3N1EA

Vps54 c-terminal domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
140
structure length
140
Chain Sequence
DQWSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSPCFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Vacuolar protein sorting-associated protein 54
publication title Structural basis for the wobbler mouse neurodegenerative disorder caused by mutation in the Vps54 subunit of the GARP complex.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.130 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3n1eA02
3N1EA 3N1BA
chains in the Genus database with same CATH superfamily
3SJJA 3LDSA 4J2DA 3SUOA 3NAEA 1MHZG 3C95A 3QEVA 4JS5A 1FZHE 3SUNA 3C94A 3TAGA 2DEBA 1FS1A 4JRQA 3CQ8A 3L0MA 4KHSA 2JH9A 1P22A 5IREA 1FPOA 2OVRB 3SCXA 4FJ5A 2OVPB 2DTUA 1WAFA 3K2OA 3SI6A 2P5OA 4AKIA 1FZ4E 4I6JB 2OVQB 2HD0A 1IG9A 3OGKB 1XVDE 2OZMA 4FJHA 4FJKA 1FYZE 2DY4A 2OZSA 3SVIA 4RG8A 4HCCA 4DTSA 4RNGA 3RWUA 3OGMB 3SPZA 3SQ4A 3BVOA 3RMCA 3QEPA 4DU1A 1XMGE 2ATQA 4DTXA 4ICGC 2P1OB 3QNNA 3KD1E 1FZ2E 3LDBA 5IBKB 3WSOA 2P5GA 2VJ5A 1XVCE 3QEIA 4FJLA 1FZ1E 1XU5E 3C6NB 4DTJA 4DTNA 1FZ9E 2YB5A 3J2PA 4DTRA 3SNNA 3QNOA 4DTUA 5H37A 4J2EA 4EPHA 4M42A 1MTYG 4IT5A 1FZ7E 3NE6A 4GAMC 3RMAA 3NDKA 4JS4A 2OYQA 2H4TA 1CLQA 1IH7A 2JPNA 3RMDA 3N1EA 2B1EA 4KHUA 2K5SA 1XMHE 3C6OB 1XU3E 4QNCA 4DTMA 1N1CA 4FJ8A 1XMFE 2MW2A 3UO2A 1JW2A 1NEXB 1FZ6E 3RMBA 4KHQA 2FW3A 3TL8B 2FYOA 2LF3A 4AI6A 3TAEA 4X5MA 2JHPA 4FVMA 3E4YA 4DTOA 3SQ1A 4J2AA 4KHNA 3E4WA 4HCBA 1FZ8E 2B8IA 3L2OB 1MMOG 4M3WA 3CFPA 3HL8A 3KD5E 4KHWA 2E32A 2P1MB 3HGKE 2PFTA 3CFRA 3SQ2A 4FJNA 4M3YA 1FZIE 4M41A 2JH8A 4KI6A 3LZIA 3S9HA 4FJMA 2VJ4A 4FK0A 4DU3A 1XVGE 4AKGA 4M3ZA 2P1QB 2P1PB 4DU4A 4FJGA 1Q9XA 3UO3A 3QERA 1FZ3E 4FJXA 2MZWB 4KI4A 3L1NA 3HP9A 4ADNA 1XVBE 1WAJA 2QXFA 2E31A 5IZ7A 4FK2A 3TAFA 3QEWA 2P1NB 4RL5A 3QESA 4B08A 2RKHA 4QNDA 4FJJA 3LD8A 2MMBA 3LZJA 1FXXA 4I9QA 2PFVA 2VIXA 3TABA 4E3SA 4I9LA 4M3UA 2JQTA 1XVFE 3C6PB 3HGLA 3SUQA 4FJ7A 2JHCA 3N1BA 4M3RA 4ADOA 3UIQA 4FJ9A 3NHGA 3NCIA 3SUPA 3MKSB 1FZ5E 3V7DB 2LF6A 3QEXA 3SPYA 4M3TA 4FK4A 3OGLB 4E4BA 4X5NA 3L8BA 2JHAA 1FZ0E 4M45A 4M3XA 4KHYA 4AKHA 3SQ0A 3NGIA 1MHYG 3TJYA 4JRPA 2RCUA 1LDKE 3CFOA 4DTPA 3J27A 1XL3C 4J2BA 4FJIA 2B7MA 1Q9YA 4EYWA 1XVEE 4EP9A 3QETA
chains in the Genus database with same CATH topology
3SJJA 3LDSA 4J2DA 3SUOA 3NAEA 1MHZG 3C95A 3QEVA 4JS5A 1FZHE 3SUNA 3C94A 3TAGA 2DEBA 1FS1A 4JRQA 3CQ8A 3L0MA 4KHSA 2JH9A 1P22A 5IREA 2OVRB 3SCXA 4FJ5A 2OVPB 2DTUA 1WAFA 3K2OA 3SI6A 2P5OA 4AKIA 1FZ4E 4I6JB 2OVQB 2HD0A 1IG9A 3OGKB 1XVDE 2OZMA 4FJHA 4FJKA 1FYZE 2DY4A 2OZSA 3SVIA 4RG8A 4HCCA 4DTSA 4RNGA 3RWUA 3OGMB 3SPZA 3SQ4A 3RMCA 3QEPA 4DU1A 1XMGE 2ATQA 4DTXA 2P1OB 3QNNA 3KD1E 1FZ2E 3LDBA 5IBKB 3WSOA 2P5GA 2VJ5A 1XVCE 3QEIA 4FJLA 1FZ1E 1XU5E 3C6NB 4DTJA 4DTNA 1FZ9E 2YB5A 3J2PA 4DTRA 3SNNA 3QNOA 4DTUA 5H37A 4J2EA 4EPHA 4M42A 1MTYG 1FZ7E 3NE6A 4GAMC 3RMAA 3NDKA 4JS4A 2OYQA 2H4TA 1CLQA 1IH7A 2JPNA 3RMDA 3N1EA 2B1EA 4KHUA 3C6OB 1XMHE 1XU3E 4QNCA 4DTMA 4FJ8A 1XMFE 1NEXB 1FZ6E 3RMBA 4KHQA 2FW3A 3TL8B 2FYOA 2LF3A 4AI6A 3TAEA 4X5MA 2JHPA 4FVMA 3E4YA 4DTOA 3SQ1A 4J2AA 4KHNA 3E4WA 4HCBA 1FZ8E 2B8IA 3L2OB 1MMOG 4M3WA 3CFPA 3HL8A 3KD5E 4KHWA 2E32A 2P1MB 3HGKE 2PFTA 3CFRA 3SQ2A 4FJNA 4M3YA 1FZIE 4M41A 2JH8A 4KI6A 3LZIA 3S9HA 4FJMA 2VJ4A 4FK0A 4DU3A 1XVGE 4AKGA 4M3ZA 2P1QB 2P1PB 4DU4A 4FJGA 1Q9XA 4FJXA 3QERA 1FZ3E 2MZWB 4KI4A 3L1NA 3HP9A 4ADNA 1XVBE 1WAJA 2QXFA 2E31A 5IZ7A 4FK2A 3TAFA 3QEWA 2P1NB 4RL5A 3QESA 4B08A 4QNDA 4FJJA 3LD8A 2MMBA 3LZJA 1FXXA 4I9QA 2PFVA 2VIXA 3TABA 4E3SA 4I9LA 4M3UA 3C6PB 1XVFE 3HGLA 4FJ7A 3SUQA 2JHCA 3N1BA 4M3RA 4ADOA 3UIQA 4FJ9A 3NHGA 3NCIA 3SUPA 3MKSB 1FZ5E 3V7DB 2LF6A 3QEXA 3SPYA 4M3TA 4FK4A 3OGLB 4E4BA 4X5NA 3L8BA 2JHAA 1FZ0E 4M45A 4M3XA 4KHYA 4AKHA 3SQ0A 3NGIA 1MHYG 3TJYA 4JRPA 2RCUA 1LDKE 3CFOA 4DTPA 3J27A 1XL3C 4J2BA 4FJIA 2B7MA 1Q9YA 4EYWA 1XVEE 4EP9A 3QETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1E A;  3N1B A; 
#chains in the Genus database with same CATH topology
 3SJJ A;  3LDS A;  4J2D A;  3SUO A;  3NAE A;  1MHZ G;  3C95 A;  3QEV A;  4JS5 A;  1FZH E;  3SUN A;  3C94 A;  3TAG A;  2DEB A;  1FS1 A;  4JRQ A;  3CQ8 A;  3L0M A;  4KHS A;  2JH9 A;  1P22 A;  5IRE A;  1FPO A;  2OVR B;  3SCX A;  4FJ5 A;  2OVP B;  2DTU A;  1WAF A;  3K2O A;  3SI6 A;  2P5O A;  4AKI A;  1FZ4 E;  4I6J B;  2OVQ B;  2HD0 A;  1IG9 A;  3OGK B;  1XVD E;  2OZM A;  4FJH A;  4FJK A;  1FYZ E;  2DY4 A;  2OZS A;  3SVI A;  4RG8 A;  4HCC A;  4DTS A;  4RNG A;  3RWU A;  3OGM B;  3SPZ A;  3SQ4 A;  3BVO A;  3RMC A;  3QEP A;  4DU1 A;  1XMG E;  2ATQ A;  4DTX A;  4ICG C;  2P1O B;  3QNN A;  3KD1 E;  1FZ2 E;  3LDB A;  5IBK B;  3WSO A;  2P5G A;  2VJ5 A;  1XVC E;  3QEI A;  4FJL A;  1FZ1 E;  1XU5 E;  3C6N B;  4DTJ A;  4DTN A;  1FZ9 E;  2YB5 A;  3J2P A;  4DTR A;  3SNN A;  3QNO A;  4DTU A;  5H37 A;  4J2E A;  4EPH A;  4M42 A;  1MTY G;  4IT5 A;  1FZ7 E;  3NE6 A;  4GAM C;  3RMA A;  3NDK A;  4JS4 A;  2OYQ A;  2H4T A;  1CLQ A;  1IH7 A;  2JPN A;  3RMD A;  3N1E A;  2B1E A;  4KHU A;  2K5S A;  1XMH E;  3C6O B;  1XU3 E;  4QNC A;  4DTM A;  1N1C A;  4FJ8 A;  1XMF E;  2MW2 A;  3UO2 A;  1JW2 A;  1NEX B;  1FZ6 E;  3RMB A;  4KHQ A;  2FW3 A;  3TL8 B;  2FYO A;  2LF3 A;  4AI6 A;  3TAE A;  4X5M A;  2JHP A;  4FVM A;  3E4Y A;  4DTO A;  3SQ1 A;  4J2A A;  4KHN A;  3E4W A;  4HCB A;  1FZ8 E;  2B8I A;  3L2O B;  1MMO G;  4M3W A;  3CFP A;  3HL8 A;  3KD5 E;  4KHW A;  2E32 A;  2P1M B;  3HGK E;  2PFT A;  3CFR A;  3SQ2 A;  4FJN A;  4M3Y A;  1FZI E;  4M41 A;  2JH8 A;  4KI6 A;  3LZI A;  3S9H A;  4FJM A;  2VJ4 A;  4FK0 A;  4DU3 A;  1XVG E;  4AKG A;  4M3Z A;  2P1Q B;  2P1P B;  4DU4 A;  4FJG A;  1Q9X A;  3UO3 A;  3QER A;  1FZ3 E;  4FJX A;  2MZW B;  4KI4 A;  3L1N A;  3HP9 A;  4ADN A;  1XVB E;  1WAJ A;  2QXF A;  2E31 A;  5IZ7 A;  4FK2 A;  3TAF A;  3QEW A;  2P1N B;  4RL5 A;  3QES A;  4B08 A;  2RKH A;  4QND A;  4FJJ A;  3LD8 A;  2MMB A;  3LZJ A;  1FXX A;  4I9Q A;  2PFV A;  2VIX A;  3TAB A;  4E3S A;  4I9L A;  4M3U A;  2JQT A;  1XVF E;  3C6P B;  3HGL A;  3SUQ A;  4FJ7 A;  2JHC A;  3N1B A;  4M3R A;  4ADO A;  3UIQ A;  4FJ9 A;  3NHG A;  3NCI A;  3SUP A;  3MKS B;  1FZ5 E;  3V7D B;  2LF6 A;  3QEX A;  3SPY A;  4M3T A;  4FK4 A;  3OGL B;  4E4B A;  4X5N A;  3L8B A;  2JHA A;  1FZ0 E;  4M45 A;  4M3X A;  4KHY A;  4AKH A;  3SQ0 A;  3NGI A;  1MHY G;  3TJY A;  4JRP A;  2RCU A;  1LDK E;  3CFO A;  4DTP A;  3J27 A;  1XL3 C;  4J2B A;  4FJI A;  2B7M A;  1Q9Y A;  4EYW A;  1XVE E;  4EP9 A;  3QET A; 
#chains in the Genus database with same CATH homology
 3SJJ A;  3LDS A;  4J2D A;  3SUO A;  3NAE A;  1MHZ G;  3C95 A;  3QEV A;  4JS5 A;  1FZH E;  3SUN A;  3C94 A;  3TAG A;  2DEB A;  1FS1 A;  4JRQ A;  3CQ8 A;  3L0M A;  4KHS A;  2JH9 A;  1P22 A;  5IRE A;  2OVR B;  3SCX A;  4FJ5 A;  2OVP B;  2DTU A;  1WAF A;  3K2O A;  3SI6 A;  2P5O A;  4AKI A;  1FZ4 E;  4I6J B;  2OVQ B;  2HD0 A;  1IG9 A;  3OGK B;  1XVD E;  2OZM A;  4FJH A;  4FJK A;  1FYZ E;  2DY4 A;  2OZS A;  3SVI A;  4RG8 A;  4HCC A;  4DTS A;  4RNG A;  3RWU A;  3OGM B;  3SPZ A;  3SQ4 A;  3RMC A;  3QEP A;  4DU1 A;  1XMG E;  2ATQ A;  4DTX A;  2P1O B;  3QNN A;  3KD1 E;  1FZ2 E;  3LDB A;  5IBK B;  3WSO A;  2P5G A;  2VJ5 A;  1XVC E;  3QEI A;  4FJL A;  1FZ1 E;  1XU5 E;  3C6N B;  4DTJ A;  4DTN A;  1FZ9 E;  2YB5 A;  3J2P A;  4DTR A;  3SNN A;  3QNO A;  4DTU A;  5H37 A;  4J2E A;  4EPH A;  4M42 A;  1MTY G;  1FZ7 E;  3NE6 A;  4GAM C;  3RMA A;  3NDK A;  4JS4 A;  2OYQ A;  2H4T A;  1CLQ A;  1IH7 A;  2JPN A;  3RMD A;  3N1E A;  2B1E A;  4KHU A;  3C6O B;  1XMH E;  1XU3 E;  4QNC A;  4DTM A;  4FJ8 A;  1XMF E;  1NEX B;  1FZ6 E;  3RMB A;  4KHQ A;  2FW3 A;  3TL8 B;  2FYO A;  2LF3 A;  4AI6 A;  3TAE A;  4X5M A;  2JHP A;  4FVM A;  3E4Y A;  4DTO A;  3SQ1 A;  4J2A A;  4KHN A;  3E4W A;  4HCB A;  1FZ8 E;  2B8I A;  3L2O B;  1MMO G;  4M3W A;  3CFP A;  3HL8 A;  3KD5 E;  4KHW A;  2E32 A;  2P1M B;  3HGK E;  2PFT A;  3CFR A;  3SQ2 A;  4FJN A;  4M3Y A;  1FZI E;  4M41 A;  2JH8 A;  4KI6 A;  3LZI A;  3S9H A;  4FJM A;  2VJ4 A;  4FK0 A;  4DU3 A;  1XVG E;  4AKG A;  4M3Z A;  2P1Q B;  2P1P B;  4DU4 A;  4FJG A;  1Q9X A;  4FJX A;  3QER A;  1FZ3 E;  2MZW B;  4KI4 A;  3L1N A;  3HP9 A;  4ADN A;  1XVB E;  1WAJ A;  2QXF A;  2E31 A;  5IZ7 A;  4FK2 A;  3TAF A;  3QEW A;  2P1N B;  4RL5 A;  3QES A;  4B08 A;  4QND A;  4FJJ A;  3LD8 A;  2MMB A;  3LZJ A;  1FXX A;  4I9Q A;  2PFV A;  2VIX A;  3TAB A;  4E3S A;  4I9L A;  4M3U A;  3C6P B;  1XVF E;  3HGL A;  4FJ7 A;  3SUQ A;  2JHC A;  3N1B A;  4M3R A;  4ADO A;  3UIQ A;  4FJ9 A;  3NHG A;  3NCI A;  3SUP A;  3MKS B;  1FZ5 E;  3V7D B;  2LF6 A;  3QEX A;  3SPY A;  4M3T A;  4FK4 A;  3OGL B;  4E4B A;  4X5N A;  3L8B A;  2JHA A;  1FZ0 E;  4M45 A;  4M3X A;  4KHY A;  4AKH A;  3SQ0 A;  3NGI A;  1MHY G;  3TJY A;  4JRP A;  2RCU A;  1LDK E;  3CFO A;  4DTP A;  3J27 A;  1XL3 C;  4J2B A;  4FJI A;  2B7M A;  1Q9Y A;  4EYW A;  1XVE E;  4EP9 A;  3QET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...