3N1EA

Vps54 c-terminal domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
DQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein sorting-associated protein 54
publication title Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 56
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.130 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3n1eA02
3N1BA 3N1EA
chains in the Genus database with same CATH superfamily
4AKHA 3L2OB 3S9HA 4FK0A 3C6NB 3L1NA 3QERA 2E32A 2JH9A 3OGMB 4DTSA 4IT5A 4QNCA 4RG8A 3RMCA 3CQ8A 3SVIA 2RCUA 3QNOA 2PFTA 3K2OA 3J27A 2OVPB 1JW2A 1XL3C 4J2DA 2JHCA 3HGKE 1FZ1E 3LZIA 4DTMA 4FJ5A 4JS4A 4DU3A 5IREA 1MHYG 2OZMA 2FW3A 3HGLA 4J2AA 4DTOA 3SI6A 1FZ4E 4M3RA 4J2BA 2LF3A 2H4TA 3QEVA 3TAEA 1Q9YA 3HL8A 4J2EA 4M45A 2QXFA 3CFOA 3LD8A 3RWUA 3SQ0A 4DTNA 3SJJA 1FZ5E 4ADNA 4AKGA 2LF6A 2B7MA 3NHGA 4FVMA 1FZ7E 2RKHA 3E4YA 2OZSA 4FJMA 4B08A 2DY4A 3E4WA 3C94A 1FZ9E 3LDBA 4FK4A 2JHPA 4I9LA 4EP9A 4JRQA 4DTPA 4FJ7A 3SQ4A 2MMBA 4FJ8A 5IBKB 2B8IA 4X5MA 4KHSA 4DTXA 2OYQA 3BVOA 1XVBE 4X5NA 5H37A 3TJYA 4FJXA 3NE6A 2P1NB 3C6PB 4KHWA 1FZIE 2MW2A 1N1CA 3WSOA 3QESA 1XVCE 3C95A 4DTUA 3QEXA 1FXXA 4FJKA 1FZ8E 4RNGA 1NEXB 4KHQA 3RMAA 1WAFA 4GAMC 2P5OA 3J2PA 2E31A 3NDKA 4I6JB 2ATQA 4EYWA 2DEBA 3NGIA 3NAEA 3TABA 1FPOA 3KD1E 4KI6A 4M3YA 5IZ7A 4M3UA 3SNNA 3SUPA 4M42A 3QETA 4FJLA 3C6OB 3L0MA 2DTUA 2K5SA 4AKIA 3LDSA 3LZJA 4AI6A 1XMGE 2VIXA 1XMHE 3KD5E 1CLQA 2VJ4A 1XU5E 2PFVA 3QEWA 2JH8A 3SQ2A 3SPYA 1IH7A 4QNDA 1FYZE 3UIQA 1P22A 1FZ3E 1WAJA 3UO2A 3SUQA 4KI4A 4FJIA 1XMFE 3L8BA 2HD0A 2YB5A 3TAGA 4I9QA 4M41A 2P1MB 4E4BA 3SUOA 2JPNA 4M3WA 4HCCA 4M3XA 4KHYA 3SQ1A 2OVRB 3N1EA 1FZ0E 3NCIA 1XVFE 3OGKB 3QEIA 3TAFA 1MHZG 1FS1A 2P1QB 4KHUA 3RMDA 3TL8B 2JHAA 4E3SA 4FJNA 2FYOA 4FJHA 1Q9XA 3QEPA 3HP9A 4FJ9A 4JRPA 1MTYG 2OVQB 2P5GA 3RMBA 2VJ5A 3V7DB 4DTRA 2P1PB 4FJJA 4M3TA 1XVEE 3SUNA 1MMOG 1XVGE 3CFPA 3OGLB 4DU1A 3QNNA 1FZ6E 2MZWB 1FZHE 3N1BA 4ICGC 4RL5A 4ADOA 4FK2A 3SCXA 1FZ2E 3UO3A 4FJGA 3SPZA 2JQTA 1LDKE 1IG9A 3CFRA 4M3ZA 1XVDE 3MKSB 4DU4A 4EPHA 4JS5A 2B1EA 1XU3E 4HCBA 4KHNA 2P1OB 4DTJA
chains in the Genus database with same CATH topology
4AKHA 3L2OB 3S9HA 4FK0A 3C6NB 3L1NA 3QERA 2E32A 2JH9A 3OGMB 4DTSA 4QNCA 4RG8A 3RMCA 3CQ8A 3SVIA 2RCUA 3QNOA 2PFTA 3K2OA 3J27A 2OVPB 1XL3C 4J2DA 2JHCA 3HGKE 1FZ1E 3LZIA 4DTMA 4FJ5A 4JS4A 4DU3A 5IREA 1MHYG 2OZMA 2FW3A 3HGLA 4J2AA 4DTOA 3SI6A 1FZ4E 4M3RA 4J2BA 2LF3A 2H4TA 3QEVA 3TAEA 1Q9YA 3HL8A 4J2EA 4M45A 2QXFA 3CFOA 3LD8A 3RWUA 3SQ0A 4DTNA 3SJJA 1FZ5E 4ADNA 4AKGA 2LF6A 2B7MA 3NHGA 4FVMA 1FZ7E 3E4YA 2OZSA 4FJMA 4B08A 2DY4A 3E4WA 3C94A 1FZ9E 3LDBA 4FK4A 2JHPA 4I9LA 4EP9A 4JRQA 4DTPA 4FJ7A 3SQ4A 2MMBA 4FJ8A 5IBKB 2B8IA 4X5MA 4KHSA 4DTXA 2OYQA 1XVBE 4X5NA 5H37A 3TJYA 4FJXA 3NE6A 2P1NB 3C6PB 4KHWA 1FZIE 3WSOA 3QESA 1XVCE 3C95A 4DTUA 3QEXA 1FXXA 4FJKA 1FZ8E 4RNGA 1NEXB 4KHQA 3RMAA 1WAFA 4GAMC 2P5OA 3J2PA 2E31A 3NDKA 4I6JB 2ATQA 4EYWA 2DEBA 3NGIA 3NAEA 3TABA 3KD1E 4KI6A 4M3YA 5IZ7A 4M3UA 3SNNA 3SUPA 4M42A 3QETA 4FJLA 3C6OB 3L0MA 2DTUA 4AKIA 4AI6A 3LDSA 3LZJA 1XMGE 2VIXA 1XMHE 3KD5E 1CLQA 2VJ4A 1XU5E 2PFVA 3QEWA 2JH8A 3SQ2A 3SPYA 1IH7A 4QNDA 1FYZE 3UIQA 1P22A 1FZ3E 1WAJA 3SUQA 4KI4A 4FJIA 1XMFE 3L8BA 2HD0A 2YB5A 3TAGA 4I9QA 4M41A 2P1MB 4E4BA 3SUOA 2JPNA 4M3WA 4HCCA 4M3XA 4KHYA 3SQ1A 2OVRB 3N1EA 1FZ0E 3NCIA 1XVFE 3OGKB 3QEIA 3TAFA 1MHZG 1FS1A 2P1QB 4KHUA 3RMDA 3TL8B 2JHAA 4E3SA 4FJNA 2FYOA 4FJHA 1Q9XA 3QEPA 3HP9A 4FJ9A 4JRPA 1MTYG 2OVQB 2P5GA 3RMBA 2VJ5A 3V7DB 4DTRA 2P1PB 4FJJA 4M3TA 1XVEE 3SUNA 1MMOG 1XVGE 3CFPA 3OGLB 4DU1A 3QNNA 1FZ6E 2MZWB 1FZHE 3N1BA 4RL5A 4ADOA 4FK2A 3SCXA 1FZ2E 4FJGA 3SPZA 1LDKE 1IG9A 3CFRA 4M3ZA 1XVDE 3MKSB 4DU4A 4EPHA 4JS5A 2B1EA 1XU3E 4HCBA 4KHNA 2P1OB 4DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1B A;  3N1E A; 
#chains in the Genus database with same CATH topology
 4AKH A;  3L2O B;  3S9H A;  4FK0 A;  3C6N B;  3L1N A;  3QER A;  2E32 A;  2JH9 A;  3OGM B;  4DTS A;  4IT5 A;  4QNC A;  4RG8 A;  3RMC A;  3CQ8 A;  3SVI A;  2RCU A;  3QNO A;  2PFT A;  3K2O A;  3J27 A;  2OVP B;  1JW2 A;  1XL3 C;  4J2D A;  2JHC A;  3HGK E;  1FZ1 E;  3LZI A;  4DTM A;  4FJ5 A;  4JS4 A;  4DU3 A;  5IRE A;  1MHY G;  2OZM A;  2FW3 A;  3HGL A;  4J2A A;  4DTO A;  3SI6 A;  1FZ4 E;  4M3R A;  4J2B A;  2LF3 A;  2H4T A;  3QEV A;  3TAE A;  1Q9Y A;  3HL8 A;  4J2E A;  4M45 A;  2QXF A;  3CFO A;  3LD8 A;  3RWU A;  3SQ0 A;  4DTN A;  3SJJ A;  1FZ5 E;  4ADN A;  4AKG A;  2LF6 A;  2B7M A;  3NHG A;  4FVM A;  1FZ7 E;  2RKH A;  3E4Y A;  2OZS A;  4FJM A;  4B08 A;  2DY4 A;  3E4W A;  3C94 A;  1FZ9 E;  3LDB A;  4FK4 A;  2JHP A;  4I9L A;  4EP9 A;  4JRQ A;  4DTP A;  4FJ7 A;  3SQ4 A;  2MMB A;  4FJ8 A;  5IBK B;  2B8I A;  4X5M A;  4KHS A;  4DTX A;  2OYQ A;  3BVO A;  1XVB E;  4X5N A;  5H37 A;  3TJY A;  4FJX A;  3NE6 A;  2P1N B;  3C6P B;  4KHW A;  1FZI E;  2MW2 A;  1N1C A;  3WSO A;  3QES A;  1XVC E;  3C95 A;  4DTU A;  3QEX A;  1FXX A;  4FJK A;  1FZ8 E;  4RNG A;  1NEX B;  4KHQ A;  3RMA A;  1WAF A;  4GAM C;  2P5O A;  3J2P A;  2E31 A;  3NDK A;  4I6J B;  2ATQ A;  4EYW A;  2DEB A;  3NGI A;  3NAE A;  3TAB A;  1FPO A;  3KD1 E;  4KI6 A;  4M3Y A;  5IZ7 A;  4M3U A;  3SNN A;  3SUP A;  4M42 A;  3QET A;  4FJL A;  3C6O B;  3L0M A;  2DTU A;  2K5S A;  4AKI A;  3LDS A;  3LZJ A;  4AI6 A;  1XMG E;  2VIX A;  1XMH E;  3KD5 E;  1CLQ A;  2VJ4 A;  1XU5 E;  2PFV A;  3QEW A;  2JH8 A;  3SQ2 A;  3SPY A;  1IH7 A;  4QND A;  1FYZ E;  3UIQ A;  1P22 A;  1FZ3 E;  1WAJ A;  3UO2 A;  3SUQ A;  4KI4 A;  4FJI A;  1XMF E;  3L8B A;  2HD0 A;  2YB5 A;  3TAG A;  4I9Q A;  4M41 A;  2P1M B;  4E4B A;  3SUO A;  2JPN A;  4M3W A;  4HCC A;  4M3X A;  4KHY A;  3SQ1 A;  2OVR B;  3N1E A;  1FZ0 E;  3NCI A;  1XVF E;  3OGK B;  3QEI A;  3TAF A;  1MHZ G;  1FS1 A;  2P1Q B;  4KHU A;  3RMD A;  3TL8 B;  2JHA A;  4E3S A;  4FJN A;  2FYO A;  4FJH A;  1Q9X A;  3QEP A;  3HP9 A;  4FJ9 A;  4JRP A;  1MTY G;  2OVQ B;  2P5G A;  3RMB A;  2VJ5 A;  3V7D B;  4DTR A;  2P1P B;  4FJJ A;  4M3T A;  1XVE E;  3SUN A;  1MMO G;  1XVG E;  3CFP A;  3OGL B;  4DU1 A;  3QNN A;  1FZ6 E;  2MZW B;  1FZH E;  3N1B A;  4ICG C;  4RL5 A;  4ADO A;  4FK2 A;  3SCX A;  1FZ2 E;  3UO3 A;  4FJG A;  3SPZ A;  2JQT A;  1LDK E;  1IG9 A;  3CFR A;  4M3Z A;  1XVD E;  3MKS B;  4DU4 A;  4EPH A;  4JS5 A;  2B1E A;  1XU3 E;  4HCB A;  4KHN A;  2P1O B;  4DTJ A; 
#chains in the Genus database with same CATH homology
 4AKH A;  3L2O B;  3S9H A;  4FK0 A;  3C6N B;  3L1N A;  3QER A;  2E32 A;  2JH9 A;  3OGM B;  4DTS A;  4QNC A;  4RG8 A;  3RMC A;  3CQ8 A;  3SVI A;  2RCU A;  3QNO A;  2PFT A;  3K2O A;  3J27 A;  2OVP B;  1XL3 C;  4J2D A;  2JHC A;  3HGK E;  1FZ1 E;  3LZI A;  4DTM A;  4FJ5 A;  4JS4 A;  4DU3 A;  5IRE A;  1MHY G;  2OZM A;  2FW3 A;  3HGL A;  4J2A A;  4DTO A;  3SI6 A;  1FZ4 E;  4M3R A;  4J2B A;  2LF3 A;  2H4T A;  3QEV A;  3TAE A;  1Q9Y A;  3HL8 A;  4J2E A;  4M45 A;  2QXF A;  3CFO A;  3LD8 A;  3RWU A;  3SQ0 A;  4DTN A;  3SJJ A;  1FZ5 E;  4ADN A;  4AKG A;  2LF6 A;  2B7M A;  3NHG A;  4FVM A;  1FZ7 E;  3E4Y A;  2OZS A;  4FJM A;  4B08 A;  2DY4 A;  3E4W A;  3C94 A;  1FZ9 E;  3LDB A;  4FK4 A;  2JHP A;  4I9L A;  4EP9 A;  4JRQ A;  4DTP A;  4FJ7 A;  3SQ4 A;  2MMB A;  4FJ8 A;  5IBK B;  2B8I A;  4X5M A;  4KHS A;  4DTX A;  2OYQ A;  1XVB E;  4X5N A;  5H37 A;  3TJY A;  4FJX A;  3NE6 A;  2P1N B;  3C6P B;  4KHW A;  1FZI E;  3WSO A;  3QES A;  1XVC E;  3C95 A;  4DTU A;  3QEX A;  1FXX A;  4FJK A;  1FZ8 E;  4RNG A;  1NEX B;  4KHQ A;  3RMA A;  1WAF A;  4GAM C;  2P5O A;  3J2P A;  2E31 A;  3NDK A;  4I6J B;  2ATQ A;  4EYW A;  2DEB A;  3NGI A;  3NAE A;  3TAB A;  3KD1 E;  4KI6 A;  4M3Y A;  5IZ7 A;  4M3U A;  3SNN A;  3SUP A;  4M42 A;  3QET A;  4FJL A;  3C6O B;  3L0M A;  2DTU A;  4AKI A;  4AI6 A;  3LDS A;  3LZJ A;  1XMG E;  2VIX A;  1XMH E;  3KD5 E;  1CLQ A;  2VJ4 A;  1XU5 E;  2PFV A;  3QEW A;  2JH8 A;  3SQ2 A;  3SPY A;  1IH7 A;  4QND A;  1FYZ E;  3UIQ A;  1P22 A;  1FZ3 E;  1WAJ A;  3SUQ A;  4KI4 A;  4FJI A;  1XMF E;  3L8B A;  2HD0 A;  2YB5 A;  3TAG A;  4I9Q A;  4M41 A;  2P1M B;  4E4B A;  3SUO A;  2JPN A;  4M3W A;  4HCC A;  4M3X A;  4KHY A;  3SQ1 A;  2OVR B;  3N1E A;  1FZ0 E;  3NCI A;  1XVF E;  3OGK B;  3QEI A;  3TAF A;  1MHZ G;  1FS1 A;  2P1Q B;  4KHU A;  3RMD A;  3TL8 B;  2JHA A;  4E3S A;  4FJN A;  2FYO A;  4FJH A;  1Q9X A;  3QEP A;  3HP9 A;  4FJ9 A;  4JRP A;  1MTY G;  2OVQ B;  2P5G A;  3RMB A;  2VJ5 A;  3V7D B;  4DTR A;  2P1P B;  4FJJ A;  4M3T A;  1XVE E;  3SUN A;  1MMO G;  1XVG E;  3CFP A;  3OGL B;  4DU1 A;  3QNN A;  1FZ6 E;  2MZW B;  1FZH E;  3N1B A;  4RL5 A;  4ADO A;  4FK2 A;  3SCX A;  1FZ2 E;  4FJG A;  3SPZ A;  1LDK E;  1IG9 A;  3CFR A;  4M3Z A;  1XVD E;  3MKS B;  4DU4 A;  4EPH A;  4JS5 A;  2B1E A;  1XU3 E;  4HCB A;  4KHN A;  2P1O B;  4DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...