3N1EA

Vps54 c-terminal domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
DQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Vacuolar protein sorting-associated protein 54
total genus 56
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.130 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3n1eA02
3N1EA 3N1BA
chains in the Genus database with same CATH superfamily
3C6PB 3LDBA 1FZ1E 1MHYG 3RMDA 3SPZA 4KHWA 3CQ8A 4FJJA 2PFTA 1XVCE 4M45A 4JRPA 4J2DA 3L0MA 4FJHA 1Q9XA 5IBKB 1JW2A 3CFOA 3MKSB 3TAGA 3KD5E 2B8IA 4JS5A 3KD1E 4KHYA 4AKIA 1XMGE 3OGMB 2FW3A 3LDSA 3OGKB 4HCCA 3QEWA 4M3WA 4FVMA 3TJYA 3NAEA 2B1EA 3J27A 4FJ8A 1NEXB 4EPHA 2YB5A 4DTPA 4J2EA 4FJLA 3BVOA 2OVRB 2P1PB 3NHGA 2OYQA 4KI4A 4AI6A 3CFRA 1WAJA 1XU3E 2P1MB 1FZ3E 3SVIA 4M3TA 3RMCA 2MMBA 4GAMC 3N1BA 5IZ7A 2P1OB 2H4TA 1FZ0E 3S9HA 4FJGA 2JHCA 3UO2A 3UIQA 1FPOA 3N1EA 4I6JB 3L2OB 3QNNA 2DY4A 2E32A 2MW2A 3SQ1A 1XVEE 4KHSA 2DTUA 4DTMA 3SUPA 4FK2A 3QEVA 4DTRA 4J2AA 3TAFA 2FYOA 2MZWB 3RWUA 4M3RA 4FJNA 2K5SA 1XMFE 1FS1A 5H37A 4EYWA 3TL8B 4DTJA 3QEPA 2RCUA 3QEXA 3SQ2A 4KHNA 4X5MA 4QNCA 4AKGA 4AKHA 2PFVA 3V7DB 3LZIA 1IH7A 4EP9A 3SQ4A 4M42A 2B7MA 2P1NB 2VJ5A 3E4WA 3CFPA 2E31A 4KHQA 3TAEA 2JPNA 3L1NA 1FZIE 3QERA 3LD8A 2DEBA 4DTNA 1MMOG 2JQTA 4ADNA 4M3ZA 4IT5A 1XL3C 4M41A 4DTUA 4FJXA 3L8BA 4J2BA 4FJKA 4M3YA 4ADOA 3SNNA 2LF3A 2P5GA 3SQ0A 3SUNA 3QETA 1FZ7E 1XU5E 3NDKA 1N1CA 4B08A 3QNOA 3LZJA 2JH9A 4FJ9A 1FYZE 3RMAA 4FK4A 4M3XA 3HGLA 3NGIA 4RNGA 3UO3A 4E4BA 1XVBE 4I9LA 1Q9YA 3SI6A 4FJMA 1FZ4E 4X5NA 4QNDA 1MTYG 1XMHE 2OVQB 1CLQA 3HP9A 4ICGC 4M3UA 2ATQA 4DTOA 4RL5A 4DTSA 3NE6A 3SUQA 3SPYA 1FZ2E 3E4YA 2OZMA 3HGKE 2JHAA 2OVPB 3QEIA 2JH8A 3HL8A 4RG8A 3OGLB 3C95A 1FZ9E 1FZ6E 3TABA 2LF6A 2VIXA 4JRQA 4E3SA 4FK0A 2QXFA 3SJJA 2VJ4A 1LDKE 1XVGE 4FJ7A 3NCIA 1MHZG 3SCXA 3C94A 4I9QA 4FJIA 2HD0A 3K2OA 1FZ5E 3J2PA 4KHUA 3C6OB 3WSOA 4JS4A 2JHPA 4DU1A 3RMBA 3SUOA 4KI6A 2OZSA 4HCBA 1WAFA 1P22A 5IREA 4DTXA 2P5OA 4DU4A 2RKHA 1XVFE 1XVDE 1FZ8E 4DU3A 1IG9A 1FZHE 2P1QB 3QESA 4FJ5A 3C6NB 1FXXA
chains in the Genus database with same CATH topology
3C6PB 3LDBA 1FZ1E 1MHYG 3RMDA 3SPZA 4KHWA 3CQ8A 4FJJA 2PFTA 1XVCE 4M45A 4JRPA 4J2DA 3L0MA 4FJHA 1Q9XA 5IBKB 3CFOA 3MKSB 3TAGA 3KD5E 2B8IA 4JS5A 3KD1E 4KHYA 4AKIA 1XMGE 3OGMB 2FW3A 3LDSA 3OGKB 4HCCA 3QEWA 4M3WA 4FVMA 3TJYA 3NAEA 2B1EA 3J27A 4FJ8A 1NEXB 4EPHA 2YB5A 4DTPA 4J2EA 4FJLA 2OVRB 2P1PB 3NHGA 2OYQA 4KI4A 4AI6A 3CFRA 1WAJA 1XU3E 2P1MB 1FZ3E 3SVIA 4M3TA 3RMCA 2MMBA 4GAMC 3N1BA 5IZ7A 2P1OB 2H4TA 1FZ0E 3S9HA 4FJGA 2JHCA 3UIQA 3N1EA 4I6JB 3L2OB 3QNNA 2DY4A 2E32A 3SQ1A 1XVEE 4KHSA 2DTUA 4DTMA 3SUPA 4FK2A 3QEVA 4DTRA 4J2AA 3TAFA 2FYOA 2MZWB 3RWUA 4M3RA 4FJNA 1XMFE 1FS1A 5H37A 4EYWA 3TL8B 4DTJA 3QEPA 2RCUA 3QEXA 3SQ2A 4KHNA 4X5MA 4QNCA 4AKGA 4AKHA 2PFVA 3V7DB 3LZIA 1IH7A 4EP9A 3SQ4A 4M42A 2B7MA 2P1NB 2VJ5A 3E4WA 3CFPA 2E31A 4KHQA 3TAEA 2JPNA 3L1NA 1FZIE 3QERA 3LD8A 2DEBA 4DTNA 1MMOG 4ADNA 4M3ZA 1XL3C 4M41A 4DTUA 4FJXA 3L8BA 4J2BA 4FJKA 4M3YA 4ADOA 3SNNA 2LF3A 2P5GA 3SQ0A 3SUNA 3QETA 1FZ7E 1XU5E 3NDKA 4B08A 3QNOA 3LZJA 2JH9A 4FJ9A 1FYZE 3RMAA 4FK4A 4M3XA 3HGLA 3NGIA 4RNGA 4E4BA 1XVBE 4I9LA 1Q9YA 3SI6A 4FJMA 1FZ4E 4X5NA 4QNDA 1MTYG 1XMHE 2OVQB 1CLQA 3HP9A 4M3UA 2ATQA 4DTOA 4RL5A 4DTSA 3NE6A 3SUQA 3SPYA 1FZ2E 3E4YA 2OZMA 3HGKE 2JHAA 2OVPB 3QEIA 2JH8A 3HL8A 4RG8A 3OGLB 3C95A 1FZ9E 1FZ6E 3TABA 2LF6A 2VIXA 4JRQA 4E3SA 4FK0A 2QXFA 3SJJA 2VJ4A 1LDKE 1XVGE 4FJ7A 3NCIA 1MHZG 3SCXA 3C94A 4I9QA 4FJIA 2HD0A 3K2OA 1FZ5E 3J2PA 4KHUA 3C6OB 3WSOA 4JS4A 2JHPA 4DU1A 3RMBA 3SUOA 4KI6A 2OZSA 4HCBA 1WAFA 1P22A 5IREA 4DTXA 2P5OA 4DU4A 1XVFE 1XVDE 1FZ8E 4DU3A 1IG9A 1FZHE 2P1QB 3QESA 4FJ5A 3C6NB 1FXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1E A;  3N1B A; 
#chains in the Genus database with same CATH topology
 3C6P B;  3LDB A;  1FZ1 E;  1MHY G;  3RMD A;  3SPZ A;  4KHW A;  3CQ8 A;  4FJJ A;  2PFT A;  1XVC E;  4M45 A;  4JRP A;  4J2D A;  3L0M A;  4FJH A;  1Q9X A;  5IBK B;  1JW2 A;  3CFO A;  3MKS B;  3TAG A;  3KD5 E;  2B8I A;  4JS5 A;  3KD1 E;  4KHY A;  4AKI A;  1XMG E;  3OGM B;  2FW3 A;  3LDS A;  3OGK B;  4HCC A;  3QEW A;  4M3W A;  4FVM A;  3TJY A;  3NAE A;  2B1E A;  3J27 A;  4FJ8 A;  1NEX B;  4EPH A;  2YB5 A;  4DTP A;  4J2E A;  4FJL A;  3BVO A;  2OVR B;  2P1P B;  3NHG A;  2OYQ A;  4KI4 A;  4AI6 A;  3CFR A;  1WAJ A;  1XU3 E;  2P1M B;  1FZ3 E;  3SVI A;  4M3T A;  3RMC A;  2MMB A;  4GAM C;  3N1B A;  5IZ7 A;  2P1O B;  2H4T A;  1FZ0 E;  3S9H A;  4FJG A;  2JHC A;  3UO2 A;  3UIQ A;  1FPO A;  3N1E A;  4I6J B;  3L2O B;  3QNN A;  2DY4 A;  2E32 A;  2MW2 A;  3SQ1 A;  1XVE E;  4KHS A;  2DTU A;  4DTM A;  3SUP A;  4FK2 A;  3QEV A;  4DTR A;  4J2A A;  3TAF A;  2FYO A;  2MZW B;  3RWU A;  4M3R A;  4FJN A;  2K5S A;  1XMF E;  1FS1 A;  5H37 A;  4EYW A;  3TL8 B;  4DTJ A;  3QEP A;  2RCU A;  3QEX A;  3SQ2 A;  4KHN A;  4X5M A;  4QNC A;  4AKG A;  4AKH A;  2PFV A;  3V7D B;  3LZI A;  1IH7 A;  4EP9 A;  3SQ4 A;  4M42 A;  2B7M A;  2P1N B;  2VJ5 A;  3E4W A;  3CFP A;  2E31 A;  4KHQ A;  3TAE A;  2JPN A;  3L1N A;  1FZI E;  3QER A;  3LD8 A;  2DEB A;  4DTN A;  1MMO G;  2JQT A;  4ADN A;  4M3Z A;  4IT5 A;  1XL3 C;  4M41 A;  4DTU A;  4FJX A;  3L8B A;  4J2B A;  4FJK A;  4M3Y A;  4ADO A;  3SNN A;  2LF3 A;  2P5G A;  3SQ0 A;  3SUN A;  3QET A;  1FZ7 E;  1XU5 E;  3NDK A;  1N1C A;  4B08 A;  3QNO A;  3LZJ A;  2JH9 A;  4FJ9 A;  1FYZ E;  3RMA A;  4FK4 A;  4M3X A;  3HGL A;  3NGI A;  4RNG A;  3UO3 A;  4E4B A;  1XVB E;  4I9L A;  1Q9Y A;  3SI6 A;  4FJM A;  1FZ4 E;  4X5N A;  4QND A;  1MTY G;  1XMH E;  2OVQ B;  1CLQ A;  3HP9 A;  4ICG C;  4M3U A;  2ATQ A;  4DTO A;  4RL5 A;  4DTS A;  3NE6 A;  3SUQ A;  3SPY A;  1FZ2 E;  3E4Y A;  2OZM A;  3HGK E;  2JHA A;  2OVP B;  3QEI A;  2JH8 A;  3HL8 A;  4RG8 A;  3OGL B;  3C95 A;  1FZ9 E;  1FZ6 E;  3TAB A;  2LF6 A;  2VIX A;  4JRQ A;  4E3S A;  4FK0 A;  2QXF A;  3SJJ A;  2VJ4 A;  1LDK E;  1XVG E;  4FJ7 A;  3NCI A;  1MHZ G;  3SCX A;  3C94 A;  4I9Q A;  4FJI A;  2HD0 A;  3K2O A;  1FZ5 E;  3J2P A;  4KHU A;  3C6O B;  3WSO A;  4JS4 A;  2JHP A;  4DU1 A;  3RMB A;  3SUO A;  4KI6 A;  2OZS A;  4HCB A;  1WAF A;  1P22 A;  5IRE A;  4DTX A;  2P5O A;  4DU4 A;  2RKH A;  1XVF E;  1XVD E;  1FZ8 E;  4DU3 A;  1IG9 A;  1FZH E;  2P1Q B;  3QES A;  4FJ5 A;  3C6N B;  1FXX A; 
#chains in the Genus database with same CATH homology
 3C6P B;  3LDB A;  1FZ1 E;  1MHY G;  3RMD A;  3SPZ A;  4KHW A;  3CQ8 A;  4FJJ A;  2PFT A;  1XVC E;  4M45 A;  4JRP A;  4J2D A;  3L0M A;  4FJH A;  1Q9X A;  5IBK B;  3CFO A;  3MKS B;  3TAG A;  3KD5 E;  2B8I A;  4JS5 A;  3KD1 E;  4KHY A;  4AKI A;  1XMG E;  3OGM B;  2FW3 A;  3LDS A;  3OGK B;  4HCC A;  3QEW A;  4M3W A;  4FVM A;  3TJY A;  3NAE A;  2B1E A;  3J27 A;  4FJ8 A;  1NEX B;  4EPH A;  2YB5 A;  4DTP A;  4J2E A;  4FJL A;  2OVR B;  2P1P B;  3NHG A;  2OYQ A;  4KI4 A;  4AI6 A;  3CFR A;  1WAJ A;  1XU3 E;  2P1M B;  1FZ3 E;  3SVI A;  4M3T A;  3RMC A;  2MMB A;  4GAM C;  3N1B A;  5IZ7 A;  2P1O B;  2H4T A;  1FZ0 E;  3S9H A;  4FJG A;  2JHC A;  3UIQ A;  3N1E A;  4I6J B;  3L2O B;  3QNN A;  2DY4 A;  2E32 A;  3SQ1 A;  1XVE E;  4KHS A;  2DTU A;  4DTM A;  3SUP A;  4FK2 A;  3QEV A;  4DTR A;  4J2A A;  3TAF A;  2FYO A;  2MZW B;  3RWU A;  4M3R A;  4FJN A;  1XMF E;  1FS1 A;  5H37 A;  4EYW A;  3TL8 B;  4DTJ A;  3QEP A;  2RCU A;  3QEX A;  3SQ2 A;  4KHN A;  4X5M A;  4QNC A;  4AKG A;  4AKH A;  2PFV A;  3V7D B;  3LZI A;  1IH7 A;  4EP9 A;  3SQ4 A;  4M42 A;  2B7M A;  2P1N B;  2VJ5 A;  3E4W A;  3CFP A;  2E31 A;  4KHQ A;  3TAE A;  2JPN A;  3L1N A;  1FZI E;  3QER A;  3LD8 A;  2DEB A;  4DTN A;  1MMO G;  4ADN A;  4M3Z A;  1XL3 C;  4M41 A;  4DTU A;  4FJX A;  3L8B A;  4J2B A;  4FJK A;  4M3Y A;  4ADO A;  3SNN A;  2LF3 A;  2P5G A;  3SQ0 A;  3SUN A;  3QET A;  1FZ7 E;  1XU5 E;  3NDK A;  4B08 A;  3QNO A;  3LZJ A;  2JH9 A;  4FJ9 A;  1FYZ E;  3RMA A;  4FK4 A;  4M3X A;  3HGL A;  3NGI A;  4RNG A;  4E4B A;  1XVB E;  4I9L A;  1Q9Y A;  3SI6 A;  4FJM A;  1FZ4 E;  4X5N A;  4QND A;  1MTY G;  1XMH E;  2OVQ B;  1CLQ A;  3HP9 A;  4M3U A;  2ATQ A;  4DTO A;  4RL5 A;  4DTS A;  3NE6 A;  3SUQ A;  3SPY A;  1FZ2 E;  3E4Y A;  2OZM A;  3HGK E;  2JHA A;  2OVP B;  3QEI A;  2JH8 A;  3HL8 A;  4RG8 A;  3OGL B;  3C95 A;  1FZ9 E;  1FZ6 E;  3TAB A;  2LF6 A;  2VIX A;  4JRQ A;  4E3S A;  4FK0 A;  2QXF A;  3SJJ A;  2VJ4 A;  1LDK E;  1XVG E;  4FJ7 A;  3NCI A;  1MHZ G;  3SCX A;  3C94 A;  4I9Q A;  4FJI A;  2HD0 A;  3K2O A;  1FZ5 E;  3J2P A;  4KHU A;  3C6O B;  3WSO A;  4JS4 A;  2JHP A;  4DU1 A;  3RMB A;  3SUO A;  4KI6 A;  2OZS A;  4HCB A;  1WAF A;  1P22 A;  5IRE A;  4DTX A;  2P5O A;  4DU4 A;  1XVF E;  1XVD E;  1FZ8 E;  4DU3 A;  1IG9 A;  1FZH E;  2P1Q B;  3QES A;  4FJ5 A;  3C6N B;  1FXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...