL5A 5IREA 3HGLA 1FZ3E 1XVEE 4FJNA 4JS5A 2JH9A 4HCCA 5IZ7A 4KHSA 4FK4A 3QESA 2JHAA 2OVQB 1XL3C 4DTXA 4I9QA 2FW3A 4AKIA 1MHZG 4X5NA 2JH8A 2LF3A 3NAEA 4AI6A 3K2OA 3KD5E 4FVMA 2JQTA 1FYZE 2PFTA 1FZIE 1WAFA 4I9LA 1XMFE 3SVIA 3OGKB 1XU3E 3TAGA 4DU1A 2B1EA 3NDKA 2E31A 1FZ6E 3L8BA 3RMBA 3SNNA 4EYWA 2LF6A 3RWUA 2P1OB 1MMOG 1XVDE 1XMGE 2P1PB 2YB5A 3E4YA 4DU4A 3SUPA 3SUOA 1FZ2E 2OYQA 4KI4A 4M3WA 4IT5A 3QERA 3OGMB 4ICGC 3UIQA 4FK0A 3KD1E 4FJ7A 3TJYA 4E4BA 1XVBE 4M3ZA 3HGKE 3SJJA 4J2DA 4M42A 1XVGE 4KHNA 4FJXA 1P22A 3QEWA 2OVRB 2VIXA 3C6NB 4M45A 1MTYG 2DY4A 1FZ8E 4JS4A 3LD8A 2RCUA 4DU3A 3QNNA 3SQ0A 4B08A 3LDSA 1IH7A 4J2AA 1FZ5E 2OVPB 3QNOA 4DTSA 1FS1A 3NHGA 3V7DB 2OZSA 4FJ5A 3SQ2A 1IG9A 4FJJA 4AKHA 3J27A 3L1NA 2P5GA 2DEBA 4M3RA 3C94A 1FZ7E 4E3SA 1FPOA 1XMHE 4KHUA 4M3XA 1FZHE 3BVOA 3SUQA 2JHCA 2VJ4A 4RNGA 2B8IA 4I6JB 5H37A 4DTOA 4DTPA 1NEXB 4EPHA 3TABA 4M3TA 1FZ1E 3LDBA 2MZWB 3SI6A 2H4TA 2OZMA 4KHWA 2MMBA 3LZJA 4DTRA 3HP9A 5IBKB 2E32A
chains in the Genus database with same CATH topology
4M41A 3WSOA 3C6OB 3RMDA 4J2EA 4FJMA 4QNCA 2DTUA 3CFRA 2P5OA 1LDKE 1XVCE 3J2PA 3SUNA 3NCIA 4M3UA 4X5MA 3MKSB 2P1QB 3N1EA 4M3YA 3N1BA 4KHYA 3SCXA 2PFVA 3SPZA 4J2BA 4FJ8A 3TL8B 3NE6A 3S9HA 2ATQA 4FK2A 4RG8A 3SPYA 3OGLB 1MHYG 3QEXA 4ADNA 4JRQA 3CFPA 1Q9XA 3C95A 3QETA 3E4WA 4KI6A 4FJKA 1Q9YA 3QEVA 4DTJA 4AKGA 2P1MB 3L0MA 4FJLA 4KHQA 3LZIA 1FZ0E 1CLQA 3RMAA 2FYOA 4EP9A 4FJIA 1XVFE 1XU5E 2JHPA 3NGIA 2JPNA 2QXFA 4ADOA 3TAEA 3SQ4A 3SQ1A 2HD0A 3C6PB 4JRPA 3QEIA 1FZ4E 3RMCA 3L2OB 1FXXA 2VJ5A 4FJGA 3QEPA 4FJ9A 4DTMA 1FZ9E 2P1NB 4DTUA 2B7MA 3CQ8A 1WAJA 4DTNA 4QNDA 4HCBA 3HL8A 3CFOA 4FJHA 3TAFA 4GAMC 4RL5A 5IREA 3HGLA 1FZ3E 1XVEE 4FJNA 4JS5A 2JH9A 4HCCA 5IZ7A 4KHSA 4FK4A 3QESA 2JHAA 2OVQB 1XL3C 4DTXA 4I9QA 2FW3A 4AKIA 1MHZG 4X5NA 2JH8A 2LF3A 3NAEA 4AI6A 3K2OA 3KD5E 4FVMA 1FYZE 2PFTA 1FZIE 1WAFA 4I9LA 1XMFE 3SVIA 3OGKB 1XU3E 3TAGA 4DU1A 2B1EA 3NDKA 2E31A 1FZ6E 3L8BA 3RMBA 3SNNA 4EYWA 2LF6A 3RWUA 2P1OB 1MMOG 1XVDE 1XMGE 2P1PB 2YB5A 3E4YA 4DU4A 3SUPA 3SUOA 1FZ2E 2OYQA 4KI4A 4M3WA 4FK0A 3QERA 3OGMB 3UIQA 3KD1E 4FJ7A 3TJYA 4E4BA 1XVBE 4M3ZA 3HGKE 3SJJA 4J2DA 4M42A 1XVGE 4KHNA 4FJXA 1P22A 3QEWA 2OVRB 2VIXA 3C6NB 4M45A 1MTYG 2DY4A 1FZ8E 4JS4A 3LD8A 2RCUA 4DU3A 3QNNA 3SQ0A 4B08A 3LDSA 1IH7A 4J2AA 1FZ5E 2OVPB 3QNOA 4DTSA 1FS1A 3NHGA 3V7DB 2OZSA 4FJ5A 3SQ2A 1IG9A 4FJJA 4AKHA 3J27A 3L1NA 2P5GA 2DEBA 4M3RA 3C94A 1FZ7E 4E3SA 1XMHE 4KHUA 4M3XA 1FZHE 3SUQA 2JHCA 2VJ4A 4RNGA 2B8IA 4I6JB 5H37A 4DTOA 4DTPA 1NEXB 4EPHA 3TABA 4M3TA 1FZ1E 3LDBA 2MZWB 3SI6A 2H4TA 2OZMA 4KHWA 2MMBA 3LZJA 4DTRA 3HP9A 5IBKB 2E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1E A;  3N1B A; 
#chains in the Genus database with same CATH topology
 4M41 A;  3WSO A;  3C6O B;  3RMD A;  4J2E A;  1N1C A;  4QNC A;  4FJM A;  2DTU A;  2RKH A;  3CFR A;  2P5O A;  1LDK E;  1XVC E;  3J2P A;  3SUN A;  3NCI A;  4M3U A;  4X5M A;  3MKS B;  2P1Q B;  3N1E A;  4M3Y A;  3N1B A;  4KHY A;  3SCX A;  2PFV A;  3SPZ A;  4J2B A;  4FJ8 A;  3TL8 B;  3NE6 A;  3S9H A;  2ATQ A;  4FK2 A;  4RG8 A;  3SPY A;  3OGL B;  1MHY G;  3QEX A;  4ADN A;  4JRQ A;  3CFP A;  1Q9X A;  3C95 A;  3QET A;  3E4W A;  4KI6 A;  4FJK A;  1Q9Y A;  3QEV A;  4DTJ A;  3UO2 A;  2P1M B;  3L0M A;  4FJL A;  4KHQ A;  3LZI A;  1FZ0 E;  1CLQ A;  4AKG A;  3RMA A;  2FYO A;  4EP9 A;  4FJI A;  1XVF E;  1XU5 E;  2JHP A;  3NGI A;  2JPN A;  2QXF A;  4ADO A;  3TAE A;  3SQ4 A;  3SQ1 A;  2HD0 A;  3C6P B;  3UO3 A;  4JRP A;  1JW2 A;  3QEI A;  1FZ4 E;  2MW2 A;  3L2O B;  1FXX A;  2VJ5 A;  3RMC A;  4FJG A;  3QEP A;  4FJ9 A;  4DTM A;  1FZ9 E;  2P1N B;  2K5S A;  4DTU A;  2B7M A;  3CQ8 A;  1WAJ A;  4DTN A;  4QND A;  4HCB A;  3HL8 A;  3CFO A;  4FJH A;  3TAF A;  4GAM C;  4RL5 A;  5IRE A;  3HGL A;  1FZ3 E;  1XVE E;  4FJN A;  4JS5 A;  2JH9 A;  4HCC A;  5IZ7 A;  4KHS A;  4FK4 A;  3QES A;  2JHA A;  2OVQ B;  1XL3 C;  4DTX A;  4I9Q A;  2FW3 A;  4AKI A;  1MHZ G;  4X5N A;  2JH8 A;  2LF3 A;  3NAE A;  4AI6 A;  3K2O A;  3KD5 E;  4FVM A;  2JQT A;  1FYZ E;  2PFT A;  1FZI E;  1WAF A;  4I9L A;  1XMF E;  3SVI A;  3OGK B;  1XU3 E;  3TAG A;  4DU1 A;  2B1E A;  3NDK A;  2E31 A;  1FZ6 E;  3L8B A;  3RMB A;  3SNN A;  4EYW A;  2LF6 A;  3RWU A;  2P1O B;  1MMO G;  1XVD E;  1XMG E;  2P1P B;  2YB5 A;  3E4Y A;  4DU4 A;  3SUP A;  3SUO A;  1FZ2 E;  2OYQ A;  4KI4 A;  4M3W A;  4IT5 A;  3QER A;  3OGM B;  4ICG C;  3UIQ A;  4FK0 A;  3KD1 E;  4FJ7 A;  3TJY A;  4E4B A;  1XVB E;  4M3Z A;  3HGK E;  3SJJ A;  4J2D A;  4M42 A;  1XVG E;  4KHN A;  4FJX A;  1P22 A;  3QEW A;  2OVR B;  2VIX A;  3C6N B;  4M45 A;  1MTY G;  2DY4 A;  1FZ8 E;  4JS4 A;  3LD8 A;  2RCU A;  4DU3 A;  3QNN A;  3SQ0 A;  4B08 A;  3LDS A;  1IH7 A;  4J2A A;  1FZ5 E;  2OVP B;  3QNO A;  4DTS A;  1FS1 A;  3NHG A;  3V7D B;  2OZS A;  4FJ5 A;  3SQ2 A;  1IG9 A;  4FJJ A;  4AKH A;  3J27 A;  3L1N A;  2P5G A;  2DEB A;  4M3R A;  3C94 A;  1FZ7 E;  4E3S A;  1FPO A;  1XMH E;  4KHU A;  4M3X A;  1FZH E;  3BVO A;  3SUQ A;  2JHC A;  2VJ4 A;  4RNG A;  2B8I A;  4I6J B;  5H37 A;  4DTO A;  4DTP A;  1NEX B;  4EPH A;  3TAB A;  4M3T A;  1FZ1 E;  3LDB A;  2MZW B;  3SI6 A;  2H4T A;  2OZM A;  4KHW A;  2MMB A;  3LZJ A;  4DTR A;  3HP9 A;  5IBK B;  2E32 A; 
#chains in the Genus database with same CATH homology
 4M41 A;  3WSO A;  3C6O B;  3RMD A;  4J2E A;  4FJM A;  4QNC A;  2DTU A;  3CFR A;  2P5O A;  1LDK E;  1XVC E;  3J2P A;  3SUN A;  3NCI A;  4M3U A;  4X5M A;  3MKS B;  2P1Q B;  3N1E A;  4M3Y A;  3N1B A;  4KHY A;  3SCX A;  2PFV A;  3SPZ A;  4J2B A;  4FJ8 A;  3TL8 B;  3NE6 A;  3S9H A;  2ATQ A;  4FK2 A;  4RG8 A;  3SPY A;  3OGL B;  1MHY G;  3QEX A;  4ADN A;  4JRQ A;  3CFP A;  1Q9X A;  3C95 A;  3QET A;  3E4W A;  4KI6 A;  4FJK A;  1Q9Y A;  3QEV A;  4DTJ A;  4AKG A;  2P1M B;  3L0M A;  4FJL A;  4KHQ A;  3LZI A;  1FZ0 E;  1CLQ A;  3RMA A;  2FYO A;  4EP9 A;  4FJI A;  1XVF E;  1XU5 E;  2JHP A;  3NGI A;  2JPN A;  2QXF A;  4ADO A;  3TAE A;  3SQ4 A;  3SQ1 A;  2HD0 A;  3C6P B;  4JRP A;  3QEI A;  1FZ4 E;  3RMC A;  3L2O B;  1FXX A;  2VJ5 A;  4FJG A;  3QEP A;  4FJ9 A;  4DTM A;  1FZ9 E;  2P1N B;  4DTU A;  2B7M A;  3CQ8 A;  1WAJ A;  4DTN A;  4QND A;  4HCB A;  3HL8 A;  3CFO A;  4FJH A;  3TAF A;  4GAM C;  4RL5 A;  5IRE A;  3HGL A;  1FZ3 E;  1XVE E;  4FJN A;  4JS5 A;  2JH9 A;  4HCC A;  5IZ7 A;  4KHS A;  4FK4 A;  3QES A;  2JHA A;  2OVQ B;  1XL3 C;  4DTX A;  4I9Q A;  2FW3 A;  4AKI A;  1MHZ G;  4X5N A;  2JH8 A;  2LF3 A;  3NAE A;  4AI6 A;  3K2O A;  3KD5 E;  4FVM A;  1FYZ E;  2PFT A;  1FZI E;  1WAF A;  4I9L A;  1XMF E;  3SVI A;  3OGK B;  1XU3 E;  3TAG A;  4DU1 A;  2B1E A;  3NDK A;  2E31 A;  1FZ6 E;  3L8B A;  3RMB A;  3SNN A;  4EYW A;  2LF6 A;  3RWU A;  2P1O B;  1MMO G;  1XVD E;  1XMG E;  2P1P B;  2YB5 A;  3E4Y A;  4DU4 A;  3SUP A;  3SUO A;  1FZ2 E;  2OYQ A;  4KI4 A;  4M3W A;  4FK0 A;  3QER A;  3OGM B;  3UIQ A;  3KD1 E;  4FJ7 A;  3TJY A;  4E4B A;  1XVB E;  4M3Z A;  3HGK E;  3SJJ A;  4J2D A;  4M42 A;  1XVG E;  4KHN A;  4FJX A;  1P22 A;  3QEW A;  2OVR B;  2VIX A;  3C6N B;  4M45 A;  1MTY G;  2DY4 A;  1FZ8 E;  4JS4 A;  3LD8 A;  2RCU A;  4DU3 A;  3QNN A;  3SQ0 A;  4B08 A;  3LDS A;  1IH7 A;  4J2A A;  1FZ5 E;  2OVP B;  3QNO A;  4DTS A;  1FS1 A;  3NHG A;  3V7D B;  2OZS A;  4FJ5 A;  3SQ2 A;  1IG9 A;  4FJJ A;  4AKH A;  3J27 A;  3L1N A;  2P5G A;  2DEB A;  4M3R A;  3C94 A;  1FZ7 E;  4E3S A;  1XMH E;  4KHU A;  4M3X A;  1FZH E;  3SUQ A;  2JHC A;  2VJ4 A;  4RNG A;  2B8I A;  4I6J B;  5H37 A;  4DTO A;  4DTP A;  1NEX B;  4EPH A;  3TAB A;  4M3T A;  1FZ1 E;  3LDB A;  2MZW B;  3SI6 A;  2H4T A;  2OZM A;  4KHW A;  2MMB A;  3LZJ A;  4DTR A;  3HP9 A;  5IBK B;  2E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...