3N1EA

Vps54 c-terminal domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
DQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Vacuolar protein sorting-associated protein 54
total genus 56
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.130 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3n1eA02
3N1EA 3N1BA
chains in the Genus database with same CATH superfamily
2P5GA 1MHZG 2PFVA 4DTXA 3TAFA 4M3YA 1XU5E 4M3TA 3J27A 4QNCA 4FJGA 1XVFE 2OVQB 1MHYG 2FYOA 3L2OB 1XMHE 3OGKB 4AKIA 1NEXB 4J2AA 4DTPA 3L1NA 1FZ5E 2JHPA 2JHCA 4DU4A 4AI6A 2JHAA 1XVGE 2ATQA 3RMCA 2OZSA 4KHWA 2HD0A 3RWUA 3C94A 3SUOA 3OGMB 3C95A 4FK0A 5H37A 3SQ0A 3NCIA 1WAFA 3SUPA 4I6JB 4M41A 4M3UA 2MMBA 2VIXA 3HL8A 3UO3A 2DY4A 3CFOA 4FVMA 4I9LA 1N1CA 4X5NA 1FYZE 3V7DB 4DTSA 3C6PB 2OZMA 4KHYA 1LDKE 4AKGA 4I9QA 1XVCE 4FJ7A 2K5SA 4RNGA 3L0MA 3QNNA 3SUQA 4KHQA 4EYWA 3QETA 4DTUA 2DTUA 4JS5A 4M3WA 3J2PA 3SQ2A 1FZ0E 2E32A 3CQ8A 4B08A 4FJNA 4DTRA 1XMGE 4KI6A 4M42A 3NE6A 2P1MB 3KD1E 2DEBA 2OVRB 2P1NB 2P5OA 5IBKB 2VJ4A 3SQ4A 2JQTA 4X5MA 4M3XA 4GAMC 4FJ5A 4DU3A 2OVPB 4KHNA 3CFRA 1XVDE 3KD5E 3LD8A 1JW2A 4JS4A 3SPYA 2H4TA 5IZ7A 3RMDA 2JH8A 3S9HA 3QEVA 4M3ZA 3SI6A 4J2DA 5IREA 3L8BA 1FZIE 1FPOA 1CLQA 4FJMA 3N1BA 4J2EA 4KHSA 4JRQA 3OGLB 1XVBE 3TAEA 4FJ8A 3CFPA 3RMBA 4DTNA 1XVEE 4DTMA 3MKSB 2JH9A 3TL8B 4ADOA 3TAGA 3QEXA 3HGLA 2VJ5A 1FS1A 2E31A 3TJYA 3QNOA 2RKHA 4IT5A 1FZ8E 4M3RA 3SPZA 4DTJA 2LF3A 4QNDA 4KI4A 3SVIA 3NAEA 4FK2A 3SUNA 1Q9XA 4FJIA 4FJLA 3NGIA 4E4BA 2MW2A 4EP9A 3E4WA 3SQ1A 1MMOG 1FZ2E 2JPNA 4ADNA 4KHUA 3E4YA 3LDBA 4DTOA 3QEIA 1P22A 2B8IA 2MZWB 1IG9A 4FJ9A 4FK4A 1FZHE 4RL5A 3C6NB 3N1EA 4DU1A 2P1QB 3WSOA 3QESA 4JRPA 1XL3C 4E3SA 4ICGC 3TABA 3NHGA 2LF6A 1FZ6E 4RG8A 3NDKA 3QERA 2FW3A 3SNNA 3SCXA 1FZ9E 1FXXA 4FJKA 2YB5A 3UIQA 2P1PB 1FZ1E 4HCBA 1Q9YA 3RMAA 2B7MA 1FZ3E 2B1EA 2RCUA 3QEPA 1XU3E 3K2OA 1FZ7E 1WAJA 3HGKE 4HCCA 1XMFE 4FJJA 1FZ4E 3SJJA 1IH7A 2P1OB 3UO2A 4J2BA 3LDSA 3HP9A 4FJHA 3BVOA 3C6OB 4EPHA 4AKHA 2QXFA 1MTYG 3LZIA 3LZJA 2PFTA 3QEWA 2OYQA 4FJXA 4M45A
chains in the Genus database with same CATH topology
2P5GA 1MHZG 2PFVA 4DTXA 3TAFA 4M3YA 1XU5E 4M3TA 3J27A 4QNCA 4FJGA 1XVFE 2OVQB 1MHYG 2FYOA 3L2OB 1XMHE 3OGKB 4AKIA 1NEXB 4J2AA 4DTPA 3L1NA 1FZ5E 2JHPA 2JHCA 4DU4A 4AI6A 2JHAA 1XVGE 2ATQA 3RMCA 2OZSA 4KHWA 2HD0A 3RWUA 3C94A 3SUOA 3OGMB 3C95A 4FK0A 5H37A 3SQ0A 3NCIA 1WAFA 3SUPA 4I6JB 4M41A 4M3UA 2MMBA 2VIXA 3HL8A 2DY4A 3CFOA 4FVMA 4I9LA 4X5NA 1FYZE 3V7DB 4DTSA 3C6PB 2OZMA 4KHYA 1LDKE 4AKGA 4I9QA 1XVCE 4FJ7A 4RNGA 3L0MA 3QNNA 3SUQA 4KHQA 4EYWA 3QETA 4DTUA 2DTUA 4JS5A 4M3WA 3J2PA 3SQ2A 1FZ0E 2E32A 3CQ8A 4B08A 4FJNA 4DTRA 1XMGE 4KI6A 4M42A 3NE6A 2P1MB 3KD1E 2DEBA 2OVRB 2P1NB 2P5OA 5IBKB 2VJ4A 3SQ4A 4X5MA 4M3XA 4GAMC 4FJ5A 4DU3A 2OVPB 4KHNA 3CFRA 1XVDE 3KD5E 3LD8A 4JS4A 3SPYA 2H4TA 5IZ7A 3RMDA 2JH8A 3S9HA 3QEVA 4M3ZA 3SI6A 4J2DA 5IREA 3L8BA 1FZIE 1CLQA 4FJMA 3N1BA 4J2EA 4KHSA 4JRQA 3OGLB 1XVBE 3TAEA 4FJ8A 3CFPA 3RMBA 4DTNA 1XVEE 4DTMA 3MKSB 2JH9A 3TL8B 4ADOA 3TAGA 3QEXA 3HGLA 2VJ5A 1FS1A 2E31A 3TJYA 3QNOA 3SPZA 1FZ8E 4M3RA 4DTJA 2LF3A 4QNDA 4KI4A 3SVIA 3NAEA 4FK2A 3SUNA 1Q9XA 4FJIA 4FJLA 3NGIA 4E4BA 4EP9A 3E4WA 3SQ1A 1MMOG 1FZ2E 2JPNA 4ADNA 4KHUA 3E4YA 3LDBA 4DTOA 3QEIA 2B8IA 1P22A 2MZWB 1IG9A 4FJ9A 4FK4A 1FZHE 4RL5A 3C6NB 3N1EA 4DU1A 2P1QB 3WSOA 3QESA 4JRPA 1XL3C 4E3SA 3TABA 3NHGA 2LF6A 1FZ6E 4RG8A 3NDKA 3QERA 2FW3A 3SNNA 3SCXA 1FZ9E 1FXXA 4FJKA 2YB5A 3UIQA 2P1PB 1FZ1E 4HCBA 1Q9YA 3RMAA 2B7MA 1FZ3E 2B1EA 2RCUA 3QEPA 1XU3E 3K2OA 1FZ7E 1WAJA 3HGKE 4HCCA 1XMFE 4FJJA 1FZ4E 3SJJA 1IH7A 2P1OB 4J2BA 3LDSA 3HP9A 4FJHA 3C6OB 4AKHA 4EPHA 2QXFA 1MTYG 3LZIA 3LZJA 2PFTA 3QEWA 2OYQA 4FJXA 4M45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1E A;  3N1B A; 
#chains in the Genus database with same CATH topology
 2P5G A;  1MHZ G;  2PFV A;  4DTX A;  3TAF A;  4M3Y A;  1XU5 E;  4M3T A;  3J27 A;  4QNC A;  4FJG A;  1XVF E;  2OVQ B;  1MHY G;  2FYO A;  3L2O B;  1XMH E;  3OGK B;  4AKI A;  1NEX B;  4J2A A;  4DTP A;  3L1N A;  1FZ5 E;  2JHP A;  2JHC A;  4DU4 A;  4AI6 A;  2JHA A;  1XVG E;  2ATQ A;  3RMC A;  2OZS A;  4KHW A;  2HD0 A;  3RWU A;  3C94 A;  3SUO A;  3OGM B;  3C95 A;  4FK0 A;  5H37 A;  3SQ0 A;  3NCI A;  1WAF A;  3SUP A;  4I6J B;  4M41 A;  4M3U A;  2MMB A;  2VIX A;  3HL8 A;  3UO3 A;  2DY4 A;  3CFO A;  4FVM A;  4I9L A;  1N1C A;  4X5N A;  1FYZ E;  3V7D B;  4DTS A;  3C6P B;  2OZM A;  4KHY A;  1LDK E;  4AKG A;  4I9Q A;  1XVC E;  4FJ7 A;  2K5S A;  4RNG A;  3L0M A;  3QNN A;  3SUQ A;  4KHQ A;  4EYW A;  3QET A;  4DTU A;  2DTU A;  4JS5 A;  4M3W A;  3J2P A;  3SQ2 A;  1FZ0 E;  2E32 A;  3CQ8 A;  4B08 A;  4FJN A;  4DTR A;  1XMG E;  4KI6 A;  4M42 A;  3NE6 A;  2P1M B;  3KD1 E;  2DEB A;  2OVR B;  2P1N B;  2P5O A;  5IBK B;  2VJ4 A;  3SQ4 A;  2JQT A;  4X5M A;  4M3X A;  4GAM C;  4FJ5 A;  4DU3 A;  2OVP B;  4KHN A;  3CFR A;  1XVD E;  3KD5 E;  3LD8 A;  1JW2 A;  4JS4 A;  3SPY A;  2H4T A;  5IZ7 A;  3RMD A;  2JH8 A;  3S9H A;  3QEV A;  4M3Z A;  3SI6 A;  4J2D A;  5IRE A;  3L8B A;  1FZI E;  1FPO A;  1CLQ A;  4FJM A;  3N1B A;  4J2E A;  4KHS A;  4JRQ A;  3OGL B;  1XVB E;  3TAE A;  4FJ8 A;  3CFP A;  3RMB A;  4DTN A;  1XVE E;  4DTM A;  3MKS B;  2JH9 A;  3TL8 B;  4ADO A;  3TAG A;  3QEX A;  3HGL A;  2VJ5 A;  1FS1 A;  2E31 A;  3TJY A;  3QNO A;  2RKH A;  4IT5 A;  1FZ8 E;  4M3R A;  3SPZ A;  4DTJ A;  2LF3 A;  4QND A;  4KI4 A;  3SVI A;  3NAE A;  4FK2 A;  3SUN A;  1Q9X A;  4FJI A;  4FJL A;  3NGI A;  4E4B A;  2MW2 A;  4EP9 A;  3E4W A;  3SQ1 A;  1MMO G;  1FZ2 E;  2JPN A;  4ADN A;  4KHU A;  3E4Y A;  3LDB A;  4DTO A;  3QEI A;  1P22 A;  2B8I A;  2MZW B;  1IG9 A;  4FJ9 A;  4FK4 A;  1FZH E;  4RL5 A;  3C6N B;  3N1E A;  4DU1 A;  2P1Q B;  3WSO A;  3QES A;  4JRP A;  1XL3 C;  4E3S A;  4ICG C;  3TAB A;  3NHG A;  2LF6 A;  1FZ6 E;  4RG8 A;  3NDK A;  3QER A;  2FW3 A;  3SNN A;  3SCX A;  1FZ9 E;  1FXX A;  4FJK A;  2YB5 A;  3UIQ A;  2P1P B;  1FZ1 E;  4HCB A;  1Q9Y A;  3RMA A;  2B7M A;  1FZ3 E;  2B1E A;  2RCU A;  3QEP A;  1XU3 E;  3K2O A;  1FZ7 E;  1WAJ A;  3HGK E;  4HCC A;  1XMF E;  4FJJ A;  1FZ4 E;  3SJJ A;  1IH7 A;  2P1O B;  3UO2 A;  4J2B A;  3LDS A;  3HP9 A;  4FJH A;  3BVO A;  3C6O B;  4EPH A;  4AKH A;  2QXF A;  1MTY G;  3LZI A;  3LZJ A;  2PFT A;  3QEW A;  2OYQ A;  4FJX A;  4M45 A; 
#chains in the Genus database with same CATH homology
 2P5G A;  1MHZ G;  2PFV A;  4DTX A;  3TAF A;  4M3Y A;  1XU5 E;  4M3T A;  3J27 A;  4QNC A;  4FJG A;  1XVF E;  2OVQ B;  1MHY G;  2FYO A;  3L2O B;  1XMH E;  3OGK B;  4AKI A;  1NEX B;  4J2A A;  4DTP A;  3L1N A;  1FZ5 E;  2JHP A;  2JHC A;  4DU4 A;  4AI6 A;  2JHA A;  1XVG E;  2ATQ A;  3RMC A;  2OZS A;  4KHW A;  2HD0 A;  3RWU A;  3C94 A;  3SUO A;  3OGM B;  3C95 A;  4FK0 A;  5H37 A;  3SQ0 A;  3NCI A;  1WAF A;  3SUP A;  4I6J B;  4M41 A;  4M3U A;  2MMB A;  2VIX A;  3HL8 A;  2DY4 A;  3CFO A;  4FVM A;  4I9L A;  4X5N A;  1FYZ E;  3V7D B;  4DTS A;  3C6P B;  2OZM A;  4KHY A;  1LDK E;  4AKG A;  4I9Q A;  1XVC E;  4FJ7 A;  4RNG A;  3L0M A;  3QNN A;  3SUQ A;  4KHQ A;  4EYW A;  3QET A;  4DTU A;  2DTU A;  4JS5 A;  4M3W A;  3J2P A;  3SQ2 A;  1FZ0 E;  2E32 A;  3CQ8 A;  4B08 A;  4FJN A;  4DTR A;  1XMG E;  4KI6 A;  4M42 A;  3NE6 A;  2P1M B;  3KD1 E;  2DEB A;  2OVR B;  2P1N B;  2P5O A;  5IBK B;  2VJ4 A;  3SQ4 A;  4X5M A;  4M3X A;  4GAM C;  4FJ5 A;  4DU3 A;  2OVP B;  4KHN A;  3CFR A;  1XVD E;  3KD5 E;  3LD8 A;  4JS4 A;  3SPY A;  2H4T A;  5IZ7 A;  3RMD A;  2JH8 A;  3S9H A;  3QEV A;  4M3Z A;  3SI6 A;  4J2D A;  5IRE A;  3L8B A;  1FZI E;  1CLQ A;  4FJM A;  3N1B A;  4J2E A;  4KHS A;  4JRQ A;  3OGL B;  1XVB E;  3TAE A;  4FJ8 A;  3CFP A;  3RMB A;  4DTN A;  1XVE E;  4DTM A;  3MKS B;  2JH9 A;  3TL8 B;  4ADO A;  3TAG A;  3QEX A;  3HGL A;  2VJ5 A;  1FS1 A;  2E31 A;  3TJY A;  3QNO A;  3SPZ A;  1FZ8 E;  4M3R A;  4DTJ A;  2LF3 A;  4QND A;  4KI4 A;  3SVI A;  3NAE A;  4FK2 A;  3SUN A;  1Q9X A;  4FJI A;  4FJL A;  3NGI A;  4E4B A;  4EP9 A;  3E4W A;  3SQ1 A;  1MMO G;  1FZ2 E;  2JPN A;  4ADN A;  4KHU A;  3E4Y A;  3LDB A;  4DTO A;  3QEI A;  2B8I A;  1P22 A;  2MZW B;  1IG9 A;  4FJ9 A;  4FK4 A;  1FZH E;  4RL5 A;  3C6N B;  3N1E A;  4DU1 A;  2P1Q B;  3WSO A;  3QES A;  4JRP A;  1XL3 C;  4E3S A;  3TAB A;  3NHG A;  2LF6 A;  1FZ6 E;  4RG8 A;  3NDK A;  3QER A;  2FW3 A;  3SNN A;  3SCX A;  1FZ9 E;  1FXX A;  4FJK A;  2YB5 A;  3UIQ A;  2P1P B;  1FZ1 E;  4HCB A;  1Q9Y A;  3RMA A;  2B7M A;  1FZ3 E;  2B1E A;  2RCU A;  3QEP A;  1XU3 E;  3K2O A;  1FZ7 E;  1WAJ A;  3HGK E;  4HCC A;  1XMF E;  4FJJ A;  1FZ4 E;  3SJJ A;  1IH7 A;  2P1O B;  4J2B A;  3LDS A;  3HP9 A;  4FJH A;  3C6O B;  4AKH A;  4EPH A;  2QXF A;  1MTY G;  3LZI A;  3LZJ A;  2PFT A;  3QEW A;  2OYQ A;  4FJX A;  4M45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...