2OVPB

Structure of the skp1-fbw7 complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
444
structure length
441
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 122
structure length 441
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovpB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovpB02
4PSWB 3DSMA 1JJUB 3OGLB 2J56H 4D6VA 2H13A 3IJCA 5I5JA 4AOWA 4L3HD 3WSOA 3I7LA 4YVDA 2P9KC 4J86A 5CYKB 3SHFA 4BUJC 3W15A 4GM9A 3MZKA 2B5MA 3EG6A 1PEVA 4GM3A 3OW8A 2OIZA 4I79A 5GXIA 5TEFA 4H5IA 1S4UX 3OKYA 2H47A 4PSXB 4Z8LA 2TRCB 2I0RA 2P9LC 4I6JB 5B4WA 4E5ZB 3I2NA 4CY2A 2P1MB 2Z2OA 2IUPA 2AGLA 4GGCA 4PBZA 5CXBA 4BL0A 2H14A 3VA6A 5KDOB 1RI6A 1N6DA 3UVLA 4U7AA 1YFQA 2H9PA 2AH1A 1LDKE 4ZOZA 3SFZA 4BH6A 4A0AA 1N6FA 2CE9A 2OK4A 5FA5B 5EMMB 2H9LA 5EM2B 2P9IC 3RLMD 1ERJA 3F3FA 4ZOXA 3SN6B 2CO0A 3I7HA 3BWSA 4A7JA 5H14A 3PSCB 3OL2B 3V9FA 3EI4B 3MKSB 2G99A 3DWLC 4E54A 4CY5A 3V7DB 5IGQA 3EI1B 5FKSA 2H3XA 2HKMA 3JB9L 3AL9A 1B9YA 3F3PA 2PBIB 2OK6A 3BG1A 5EMJB 2W18A 5AJAA 4TZ4A 4X3EA 5CXCB 3RSEC 2B4EA 2QC5A 5C2VB 4L3GD 2XL2A 3SWSD 3EI4A 3I7PA 4XYIA 4J77A 5IGOA 2H68A 3RRMC 3JZGA 2AGYA 3SBRA 4A08A 1SHYB 4J0WA 5CXCA 2H9MA 4JSXC 2IAAA 3SBQA 3OGKB 4J87A 1XHMA 3L2OB 4J0XA 3ZWLB 4CY3A 4FWWA 3MXXA 2YBAA 2CN2A 1SQ9A 2P9UC 2XL3A 3P4FA 4K3JB 5HE0B 3UKUC 4GQ2P 4O9DA 4J82A 3JZHA 3L4OD 1A0RB 1JOFA 3RFGA 3JROA 5IJ8E 4Y7RA 3GREA 2MTAH 2I3SA 5H1MA 4JXMA 4HDJA 5EMKB 1R5MA 1NEXB 2HYEA 2PM7B 2XYIA 4O1QD 4PBYA 2P1NB 4FAVD 2H6NA 3C99A 4ES0A 3UVKA 3KRXB 1B9XA 4JSVC 4IMMA 3VGZA 4ZN4A 3PVUB 2IWFA 3UR4A 1K8KC 3N0EA 4U1EI 1OMWB 5CYKA 3SVWD 4A11B 4JSNC 4JT5C 1N6EA 4GQBB 2CE8A 4QRJA 2CN3A 3K26A 3I89A 3EI2B 4CI2A 3HFQA 5AMSA 3AH8B 5FQDA 3IKOA 3OKWA 2GC7A 4A09B 4E5ZA 1GOTB 4PNKB 2E31A 3UKRC 5I5IA 1PBYB 4CI3A 5SXMA 2GC4A 4GMBA 4LGNA 3U4YA 2YNPA 5TDHB 4NSXA 5C2WB 3VH0A 3FGBA 1GP2B 4L1QD 4O45A 5H17A 4UI9R 5GXHA 3V5WB 3DM0A 4A09A 4X61B 3A0FA 1OLZA 3MMYA 4R7AB 3IIYA 2HESX 1SQJA 5EM2A 2IUQA 4IA9A 5EAPA 4LG8A 2AH0A 3RN1D 3EMHA 3C9CA 2YNNA 3AL8B 3J81g 1U4CA 2AGZA 2Z2NA 3CFVA 1TYQC 2Z2PA 3OL2A 3UVMA 4FAND 5IT9g 4KFMB 3PXSD 2UZXB 4O3TB 3EI1A 2P9NC 4AEZA 4Y5RD 2PM9B 2AQ5A 2H6KA 2HJ4A 4QT8A 4JT6C 3JZNA 5HQGA 4J8BA 5EARA 5K19A 2OJYA 3OGMB 4J78A 2AGWA 3EU7A 5A2Qg 4CZXA 3NVNA 2QXVA 3NVQA 4CZVA 3I7KA 5IC7A 2GNQA 5EAMA 3C5MA 3SJLD 5TEEA 3C6NB 1P22A 3C75H 4FHLA 3GFCA 2IUVA 1NR0A 2YMUA 2OVRB 4N14A 5TF2A 1JMZB 3OTTA 2IWKA 3I8EA 3SMRA 4A2MA 4GZ8A 2I0SA 2H6QA 3EI3B 2P1PB 2P1OB 3OKYB 3SBPA 3B7FA 3UVNA 2AGXA 3JRPA 4GM8A 1MDAH 1VYHC 3SLED 4GQ1A 5HYNB 4X60B 5GSAA 3PE7A 4J84A 1TBGA 4QL1A 5CXBB 4GGAA 4OWRA 3EI3A 2YB8B 4ERYA 4O3UB 4XYHA 4ZOVA 1GXRA 4K3ID 4CC9A 3JAMg 3ORVD 3UVOA 5THAA 3DXMC 2P9PC 3BG0A 3IIWA 3K27A 3PXWD 4L9OA 3AFCA 4A0AB 5IBKB 2YNOA 4PC0A 3C6OB 3RFHA 1PI6A 2BBKH 2EBSA 3I8CA 4X63B 4LG9A 4A11A 1PGUA 3SCYA 1QNIA 4CI1A 5FKQA 2HXCA 3JPXA 4CZYA 3I7OA 5K1CC 2P9SC 3DXKC 4D0KA 4XEIC 3EI2A 5EALA 2B5LA 3J80g 4E54B 2OVQB 3FM0A 4EWRA 4FA1D 2CNXA 3ODTA 2HJBA 3I7NA 3PSLA 4ERQA 4J79A 1U2VC 1GG2B 3C6PB 4GGDA 5EMLB 4FA9D 4A0BB 3CFSB 1MG2A 2PM6B 3CIKB 4JD2C 3SXTD 2I3TA 2XU7A 2J55H 3RMZD 1XIPA 3E0CA 3RN0D 2IURA 3N0DA 4OZUA 3PVWB 4A08B 4CY1A 5IJ7E 2I0TA 3IJ0A 5HE3B 3MZLA 4PXWA 4CI8A 2J57G 5C9ZB 4JSPC 1XKSA 4ERZA 4A0BA 5I5MA 3ULEC 3AL8A 3MKQA 2O9KA 5FKTA 1FWXA 3F3GA 3OKTA 2G9AA 2CO0C 2OVPB 4J8GA 2BCJB 5FKRA 2E32A 1K32A 3IJ1A 2H9NA 5HE1B 4FB1D 2Q7QA 4J73A 2B5NA 5GMKn 2PM9A 2HKRA 3FRXA 1Q47A 4MK0B 4QQEA 5HE2B 3KRWB 3PXTD 4J81A 1JMXB 4ZOYA 3NVXA 1L0QA 4FA5D 3L4MD 5AFU3 2P1QB 4ESGA 4H5JA 4G56B 4A2LA 4FA4D 5FLXg 2UZYB 3EWEA 5FXYA 1MG3A 1FS1A 5JWZA
chains in the Genus database with same CATH superfamily
1BPOA 4FJLA 4PSWB 3IVMA 3DSMA 1JJUB 3OGLB 4J2EA 4L1MA 2J56H 4D6VA 1QFSA 3OF7A 2H13A 3IJCA 5I5JA 4M41A 4AOWA 4L3HD 3WSOA 3CFRA 3I7LA 4YVDA 2P9KC 4J86A 5E6RA 5CYKB 4DTMA 3SHFA 4BUJC 1XVDE 3W15A 4GM9A 4WK4A 3MZKA 3SQ2A 1I2MB 2B5MA 3EG6A 1PEVA 4GM3A 3OW8A 1VZ3A 2OIZA 4FJMA 4I79A 5GXIA 5TEFA 3J27A 4H5IA 2HU5A 1S4UX 3OKYA 4JS4A 3KCIA 4FJHA 2H47A 4PSXB 4Z8LA 2TRCB 4DU3A 2VIXA 1H2XA 2I0RA 2P9LC 4DTOA 4I6JB 5B4WA 4E5ZB 3I2NA 4CY2A 2P1MB 2Z2OA 5M5RA 5FFGA 4M3WA 3J2PA 4JRPA 3O4JA 2IUPA 2DEBA 4D9SA 2AGLA 4GGCA 4NBMA 4DU4A 4PBZA 4DTXA 3O4IA 5CXBA 4FK4A 4DTJA 4MMXA 4DTRA 4BL0A 1JV2A 2H14A 3VA6A 2LF6A 3LD8A 3MUNA 5KDOB 1RI6A 1N6DA 3UVLA 4M3ZA 1XMHE 4U7AA 1YFQA 5M5UA 2H9PA 2AH1A 1LDKE 3EQ7A 4ZOZA 4J2AA 3SFZA 3VI3A 4BH6A 3IUNA 4A0AA 1N6FA 2CE9A 2ATQA 2OK4A 5FA5B 5EMMB 1XMFE 2B1EA 5FFOA 2H9LA 1IH7A 1XVEE 5EM2B 2P9IC 4J2DA 3RLMD 1ERJA 4BCBA 3F3FA 3QI0A 4ZOXA 4RNGA 3SN6B 4GAMC 2CO0A 4M45A 1FZ8E 3RMBA 3I7HA 4NAAA 3BWSA 4A7JA 5H14A 3IJEA 4AX4A 4M3RA 3PSCB 3ZE1A 4WK0A 3SUPA 3OL2B 3V9FA 3K6SA 1MTYG 3EI4B 3MKSB 2G99A 3DWLC 4E54A 4CY5A 2JHAA 2MMBA 3V7DB 5IGQA 3EI1B 5FKSA 3QETA 3HP9A 2H3XA 2HKMA 4B08A 1B9YA 3AL9A 3F3PA 4MMYA 4O02A 4AN1A 2PBIB 4WK2A 3ZDXA 2OK6A 4M3YA 3BG1A 2EIEA 4KHQA 2QXFA 2W18A 3SJJA 5AJAA 3IUJA 5EMJB 4TZ4A 4X3EA 5CXCB 3L0MA 3C94A 3RSEC 3IURA 3MUOA 2B4EA 2QC5A 2PFTA 3C95A 5C2VB 4JRQA 1XU3E 4L3GD 2XL2A 3SWSD 4JHNA 1FZHE 3K2OA 3EI4A 4DTUA 3I7PA 4XYIA 4J77A 5IGOA 3SI6A 2H68A 3RRMC 3JZGA 2AGYA 3LDSA 3SBRA 2DTUA 2MW2A 3CQ8A 4A08A 1SHYB 4J0WA 5CXCA 4AKHA 2H9MA 4JSXC 3UO3A 3TAEA 2IAAA 2LF3A 2QZPA 3SBQA 3OGKB 3L1NA 3SUNA 4J87A 1XHMA 3L2OB 4J0XA 3N1BA 3ZWLB 3SUOA 4CY3A 4DNWA 1XVFE 4FWWA 1WAFA 1E8MA 1YR2A 3MXXA 2YBAA 4HCBA 4KI6A 5M5TA 2CN2A 1XU5E 2VDMA 1SQ9A 2P9UC 2XL3A 3P4FA 4K3JB 5HE0B 3UKUC 4GQ2P 2VZ3A 4O9DA 4J82A 3JZHA 3L4OD 1MHZG 4FJJA 1A0RB 4FJ8A 1JOFA 3RFGA 3JROA 5IJ8E 1FZ5E 3SPYA 4Y7RA 4DTPA 3N1EA 2EICA 3GREA 2MTAH 4NENA 2P5GA 2I3SA 3HGKE 2XE4A 5H1MA 4JXMA 4HCCA 4HDJA 3QEXA 2P5OA 5EMKB 1R5MA 1NEXB 2OZMA 1GOGA 2HYEA 2PM7B 2XYIA 2H4TA 2VC2A 2VDNA 4DTNA 4O1QD 4PBYA 2XZGA 2P1NB 4FAVD 2H6NA 2YB5A 3SPZA 3C99A 1FPOA 4UM9A 1FZ1E 3UVKA 3KRXB 4ES0A 1B9XA 4JSVC 4IMMA 3VGZA 4ZN4A 4AKGA 3PVUB 2IWFA 3UR4A 3MVDK 1FXXA 1FZ7E 1E8NA 1K8KC 3N0EA 2JH9A 4U1EI 2VJ4A 1OMWB 5CYKA 3SVWD 1XVBE 4A11B 4JSNC 4UM8A 1U8CA 3L8BA 4JT5C 1N6EA 2QR5A 5IZ7A 2CE8A 4GQBB 4FJ9A 2CN3A 3K26A 4QRJA 3I89A 3EI2B 4CI2A 3NIFA 3HFQA 3KD5E 3ZE0A 5AMSA 3AH8B 5FQDA 2OZSA 3IKOA 3OKWA 2GC7A 1FZIE 4AN0A 4A09B 4E5ZA 1GOTB 4FJGA 4PNKB 4IT5A 1WAJA 4EYWA 2E31A 3DDUA 3UKRC 5I5IA 1VZ2A 5M5SA 1PBYB 3QEPA 1O6FA 4QAMA 2RCUA 3QEIA 4CI3A 1UOPA 3SVIA 3QNNA 3KD1E 5SXMA 2JH8A 4G55A 2GC4A 4GMBA 4JHPC 1N1CA 4LGNA 3U4YA 3SQ4A 2YNPA 5TDHB 4NSXA 5C2WB 3VH0A 1FYZE 4O2WA 3SNNA 3GD1I 2MZWB 3FGBA 3CFPA 4FK0A 1GP2B 4L1QD 4O45A 3NCIA 5H17A 2JKXA 4M42A 4UI9R 3ZE2A 5GXHA 3V5WB 3DM0A 4A09A 4X61B 3A0FA 1OLZA 4FJNA 4KHSA 3MMYA 4R7AB 3IIYA 2HU8A 3LDBA 2HESX 4M3XA 1SQJA 5EM2A 3TJYA 2IUQA 4IA9A 1MMOG 3SQ1A 5EAPA 2VDLA 4FK2A 4LG8A 2AH0A 3RN1D 3NHGA 3NAEA 3SUQA 3EMHA 3C9CA 4BCCA 2YNNA 3T3MA 3AL8B 3ZDYA 4Z7QA 3J81g 1U4CA 2AGZA 2Z2NA 3CFVA 1TYQC 1GOHA 2Z2PA 3OL2A 3UVMA 4FAND 5IT9g 4KFMB 3UO2A 3HGLA 3PXSD 2UZXB 4O3TB 4RE6A 3IUQA 3EI1A 3NDKA 2P9NC 1E5TA 4AEZA 4Y5RD 3S9HA 2PM9B 2AQ5A 3SCXA 1T2XA 2H6KA 4X5NA 2HJ4A 4JT6C 3JZNA 4QT8A 5HQGA 3K71A 2XDWA 4J8BA 1C9IA 5EARA 1JTDB 3RMDA 5K19A 4BP8A 2OJYA 4FJXA 1VE6A 2HD0A 3OGMB 4G1EA 2AGWA 2WQ8A 3EU7A 3FCUA 4J78A 5IREA 4CZXA 5A2Qg 3NVNA 2QXVA 3NVQA 4CZVA 3I7KA 2VDOA 5IC7A 2GNQA 5EAMA 3C5MA 4I9LA 3SJLD 5TEEA 3C6NB 4J2BA 1P22A 4AMZA 3C75H 4KHUA 4RG8A 1UTCA 2VDKA 4FHLA 3LZJA 4FJIA 5E6SA 3GFCA 3NE6A 2IUVA 1IG9A 1C9LA 1NR0A 2YMUA 2OVRB 4RL5A 3TABA 4N14A 2HU7A 5TF2A 1JMZB 1Q9XA 3FCSA 4AKIA 3OTTA 2IWKA 2JPNA 3NIDA 2DY4A 3I8EA 3SMRA 5C86A 4A2MA 4KHNA 4GZ8A 4QNDA 2I0SA 4BP9A 1K3IA 2H6QA 3EI3B 2P1PB 4M3TA 2P1OB 1FZ4E 1CLQA 3OKYB 3SBPA 4X5MA 1FZ9E 1H2WA 3B7FA 3UVNA 2AGXA 4JS5A 3JRPA 4GM8A 1MDAH 1VYHC 3SLED 4GQ1A 5HYNB 4X60B 5GSAA 5H37A 4G1MA 3PE7A 4J84A 3EQ8A 4E3SA 1TBGA 4QL1A 4FJKA 1L5GA 5CXBB 4GGAA 3E4YA 3EI3A 2YB8B 4OWRA 4EPHA 4ERYA 4O3UB 4XYHA 1GOFA 4ZOVA 1GXRA 3QNOA 4K3ID 4CC9A 3TAGA 2VDPA 3V4PA 3JAMg 3ORVD 3UVOA 5THAA 3DXMC 2P9PC 3BG0A 3IIWA 3O4GA 3K27A 3RWUA 1UOOA 3PXWD 4L9OA 5M5VA 3AFCA 2FW3A 3LZIA 4A0AB 5IBKB 2EIBA 2YNOA 4PC0A 4FJ5A 3C6OB 1M1XA 3RFHA 3EQ9A 4QNCA 1PI6A 2BBKH 2EBSA 3NGIA 3SQ0A 4AI6A 3I8CA 4X63B 1FZ2E 1MHYG 4ADOA 4LG9A 4A11A 1PGUA 1XMGE 3SCYA 1QNIA 4CI1A 5FKQA 1UOQA 1FZ0E 2HXCA 3JPXA 4CZYA 3I7OA 5K1CC 2P9SC 3CFOA 2JQTA 3DXKC 4D0KA 3QHYB 4XEIC 3EI2A 1A12A 5EALA 4I9QA 2B5LA 3J80g 3JB9L 4E54B 2OVQB 3IULA 3FM0A 4EWRA 4FA1D 2CNXA 3ODTA 2VDRA 2HJBA 3I7NA 3TAFA 3PSLA 4ERQA 2EIDA 1O6GA 4J79A 3UIQA 1U2VC 1GG2B 3C6PB 4GGDA 5HDBA 5EMLB 4DU1A 3QEVA 4FA9D 1XL3C 2OYQA 3K72A 4E4BA 4A0BB 3CFSB 1MG2A 4DNUA 5E6UA 2PM6B 4KI4A 3TL8B 3CIKB 4JD2C 2BKLA 4ADNA 4IRZA 3SXTD 3VI4A 1FZ3E 2I3TA 4WJKA 2XU7A 2J55H 3RMZD 1XIPA 1VE7A 3E0CA 2RKHA 3RN0D 2IURA 3N0DA 4ICGC 3RMCA 4OZUA 3PVWB 4A08B 2VJ5A 3IUMA 3O4HA 3T3PA 4CY1A 5IJ7E 2I0TA 3IJ0A 1TYEA 3ZDZA 5HE3B 3MZLA 4PXWA 5C92A 2J57G 2FYOA 1H2ZA 4DTSA 2VDQA 5C9ZB 4CI8A 4JSPC 1XKSA 4ERZA 4A0BA 4Z7OA 2VZ1A 4Z7NA 3ULEC 1Q9YA 3AL8A 5I5MA 3MKQA 1QFMA 2O9KA 5FKTA 4KHWA 2B8IA 3QERA 1FWXA 3F3GA 3OKTA 2G9AA 5M61A 2PFVA 2CO0C 2OVPB 4J8GA 2BCJB 5FKRA 2K5SA 4AMYA 2E32A 1K32A 2JHPA 3IJ1A 2H9NA 1H2YA 5HE1B 4DNVA 2Q7QA 4J73A 4FB1D 1XVGE 3QEWA 1JW2A 2B5NA 5GMKn 2PM9A 2HKRA 3FRXA 1Q47A 3NIGA 4MK0B 3HL8A 4QQEA 5HE2B 3KRWB 3PXTD 4EP9A 4J81A 4NC4A 1JMXB 4ZOYA 3NVXA 3QESA 4M3UA 1L0QA 4KHYA 4FA5D 3L4MD 5AFU3 4MMZA 3BVOA 3GC3B 4RE5A 2P1QB 1FZ6E 3V4VA 1XVCE 4H5JA 4ESGA 4G56B 4A2LA 4FA4D 5FLXg 3RMAA 2B7MA 4FJ7A 4BCDA 2UZYB 3EWEA 5FXYA 2JHCA 4FVMA 1MG3A 1FS1A 5JWZA 3E4WA
chains in the Genus database with same CATH topology
4FJLA 4PSWB 3DSMA 1JJUB 3OGLB 4J2EA 2J56H 4D6VA 2H13A 3IJCA 5I5JA 4M41A 4AOWA 4L3HD 3WSOA 3CFRA 3I7LA 4YVDA 2P9KC 4J86A 5CYKB 4DTMA 3SHFA 4BUJC 1XVDE 3W15A 4GM9A 3MZKA 3SQ2A 2B5MA 3EG6A 1PEVA 4GM3A 3OW8A 2OIZA 4FJMA 4I79A 5GXIA 5TEFA 3J27A 4H5IA 1S4UX 3OKYA 4JS4A 4FJHA 2H47A 4PSXB 4Z8LA 2TRCB 4DU3A 2VIXA 2I0RA 2P9LC 4DTOA 4I6JB 5B4WA 4E5ZB 3I2NA 4CY2A 2P1MB 2Z2OA 4M3WA 3J2PA 4JRPA 2IUPA 2DEBA 2AGLA 4GGCA 4DU4A 4PBZA 4DTXA 5CXBA 4FK4A 4DTJA 4DTRA 4BL0A 2H14A 3VA6A 2LF6A 3LD8A 5KDOB 1RI6A 1N6DA 3UVLA 4M3ZA 1XMHE 4U7AA 1YFQA 2H9PA 2AH1A 1LDKE 4ZOZA 3SFZA 4J2AA 4BH6A 4A0AA 1N6FA 2CE9A 2ATQA 2OK4A 5FA5B 5EMMB 1XMFE 2B1EA 2H9LA 1IH7A 1XVEE 5EM2B 2P9IC 4J2DA 3RLMD 1ERJA 3F3FA 4ZOXA 4RNGA 3SN6B 4GAMC 2CO0A 4M45A 1FZ8E 3RMBA 3I7HA 3BWSA 4A7JA 5H14A 4M3RA 3PSCB 3SUPA 3OL2B 3V9FA 1MTYG 3EI4B 3MKSB 2G99A 3DWLC 4E54A 4CY5A 2JHAA 2MMBA 3V7DB 5IGQA 3EI1B 5FKSA 3QETA 3HP9A 2H3XA 2HKMA 4B08A 1B9YA 3AL9A 3F3PA 3JB9L 2PBIB 2OK6A 4M3YA 3BG1A 4KHQA 2QXFA 2W18A 3SJJA 5AJAA 5EMJB 4TZ4A 4X3EA 5CXCB 3L0MA 3C94A 3RSEC 2B4EA 2QC5A 2PFTA 3C95A 5C2VB 4JRQA 1XU3E 4L3GD 2XL2A 3SWSD 1FZHE 3K2OA 3EI4A 4DTUA 3I7PA 4XYIA 4J77A 5IGOA 3SI6A 2H68A 3RRMC 3JZGA 2AGYA 3LDSA 3SBRA 2DTUA 4A08A 3CQ8A 1SHYB 4J0WA 5CXCA 4AKHA 2H9MA 4JSXC 3TAEA 2IAAA 2LF3A 3SBQA 3OGKB 3L1NA 3SUNA 4J87A 1XHMA 3L2OB 4J0XA 3N1BA 3ZWLB 3SUOA 4CY3A 1XVFE 4FWWA 1WAFA 3MXXA 2YBAA 4HCBA 4KI6A 2CN2A 1XU5E 1SQ9A 2P9UC 2XL3A 3P4FA 4K3JB 5HE0B 3UKUC 4GQ2P 4O9DA 4J82A 3JZHA 3L4OD 1MHZG 4FJJA 1A0RB 4FJ8A 1JOFA 3RFGA 3JROA 5IJ8E 1FZ5E 3SPYA 4Y7RA 4DTPA 3N1EA 3GREA 2MTAH 2P5GA 2I3SA 3HGKE 5H1MA 4JXMA 4HCCA 4HDJA 3QEXA 2P5OA 5EMKB 1R5MA 1NEXB 2OZMA 2HYEA 2PM7B 2XYIA 2H4TA 4DTNA 4O1QD 4PBYA 2P1NB 4FAVD 2H6NA 2YB5A 3SPZA 3C99A 4ES0A 1FZ1E 3UVKA 3KRXB 1B9XA 4JSVC 4IMMA 3VGZA 4ZN4A 4AKGA 3PVUB 2IWFA 3UR4A 1FXXA 1FZ7E 1K8KC 3N0EA 2JH9A 4U1EI 2VJ4A 1OMWB 5CYKA 3SVWD 1XVBE 4A11B 4JSNC 3L8BA 4JT5C 1N6EA 5IZ7A 2CE8A 4GQBB 4FJ9A 2CN3A 3K26A 4QRJA 3I89A 3EI2B 4CI2A 3HFQA 3KD5E 5AMSA 3AH8B 5FQDA 2OZSA 3IKOA 3OKWA 2GC7A 1FZIE 4A09B 4E5ZA 1GOTB 4FJGA 4PNKB 1WAJA 4EYWA 2E31A 3UKRC 5I5IA 1PBYB 3QEPA 2RCUA 3QEIA 4CI3A 3SVIA 3QNNA 3KD1E 5SXMA 2JH8A 2GC4A 4GMBA 4LGNA 3U4YA 3SQ4A 2YNPA 5TDHB 4NSXA 5C2WB 3VH0A 1FYZE 3SNNA 2MZWB 3FGBA 3CFPA 4FK0A 1GP2B 4L1QD 4O45A 3NCIA 5H17A 4M42A 4UI9R 5GXHA 3V5WB 3DM0A 4A09A 4X61B 3A0FA 1OLZA 4FJNA 4KHSA 3MMYA 4R7AB 3IIYA 3LDBA 2HESX 4M3XA 1SQJA 5EM2A 3TJYA 2IUQA 4IA9A 1MMOG 3SQ1A 5EAPA 4FK2A 4LG8A 2AH0A 3RN1D 3NHGA 3NAEA 3SUQA 3EMHA 3C9CA 2YNNA 3AL8B 3J81g 1U4CA 2AGZA 2Z2NA 3CFVA 1TYQC 2Z2PA 3OL2A 3UVMA 4FAND 5IT9g 4KFMB 3HGLA 3PXSD 2UZXB 4O3TB 3EI1A 3NDKA 2P9NC 4AEZA 4Y5RD 3S9HA 2PM9B 2AQ5A 3SCXA 2H6KA 2HJ4A 4X5NA 4QT8A 4JT6C 3JZNA 5HQGA 4J8BA 5EARA 3RMDA 5K19A 2OJYA 4FJXA 2HD0A 3OGMB 4J78A 2AGWA 3EU7A 5A2Qg 5IREA 4CZXA 3NVNA 2QXVA 3NVQA 4CZVA 3I7KA 5IC7A 2GNQA 5EAMA 3C5MA 4I9LA 3SJLD 5TEEA 3C6NB 4J2BA 1P22A 3C75H 4KHUA 4RG8A 4FHLA 3LZJA 4FJIA 3GFCA 3NE6A 2IUVA 1IG9A 1NR0A 2YMUA 2OVRB 4RL5A 3TABA 4N14A 5TF2A 1JMZB 1Q9XA 4AKIA 3OTTA 2IWKA 2JPNA 2DY4A 3I8EA 3SMRA 4A2MA 4KHNA 4GZ8A 4QNDA 2I0SA 2H6QA 3EI3B 2P1PB 4M3TA 2P1OB 1FZ4E 1CLQA 3OKYB 3SBPA 4X5MA 1FZ9E 3B7FA 3UVNA 2AGXA 4JS5A 3JRPA 4GM8A 1MDAH 1VYHC 3SLED 4GQ1A 5HYNB 4X60B 5GSAA 5H37A 3PE7A 4J84A 4E3SA 1TBGA 4QL1A 4FJKA 5CXBB 4GGAA 3E4YA 3EI3A 2YB8B 4OWRA 4EPHA 4ERYA 4O3UB 4XYHA 4ZOVA 1GXRA 3QNOA 4K3ID 4CC9A 3TAGA 3JAMg 3ORVD 3UVOA 5THAA 3DXMC 2P9PC 3BG0A 3IIWA 3K27A 3RWUA 3PXWD 4L9OA 3AFCA 2FW3A 3LZIA 4A0AB 5IBKB 2YNOA 4PC0A 4FJ5A 3C6OB 3RFHA 4QNCA 1PI6A 2BBKH 2EBSA 3NGIA 3SQ0A 4AI6A 3I8CA 4X63B 1FZ2E 1MHYG 4ADOA 4LG9A 4A11A 1PGUA 1XMGE 3SCYA 1QNIA 4CI1A 5FKQA 1FZ0E 2HXCA 3JPXA 4CZYA 3I7OA 5K1CC 2P9SC 3CFOA 3DXKC 4D0KA 4XEIC 3EI2A 5EALA 4I9QA 2B5LA 3J80g 4E54B 2OVQB 3FM0A 4EWRA 4FA1D 2CNXA 3ODTA 2HJBA 3I7NA 3TAFA 3PSLA 4ERQA 4J79A 3UIQA 1U2VC 1GG2B 3C6PB 4GGDA 5EMLB 4DU1A 3QEVA 4FA9D 1XL3C 2OYQA 4E4BA 4A0BB 3CFSB 1MG2A 2PM6B 4KI4A 3TL8B 3CIKB 4JD2C 3SXTD 4ADNA 1FZ3E 2I3TA 2XU7A 2J55H 3RMZD 1XIPA 3E0CA 3RN0D 2IURA 3N0DA 4OZUA 3RMCA 3PVWB 4A08B 2VJ5A 4CY1A 5IJ7E 2I0TA 3IJ0A 5HE3B 3MZLA 4PXWA 4CI8A 2J57G 2FYOA 5C9ZB 4DTSA 4JSPC 1XKSA 4ERZA 4A0BA 5I5MA 3ULEC 1Q9YA 3AL8A 3MKQA 2O9KA 5FKTA 4KHWA 2B8IA 3QERA 1FWXA 3F3GA 3OKTA 2G9AA 2PFVA 2CO0C 2OVPB 4J8GA 2BCJB 5FKRA 2E32A 1K32A 2JHPA 3IJ1A 2H9NA 5HE1B 4FB1D 2Q7QA 4J73A 1XVGE 3QEWA 2B5NA 5GMKn 2PM9A 2HKRA 3FRXA 1Q47A 4MK0B 3HL8A 4QQEA 5HE2B 3KRWB 3PXTD 4EP9A 4J81A 1JMXB 4ZOYA 3NVXA 3QESA 4M3UA 1L0QA 4KHYA 4FA5D 3L4MD 5AFU3 2P1QB 1FZ6E 4ESGA 1XVCE 4H5JA 4G56B 4A2LA 4FA4D 5FLXg 3RMAA 2B7MA 4FJ7A 2UZYB 3EWEA 5FXYA 2JHCA 4FVMA 1MG3A 1FS1A 5JWZA 3E4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSW B;  3DSM A;  1JJU B;  3OGL B;  2J56 H;  4D6V A;  2H13 A;  3IJC A;  5I5J A;  4AOW A;  4L3H D;  3WSO A;  3I7L A;  4YVD A;  2P9K C;  4J86 A;  5CYK B;  3SHF A;  4BUJ C;  3W15 A;  4GM9 A;  3MZK A;  2B5M A;  3EG6 A;  1PEV A;  4GM3 A;  3OW8 A;  2OIZ A;  4I79 A;  5GXI A;  5TEF A;  4H5I A;  1S4U X;  3OKY A;  2H47 A;  4PSX B;  4Z8L A;  2TRC B;  2I0R A;  2P9L C;  4I6J B;  5B4W A;  4E5Z B;  3I2N A;  4CY2 A;  2P1M B;  2Z2O A;  2IUP A;  2AGL A;  4GGC A;  4PBZ A;  5CXB A;  4BL0 A;  2H14 A;  3VA6 A;  5KDO B;  1RI6 A;  1N6D A;  3UVL A;  4U7A A;  1YFQ A;  2H9P A;  2AH1 A;  1LDK E;  4ZOZ A;  3SFZ A;  4BH6 A;  4A0A A;  1N6F A;  2CE9 A;  2OK4 A;  5FA5 B;  5EMM B;  2H9L A;  5EM2 B;  2P9I C;  3RLM D;  1ERJ A;  3F3F A;  4ZOX A;  3SN6 B;  2CO0 A;  3I7H A;  3BWS A;  4A7J A;  5H14 A;  3PSC B;  3OL2 B;  3V9F A;  3EI4 B;  3MKS B;  2G99 A;  3DWL C;  4E54 A;  4CY5 A;  3V7D B;  5IGQ A;  3EI1 B;  5FKS A;  2H3X A;  2HKM A;  3JB9 L;  3AL9 A;  1B9Y A;  3F3P A;  2PBI B;  2OK6 A;  3BG1 A;  5EMJ B;  2W18 A;  5AJA A;  4TZ4 A;  4X3E A;  5CXC B;  3RSE C;  2B4E A;  2QC5 A;  5C2V B;  4L3G D;  2XL2 A;  3SWS D;  3EI4 A;  3I7P A;  4XYI A;  4J77 A;  5IGO A;  2H68 A;  3RRM C;  3JZG A;  2AGY A;  3SBR A;  4A08 A;  1SHY B;  4J0W A;  5CXC A;  2H9M A;  4JSX C;  2IAA A;  3SBQ A;  3OGK B;  4J87 A;  1XHM A;  3L2O B;  4J0X A;  3ZWL B;  4CY3 A;  4FWW A;  3MXX A;  2YBA A;  2CN2 A;  1SQ9 A;  2P9U C;  2XL3 A;  3P4F A;  4K3J B;  5HE0 B;  3UKU C;  4GQ2 P;  4O9D A;  4J82 A;  3JZH A;  3L4O D;  1A0R B;  1JOF A;  3RFG A;  3JRO A;  5IJ8 E;  4Y7R A;  3GRE A;  2MTA H;  2I3S A;  5H1M A;  4JXM A;  4HDJ A;  5EMK B;  1R5M A;  1NEX B;  2HYE A;  2PM7 B;  2XYI A;  4O1Q D;  4PBY A;  2P1N B;  4FAV D;  2H6N A;  3C99 A;  4ES0 A;  3UVK A;  3KRX B;  1B9X A;  4JSV C;  4IMM A;  3VGZ A;  4ZN4 A;  3PVU B;  2IWF A;  3UR4 A;  1K8K C;  3N0E A;  4U1E I;  1OMW B;  5CYK A;  3SVW D;  4A11 B;  4JSN C;  4JT5 C;  1N6E A;  4GQB B;  2CE8 A;  4QRJ A;  2CN3 A;  3K26 A;  3I89 A;  3EI2 B;  4CI2 A;  3HFQ A;  5AMS A;  3AH8 B;  5FQD A;  3IKO A;  3OKW A;  2GC7 A;  4A09 B;  4E5Z A;  1GOT B;  4PNK B;  2E31 A;  3UKR C;  5I5I A;  1PBY B;  4CI3 A;  5SXM A;  2GC4 A;  4GMB A;  4LGN A;  3U4Y A;  2YNP A;  5TDH B;  4NSX A;  5C2W B;  3VH0 A;  3FGB A;  1GP2 B;  4L1Q D;  4O45 A;  5H17 A;  4UI9 R;  5GXH A;  3V5W B;  3DM0 A;  4A09 A;  4X61 B;  3A0F A;  1OLZ A;  3MMY A;  4R7A B;  3IIY A;  2HES X;  1SQJ A;  5EM2 A;  2IUQ A;  4IA9 A;  5EAP A;  4LG8 A;  2AH0 A;  3RN1 D;  3EMH A;  3C9C A;  2YNN A;  3AL8 B;  3J81 g;  1U4C A;  2AGZ A;  2Z2N A;  3CFV A;  1TYQ C;  2Z2P A;  3OL2 A;  3UVM A;  4FAN D;  5IT9 g;  4KFM B;  3PXS D;  2UZX B;  4O3T B;  3EI1 A;  2P9N C;  4AEZ A;  4Y5R D;  2PM9 B;  2AQ5 A;  2H6K A;  2HJ4 A;  4QT8 A;  4JT6 C;  3JZN A;  5HQG A;  4J8B A;  5EAR A;  5K19 A;  2OJY A;  3OGM B;  4J78 A;  2AGW A;  3EU7 A;  5A2Q g;  4CZX A;  3NVN A;  2QXV A;  3NVQ A;  4CZV A;  3I7K A;  5IC7 A;  2GNQ A;  5EAM A;  3C5M A;  3SJL D;  5TEE A;  3C6N B;  1P22 A;  3C75 H;  4FHL A;  3GFC A;  2IUV A;  1NR0 A;  2YMU A;  2OVR B;  4N14 A;  5TF2 A;  1JMZ B;  3OTT A;  2IWK A;  3I8E A;  3SMR A;  4A2M A;  4GZ8 A;  2I0S A;  2H6Q A;  3EI3 B;  2P1P B;  2P1O B;  3OKY B;  3SBP A;  3B7F A;  3UVN A;  2AGX A;  3JRP A;  4GM8 A;  1MDA H;  1VYH C;  3SLE D;  4GQ1 A;  5HYN B;  4X60 B;  5GSA A;  3PE7 A;  4J84 A;  1TBG A;  4QL1 A;  5CXB B;  4GGA A;  4OWR A;  3EI3 A;  2YB8 B;  4ERY A;  4O3U B;  4XYH A;  4ZOV A;  1GXR A;  4K3I D;  4CC9 A;  3JAM g;  3ORV D;  3UVO A;  5THA A;  3DXM C;  2P9P C;  3BG0 A;  3IIW A;  3K27 A;  3PXW D;  4L9O A;  3AFC A;  4A0A B;  5IBK B;  2YNO A;  4PC0 A;  3C6O B;  3RFH A;  1PI6 A;  2BBK H;  2EBS A;  3I8C A;  4X63 B;  4LG9 A;  4A11 A;  1PGU A;  3SCY A;  1QNI A;  4CI1 A;  5FKQ A;  2HXC A;  3JPX A;  4CZY A;  3I7O A;  5K1C C;  2P9S C;  3DXK C;  4D0K A;  4XEI C;  3EI2 A;  5EAL A;  2B5L A;  3J80 g;  4E54 B;  2OVQ B;  3FM0 A;  4EWR A;  4FA1 D;  2CNX A;  3ODT A;  2HJB A;  3I7N A;  3PSL A;  4ERQ A;  4J79 A;  1U2V C;  1GG2 B;  3C6P B;  4GGD A;  5EML B;  4FA9 D;  4A0B B;  3CFS B;  1MG2 A;  2PM6 B;  3CIK B;  4JD2 C;  3SXT D;  2I3T A;  2XU7 A;  2J55 H;  3RMZ D;  1XIP A;  3E0C A;  3RN0 D;  2IUR A;  3N0D A;  4OZU A;  3PVW B;  4A08 B;  4CY1 A;  5IJ7 E;  2I0T A;  3IJ0 A;  5HE3 B;  3MZL A;  4PXW A;  4CI8 A;  2J57 G;  5C9Z B;  4JSP C;  1XKS A;  4ERZ A;  4A0B A;  5I5M A;  3ULE C;  3AL8 A;  3MKQ A;  2O9K A;  5FKT A;  1FWX A;  3F3G A;  3OKT A;  2G9A A;  2CO0 C;  2OVP B;  4J8G A;  2BCJ B;  5FKR A;  2E32 A;  1K32 A;  3IJ1 A;  2H9N A;  5HE1 B;  4FB1 D;  2Q7Q A;  4J73 A;  2B5N A;  5GMK n;  2PM9 A;  2HKR A;  3FRX A;  1Q47 A;  4MK0 B;  4QQE A;  5HE2 B;  3KRW B;  3PXT D;  4J81 A;  1JMX B;  4ZOY A;  3NVX A;  1L0Q A;  4FA5 D;  3L4M D;  5AFU 3;  2P1Q B;  4ESG A;  4H5J A;  4G56 B;  4A2L A;  4FA4 D;  5FLX g;  2UZY B;  3EWE A;  5FXY A;  1MG3 A;  1FS1 A;  5JWZ A; 
#chains in the Genus database with same CATH topology
 1BPO A;  4FJL A;  4PSW B;  3IVM A;  3DSM A;  1JJU B;  3OGL B;  4J2E A;  4L1M A;  2J56 H;  4D6V A;  1QFS A;  3OF7 A;  2H13 A;  3IJC A;  5I5J A;  4M41 A;  4AOW A;  4L3H D;  3WSO A;  3CFR A;  3I7L A;  4YVD A;  2P9K C;  4J86 A;  5E6R A;  5CYK B;  4DTM A;  3SHF A;  4BUJ C;  1XVD E;  3W15 A;  4GM9 A;  4WK4 A;  3MZK A;  3SQ2 A;  1I2M B;  2B5M A;  3EG6 A;  1PEV A;  4GM3 A;  3OW8 A;  1VZ3 A;  2OIZ A;  4FJM A;  4I79 A;  5GXI A;  5TEF A;  3J27 A;  4H5I A;  2HU5 A;  1S4U X;  3OKY A;  4JS4 A;  3KCI A;  4FJH A;  2H47 A;  4PSX B;  4Z8L A;  2TRC B;  4DU3 A;  2VIX A;  1H2X A;  2I0R A;  2P9L C;  4DTO A;  4I6J B;  5B4W A;  4E5Z B;  3I2N A;  4CY2 A;  2P1M B;  2Z2O A;  5M5R A;  5FFG A;  4M3W A;  3J2P A;  4JRP A;  3O4J A;  2IUP A;  2DEB A;  4D9S A;  2AGL A;  4GGC A;  4NBM A;  4DU4 A;  4PBZ A;  4DTX A;  3O4I A;  5CXB A;  4FK4 A;  4DTJ A;  4MMX A;  4DTR A;  4BL0 A;  1JV2 A;  2H14 A;  3VA6 A;  2LF6 A;  3LD8 A;  3MUN A;  5KDO B;  1RI6 A;  1N6D A;  3UVL A;  4M3Z A;  1XMH E;  4U7A A;  1YFQ A;  5M5U A;  2H9P A;  2AH1 A;  1LDK E;  3EQ7 A;  4ZOZ A;  4J2A A;  3SFZ A;  3VI3 A;  4BH6 A;  3IUN A;  4A0A A;  1N6F A;  2CE9 A;  2ATQ A;  2OK4 A;  5FA5 B;  5EMM B;  1XMF E;  2B1E A;  5FFO A;  2H9L A;  1IH7 A;  1XVE E;  5EM2 B;  2P9I C;  4J2D A;  3RLM D;  1ERJ A;  4BCB A;  3F3F A;  3QI0 A;  4ZOX A;  4RNG A;  3SN6 B;  4GAM C;  2CO0 A;  4M45 A;  1FZ8 E;  3RMB A;  3I7H A;  4NAA A;  3BWS A;  4A7J A;  5H14 A;  3IJE A;  4AX4 A;  4M3R A;  3PSC B;  3ZE1 A;  4WK0 A;  3SUP A;  3OL2 B;  3V9F A;  3K6S A;  1MTY G;  3EI4 B;  3MKS B;  2G99 A;  3DWL C;  4E54 A;  4CY5 A;  2JHA A;  2MMB A;  3V7D B;  5IGQ A;  3EI1 B;  5FKS A;  3QET A;  3HP9 A;  2H3X A;  2HKM A;  4B08 A;  1B9Y A;  3AL9 A;  3F3P A;  4MMY A;  4O02 A;  4AN1 A;  2PBI B;  4WK2 A;  3ZDX A;  2OK6 A;  4M3Y A;  3BG1 A;  2EIE A;  4KHQ A;  2QXF A;  2W18 A;  3SJJ A;  5AJA A;  3IUJ A;  5EMJ B;  4TZ4 A;  4X3E A;  5CXC B;  3L0M A;  3C94 A;  3RSE C;  3IUR A;  3MUO A;  2B4E A;  2QC5 A;  2PFT A;  3C95 A;  5C2V B;  4JRQ A;  1XU3 E;  4L3G D;  2XL2 A;  3SWS D;  4JHN A;  1FZH E;  3K2O A;  3EI4 A;  4DTU A;  3I7P A;  4XYI A;  4J77 A;  5IGO A;  3SI6 A;  2H68 A;  3RRM C;  3JZG A;  2AGY A;  3LDS A;  3SBR A;  2DTU A;  2MW2 A;  3CQ8 A;  4A08 A;  1SHY B;  4J0W A;  5CXC A;  4AKH A;  2H9M A;  4JSX C;  3UO3 A;  3TAE A;  2IAA A;  2LF3 A;  2QZP A;  3SBQ A;  3OGK B;  3L1N A;  3SUN A;  4J87 A;  1XHM A;  3L2O B;  4J0X A;  3N1B A;  3ZWL B;  3SUO A;  4CY3 A;  4DNW A;  1XVF E;  4FWW A;  1WAF A;  1E8M A;  1YR2 A;  3MXX A;  2YBA A;  4HCB A;  4KI6 A;  5M5T A;  2CN2 A;  1XU5 E;  2VDM A;  1SQ9 A;  2P9U C;  2XL3 A;  3P4F A;  4K3J B;  5HE0 B;  3UKU C;  4GQ2 P;  2VZ3 A;  4O9D A;  4J82 A;  3JZH A;  3L4O D;  1MHZ G;  4FJJ A;  1A0R B;  4FJ8 A;  1JOF A;  3RFG A;  3JRO A;  5IJ8 E;  1FZ5 E;  3SPY A;  4Y7R A;  4DTP A;  3N1E A;  2EIC A;  3GRE A;  2MTA H;  4NEN A;  2P5G A;  2I3S A;  3HGK E;  2XE4 A;  5H1M A;  4JXM A;  4HCC A;  4HDJ A;  3QEX A;  2P5O A;  5EMK B;  1R5M A;  1NEX B;  2OZM A;  1GOG A;  2HYE A;  2PM7 B;  2XYI A;  2H4T A;  2VC2 A;  2VDN A;  4DTN A;  4O1Q D;  4PBY A;  2XZG A;  2P1N B;  4FAV D;  2H6N A;  2YB5 A;  3SPZ A;  3C99 A;  1FPO A;  4UM9 A;  1FZ1 E;  3UVK A;  3KRX B;  4ES0 A;  1B9X A;  4JSV C;  4IMM A;  3VGZ A;  4ZN4 A;  4AKG A;  3PVU B;  2IWF A;  3UR4 A;  3MVD K;  1FXX A;  1FZ7 E;  1E8N A;  1K8K C;  3N0E A;  2JH9 A;  4U1E I;  2VJ4 A;  1OMW B;  5CYK A;  3SVW D;  1XVB E;  4A11 B;  4JSN C;  4UM8 A;  1U8C A;  3L8B A;  4JT5 C;  1N6E A;  2QR5 A;  5IZ7 A;  2CE8 A;  4GQB B;  4FJ9 A;  2CN3 A;  3K26 A;  4QRJ A;  3I89 A;  3EI2 B;  4CI2 A;  3NIF A;  3HFQ A;  3KD5 E;  3ZE0 A;  5AMS A;  3AH8 B;  5FQD A;  2OZS A;  3IKO A;  3OKW A;  2GC7 A;  1FZI E;  4AN0 A;  4A09 B;  4E5Z A;  1GOT B;  4FJG A;  4PNK B;  4IT5 A;  1WAJ A;  4EYW A;  2E31 A;  3DDU A;  3UKR C;  5I5I A;  1VZ2 A;  5M5S A;  1PBY B;  3QEP A;  1O6F A;  4QAM A;  2RCU A;  3QEI A;  4CI3 A;  1UOP A;  3SVI A;  3QNN A;  3KD1 E;  5SXM A;  2JH8 A;  4G55 A;  2GC4 A;  4GMB A;  4JHP C;  1N1C A;  4LGN A;  3U4Y A;  3SQ4 A;  2YNP A;  5TDH B;  4NSX A;  5C2W B;  3VH0 A;  1FYZ E;  4O2W A;  3SNN A;  3GD1 I;  2MZW B;  3FGB A;  3CFP A;  4FK0 A;  1GP2 B;  4L1Q D;  4O45 A;  3NCI A;  5H17 A;  2JKX A;  4M42 A;  4UI9 R;  3ZE2 A;  5GXH A;  3V5W B;  3DM0 A;  4A09 A;  4X61 B;  3A0F A;  1OLZ A;  4FJN A;  4KHS A;  3MMY A;  4R7A B;  3IIY A;  2HU8 A;  3LDB A;  2HES X;  4M3X A;  1SQJ A;  5EM2 A;  3TJY A;  2IUQ A;  4IA9 A;  1MMO G;  3SQ1 A;  5EAP A;  2VDL A;  4FK2 A;  4LG8 A;  2AH0 A;  3RN1 D;  3NHG A;  3NAE A;  3SUQ A;  3EMH A;  3C9C A;  4BCC A;  2YNN A;  3T3M A;  3AL8 B;  3ZDY A;  4Z7Q A;  3J81 g;  1U4C A;  2AGZ A;  2Z2N A;  3CFV A;  1TYQ C;  1GOH A;  2Z2P A;  3OL2 A;  3UVM A;  4FAN D;  5IT9 g;  4KFM B;  3UO2 A;  3HGL A;  3PXS D;  2UZX B;  4O3T B;  4RE6 A;  3IUQ A;  3EI1 A;  3NDK A;  2P9N C;  1E5T A;  4AEZ A;  4Y5R D;  3S9H A;  2PM9 B;  2AQ5 A;  3SCX A;  1T2X A;  2H6K A;  4X5N A;  2HJ4 A;  4JT6 C;  3JZN A;  4QT8 A;  5HQG A;  3K71 A;  2XDW A;  4J8B A;  1C9I A;  5EAR A;  1JTD B;  3RMD A;  5K19 A;  4BP8 A;  2OJY A;  4FJX A;  1VE6 A;  2HD0 A;  3OGM B;  4G1E A;  2AGW A;  2WQ8 A;  3EU7 A;  3FCU A;  4J78 A;  5IRE A;  4CZX A;  5A2Q g;  3NVN A;  2QXV A;  3NVQ A;  4CZV A;  3I7K A;  2VDO A;  5IC7 A;  2GNQ A;  5EAM A;  3C5M A;  4I9L A;  3SJL D;  5TEE A;  3C6N B;  4J2B A;  1P22 A;  4AMZ A;  3C75 H;  4KHU A;  4RG8 A;  1UTC A;  2VDK A;  4FHL A;  3LZJ A;  4FJI A;  5E6S A;  3GFC A;  3NE6 A;  2IUV A;  1IG9 A;  1C9L A;  1NR0 A;  2YMU A;  2OVR B;  4RL5 A;  3TAB A;  4N14 A;  2HU7 A;  5TF2 A;  1JMZ B;  1Q9X A;  3FCS A;  4AKI A;  3OTT A;  2IWK A;  2JPN A;  3NID A;  2DY4 A;  3I8E A;  3SMR A;  5C86 A;  4A2M A;  4KHN A;  4GZ8 A;  4QND A;  2I0S A;  4BP9 A;  1K3I A;  2H6Q A;  3EI3 B;  2P1P B;  4M3T A;  2P1O B;  1FZ4 E;  1CLQ A;  3OKY B;  3SBP A;  4X5M A;  1FZ9 E;  1H2W A;  3B7F A;  3UVN A;  2AGX A;  4JS5 A;  3JRP A;  4GM8 A;  1MDA H;  1VYH C;  3SLE D;  4GQ1 A;  5HYN B;  4X60 B;  5GSA A;  5H37 A;  4G1M A;  3PE7 A;  4J84 A;  3EQ8 A;  4E3S A;  1TBG A;  4QL1 A;  4FJK A;  1L5G A;  5CXB B;  4GGA A;  3E4Y A;  3EI3 A;  2YB8 B;  4OWR A;  4EPH A;  4ERY A;  4O3U B;  4XYH A;  1GOF A;  4ZOV A;  1GXR A;  3QNO A;  4K3I D;  4CC9 A;  3TAG A;  2VDP A;  3V4P A;  3JAM g;  3ORV D;  3UVO A;  5THA A;  3DXM C;  2P9P C;  3BG0 A;  3IIW A;  3O4G A;  3K27 A;  3RWU A;  1UOO A;  3PXW D;  4L9O A;  5M5V A;  3AFC A;  2FW3 A;  3LZI A;  4A0A B;  5IBK B;  2EIB A;  2YNO A;  4PC0 A;  4FJ5 A;  3C6O B;  1M1X A;  3RFH A;  3EQ9 A;  4QNC A;  1PI6 A;  2BBK H;  2EBS A;  3NGI A;  3SQ0 A;  4AI6 A;  3I8C A;  4X63 B;  1FZ2 E;  1MHY G;  4ADO A;  4LG9 A;  4A11 A;  1PGU A;  1XMG E;  3SCY A;  1QNI A;  4CI1 A;  5FKQ A;  1UOQ A;  1FZ0 E;  2HXC A;  3JPX A;  4CZY A;  3I7O A;  5K1C C;  2P9S C;  3CFO A;  2JQT A;  3DXK C;  4D0K A;  3QHY B;  4XEI C;  3EI2 A;  1A12 A;  5EAL A;  4I9Q A;  2B5L A;  3J80 g;  3JB9 L;  4E54 B;  2OVQ B;  3IUL A;  3FM0 A;  4EWR A;  4FA1 D;  2CNX A;  3ODT A;  2VDR A;  2HJB A;  3I7N A;  3TAF A;  3PSL A;  4ERQ A;  2EID A;  1O6G A;  4J79 A;  3UIQ A;  1U2V C;  1GG2 B;  3C6P B;  4GGD A;  5HDB A;  5EML B;  4DU1 A;  3QEV A;  4FA9 D;  1XL3 C;  2OYQ A;  3K72 A;  4E4B A;  4A0B B;  3CFS B;  1MG2 A;  4DNU A;  5E6U A;  2PM6 B;  4KI4 A;  3TL8 B;  3CIK B;  4JD2 C;  2BKL A;  4ADN A;  4IRZ A;  3SXT D;  3VI4 A;  1FZ3 E;  2I3T A;  4WJK A;  2XU7 A;  2J55 H;  3RMZ D;  1XIP A;  1VE7 A;  3E0C A;  2RKH A;  3RN0 D;  2IUR A;  3N0D A;  4ICG C;  3RMC A;  4OZU A;  3PVW B;  4A08 B;  2VJ5 A;  3IUM A;  3O4H A;  3T3P A;  4CY1 A;  5IJ7 E;  2I0T A;  3IJ0 A;  1TYE A;  3ZDZ A;  5HE3 B;  3MZL A;  4PXW A;  5C92 A;  2J57 G;  2FYO A;  1H2Z A;  4DTS A;  2VDQ A;  5C9Z B;  4CI8 A;  4JSP C;  1XKS A;  4ERZ A;  4A0B A;  4Z7O A;  2VZ1 A;  4Z7N A;  3ULE C;  1Q9Y A;  3AL8 A;  5I5M A;  3MKQ A;  1QFM A;  2O9K A;  5FKT A;  4KHW A;  2B8I A;  3QER A;  1FWX A;  3F3G A;  3OKT A;  2G9A A;  5M61 A;  2PFV A;  2CO0 C;  2OVP B;  4J8G A;  2BCJ B;  5FKR A;  2K5S A;  4AMY A;  2E32 A;  1K32 A;  2JHP A;  3IJ1 A;  2H9N A;  1H2Y A;  5HE1 B;  4DNV A;  2Q7Q A;  4J73 A;  4FB1 D;  1XVG E;  3QEW A;  1JW2 A;  2B5N A;  5GMK n;  2PM9 A;  2HKR A;  3FRX A;  1Q47 A;  3NIG A;  4MK0 B;  3HL8 A;  4QQE A;  5HE2 B;  3KRW B;  3PXT D;  4EP9 A;  4J81 A;  4NC4 A;  1JMX B;  4ZOY A;  3NVX A;  3QES A;  4M3U A;  1L0Q A;  4KHY A;  4FA5 D;  3L4M D;  5AFU 3;  4MMZ A;  3BVO A;  3GC3 B;  4RE5 A;  2P1Q B;  1FZ6 E;  3V4V A;  1XVC E;  4H5J A;  4ESG A;  4G56 B;  4A2L A;  4FA4 D;  5FLX g;  3RMA A;  2B7M A;  4FJ7 A;  4BCD A;  2UZY B;  3EWE A;  5FXY A;  2JHC A;  4FVM A;  1MG3 A;  1FS1 A;  5JWZ A;  3E4W A; 
#chains in the Genus database with same CATH homology
 4FJL A;  4PSW B;  3DSM A;  1JJU B;  3OGL B;  4J2E A;  2J56 H;  4D6V A;  2H13 A;  3IJC A;  5I5J A;  4M41 A;  4AOW A;  4L3H D;  3WSO A;  3CFR A;  3I7L A;  4YVD A;  2P9K C;  4J86 A;  5CYK B;  4DTM A;  3SHF A;  4BUJ C;  1XVD E;  3W15 A;  4GM9 A;  3MZK A;  3SQ2 A;  2B5M A;  3EG6 A;  1PEV A;  4GM3 A;  3OW8 A;  2OIZ A;  4FJM A;  4I79 A;  5GXI A;  5TEF A;  3J27 A;  4H5I A;  1S4U X;  3OKY A;  4JS4 A;  4FJH A;  2H47 A;  4PSX B;  4Z8L A;  2TRC B;  4DU3 A;  2VIX A;  2I0R A;  2P9L C;  4DTO A;  4I6J B;  5B4W A;  4E5Z B;  3I2N A;  4CY2 A;  2P1M B;  2Z2O A;  4M3W A;  3J2P A;  4JRP A;  2IUP A;  2DEB A;  2AGL A;  4GGC A;  4DU4 A;  4PBZ A;  4DTX A;  5CXB A;  4FK4 A;  4DTJ A;  4DTR A;  4BL0 A;  2H14 A;  3VA6 A;  2LF6 A;  3LD8 A;  5KDO B;  1RI6 A;  1N6D A;  3UVL A;  4M3Z A;  1XMH E;  4U7A A;  1YFQ A;  2H9P A;  2AH1 A;  1LDK E;  4ZOZ A;  3SFZ A;  4J2A A;  4BH6 A;  4A0A A;  1N6F A;  2CE9 A;  2ATQ A;  2OK4 A;  5FA5 B;  5EMM B;  1XMF E;  2B1E A;  2H9L A;  1IH7 A;  1XVE E;  5EM2 B;  2P9I C;  4J2D A;  3RLM D;  1ERJ A;  3F3F A;  4ZOX A;  4RNG A;  3SN6 B;  4GAM C;  2CO0 A;  4M45 A;  1FZ8 E;  3RMB A;  3I7H A;  3BWS A;  4A7J A;  5H14 A;  4M3R A;  3PSC B;  3SUP A;  3OL2 B;  3V9F A;  1MTY G;  3EI4 B;  3MKS B;  2G99 A;  3DWL C;  4E54 A;  4CY5 A;  2JHA A;  2MMB A;  3V7D B;  5IGQ A;  3EI1 B;  5FKS A;  3QET A;  3HP9 A;  2H3X A;  2HKM A;  4B08 A;  1B9Y A;  3AL9 A;  3F3P A;  3JB9 L;  2PBI B;  2OK6 A;  4M3Y A;  3BG1 A;  4KHQ A;  2QXF A;  2W18 A;  3SJJ A;  5AJA A;  5EMJ B;  4TZ4 A;  4X3E A;  5CXC B;  3L0M A;  3C94 A;  3RSE C;  2B4E A;  2QC5 A;  2PFT A;  3C95 A;  5C2V B;  4JRQ A;  1XU3 E;  4L3G D;  2XL2 A;  3SWS D;  1FZH E;  3K2O A;  3EI4 A;  4DTU A;  3I7P A;  4XYI A;  4J77 A;  5IGO A;  3SI6 A;  2H68 A;  3RRM C;  3JZG A;  2AGY A;  3LDS A;  3SBR A;  2DTU A;  4A08 A;  3CQ8 A;  1SHY B;  4J0W A;  5CXC A;  4AKH A;  2H9M A;  4JSX C;  3TAE A;  2IAA A;  2LF3 A;  3SBQ A;  3OGK B;  3L1N A;  3SUN A;  4J87 A;  1XHM A;  3L2O B;  4J0X A;  3N1B A;  3ZWL B;  3SUO A;  4CY3 A;  1XVF E;  4FWW A;  1WAF A;  3MXX A;  2YBA A;  4HCB A;  4KI6 A;  2CN2 A;  1XU5 E;  1SQ9 A;  2P9U C;  2XL3 A;  3P4F A;  4K3J B;  5HE0 B;  3UKU C;  4GQ2 P;  4O9D A;  4J82 A;  3JZH A;  3L4O D;  1MHZ G;  4FJJ A;  1A0R B;  4FJ8 A;  1JOF A;  3RFG A;  3JRO A;  5IJ8 E;  1FZ5 E;  3SPY A;  4Y7R A;  4DTP A;  3N1E A;  3GRE A;  2MTA H;  2P5G A;  2I3S A;  3HGK E;  5H1M A;  4JXM A;  4HCC A;  4HDJ A;  3QEX A;  2P5O A;  5EMK B;  1R5M A;  1NEX B;  2OZM A;  2HYE A;  2PM7 B;  2XYI A;  2H4T A;  4DTN A;  4O1Q D;  4PBY A;  2P1N B;  4FAV D;  2H6N A;  2YB5 A;  3SPZ A;  3C99 A;  4ES0 A;  1FZ1 E;  3UVK A;  3KRX B;  1B9X A;  4JSV C;  4IMM A;  3VGZ A;  4ZN4 A;  4AKG A;  3PVU B;  2IWF A;  3UR4 A;  1FXX A;  1FZ7 E;  1K8K C;  3N0E A;  2JH9 A;  4U1E I;  2VJ4 A;  1OMW B;  5CYK A;  3SVW D;  1XVB E;  4A11 B;  4JSN C;  3L8B A;  4JT5 C;  1N6E A;  5IZ7 A;  2CE8 A;  4GQB B;  4FJ9 A;  2CN3 A;  3K26 A;  4QRJ A;  3I89 A;  3EI2 B;  4CI2 A;  3HFQ A;  3KD5 E;  5AMS A;  3AH8 B;  5FQD A;  2OZS A;  3IKO A;  3OKW A;  2GC7 A;  1FZI E;  4A09 B;  4E5Z A;  1GOT B;  4FJG A;  4PNK B;  1WAJ A;  4EYW A;  2E31 A;  3UKR C;  5I5I A;  1PBY B;  3QEP A;  2RCU A;  3QEI A;  4CI3 A;  3SVI A;  3QNN A;  3KD1 E;  5SXM A;  2JH8 A;  2GC4 A;  4GMB A;  4LGN A;  3U4Y A;  3SQ4 A;  2YNP A;  5TDH B;  4NSX A;  5C2W B;  3VH0 A;  1FYZ E;  3SNN A;  2MZW B;  3FGB A;  3CFP A;  4FK0 A;  1GP2 B;  4L1Q D;  4O45 A;  3NCI A;  5H17 A;  4M42 A;  4UI9 R;  5GXH A;  3V5W B;  3DM0 A;  4A09 A;  4X61 B;  3A0F A;  1OLZ A;  4FJN A;  4KHS A;  3MMY A;  4R7A B;  3IIY A;  3LDB A;  2HES X;  4M3X A;  1SQJ A;  5EM2 A;  3TJY A;  2IUQ A;  4IA9 A;  1MMO G;  3SQ1 A;  5EAP A;  4FK2 A;  4LG8 A;  2AH0 A;  3RN1 D;  3NHG A;  3NAE A;  3SUQ A;  3EMH A;  3C9C A;  2YNN A;  3AL8 B;  3J81 g;  1U4C A;  2AGZ A;  2Z2N A;  3CFV A;  1TYQ C;  2Z2P A;  3OL2 A;  3UVM A;  4FAN D;  5IT9 g;  4KFM B;  3HGL A;  3PXS D;  2UZX B;  4O3T B;  3EI1 A;  3NDK A;  2P9N C;  4AEZ A;  4Y5R D;  3S9H A;  2PM9 B;  2AQ5 A;  3SCX A;  2H6K A;  2HJ4 A;  4X5N A;  4QT8 A;  4JT6 C;  3JZN A;  5HQG A;  4J8B A;  5EAR A;  3RMD A;  5K19 A;  2OJY A;  4FJX A;  2HD0 A;  3OGM B;  4J78 A;  2AGW A;  3EU7 A;  5A2Q g;  5IRE A;  4CZX A;  3NVN A;  2QXV A;  3NVQ A;  4CZV A;  3I7K A;  5IC7 A;  2GNQ A;  5EAM A;  3C5M A;  4I9L A;  3SJL D;  5TEE A;  3C6N B;  4J2B A;  1P22 A;  3C75 H;  4KHU A;  4RG8 A;  4FHL A;  3LZJ A;  4FJI A;  3GFC A;  3NE6 A;  2IUV A;  1IG9 A;  1NR0 A;  2YMU A;  2OVR B;  4RL5 A;  3TAB A;  4N14 A;  5TF2 A;  1JMZ B;  1Q9X A;  4AKI A;  3OTT A;  2IWK A;  2JPN A;  2DY4 A;  3I8E A;  3SMR A;  4A2M A;  4KHN A;  4GZ8 A;  4QND A;  2I0S A;  2H6Q A;  3EI3 B;  2P1P B;  4M3T A;  2P1O B;  1FZ4 E;  1CLQ A;  3OKY B;  3SBP A;  4X5M A;  1FZ9 E;  3B7F A;  3UVN A;  2AGX A;  4JS5 A;  3JRP A;  4GM8 A;  1MDA H;  1VYH C;  3SLE D;  4GQ1 A;  5HYN B;  4X60 B;  5GSA A;  5H37 A;  3PE7 A;  4J84 A;  4E3S A;  1TBG A;  4QL1 A;  4FJK A;  5CXB B;  4GGA A;  3E4Y A;  3EI3 A;  2YB8 B;  4OWR A;  4EPH A;  4ERY A;  4O3U B;  4XYH A;  4ZOV A;  1GXR A;  3QNO A;  4K3I D;  4CC9 A;  3TAG A;  3JAM g;  3ORV D;  3UVO A;  5THA A;  3DXM C;  2P9P C;  3BG0 A;  3IIW A;  3K27 A;  3RWU A;  3PXW D;  4L9O A;  3AFC A;  2FW3 A;  3LZI A;  4A0A B;  5IBK B;  2YNO A;  4PC0 A;  4FJ5 A;  3C6O B;  3RFH A;  4QNC A;  1PI6 A;  2BBK H;  2EBS A;  3NGI A;  3SQ0 A;  4AI6 A;  3I8C A;  4X63 B;  1FZ2 E;  1MHY G;  4ADO A;  4LG9 A;  4A11 A;  1PGU A;  1XMG E;  3SCY A;  1QNI A;  4CI1 A;  5FKQ A;  1FZ0 E;  2HXC A;  3JPX A;  4CZY A;  3I7O A;  5K1C C;  2P9S C;  3CFO A;  3DXK C;  4D0K A;  4XEI C;  3EI2 A;  5EAL A;  4I9Q A;  2B5L A;  3J80 g;  4E54 B;  2OVQ B;  3FM0 A;  4EWR A;  4FA1 D;  2CNX A;  3ODT A;  2HJB A;  3I7N A;  3TAF A;  3PSL A;  4ERQ A;  4J79 A;  3UIQ A;  1U2V C;  1GG2 B;  3C6P B;  4GGD A;  5EML B;  4DU1 A;  3QEV A;  4FA9 D;  1XL3 C;  2OYQ A;  4E4B A;  4A0B B;  3CFS B;  1MG2 A;  2PM6 B;  4KI4 A;  3TL8 B;  3CIK B;  4JD2 C;  3SXT D;  4ADN A;  1FZ3 E;  2I3T A;  2XU7 A;  2J55 H;  3RMZ D;  1XIP A;  3E0C A;  3RN0 D;  2IUR A;  3N0D A;  4OZU A;  3RMC A;  3PVW B;  4A08 B;  2VJ5 A;  4CY1 A;  5IJ7 E;  2I0T A;  3IJ0 A;  5HE3 B;  3MZL A;  4PXW A;  4CI8 A;  2J57 G;  2FYO A;  5C9Z B;  4DTS A;  4JSP C;  1XKS A;  4ERZ A;  4A0B A;  5I5M A;  3ULE C;  1Q9Y A;  3AL8 A;  3MKQ A;  2O9K A;  5FKT A;  4KHW A;  2B8I A;  3QER A;  1FWX A;  3F3G A;  3OKT A;  2G9A A;  2PFV A;  2CO0 C;  2OVP B;  4J8G A;  2BCJ B;  5FKR A;  2E32 A;  1K32 A;  2JHP A;  3IJ1 A;  2H9N A;  5HE1 B;  4FB1 D;  2Q7Q A;  4J73 A;  1XVG E;  3QEW A;  2B5N A;  5GMK n;  2PM9 A;  2HKR A;  3FRX A;  1Q47 A;  4MK0 B;  3HL8 A;  4QQE A;  5HE2 B;  3KRW B;  3PXT D;  4EP9 A;  4J81 A;  1JMX B;  4ZOY A;  3NVX A;  3QES A;  4M3U A;  1L0Q A;  4KHY A;  4FA5 D;  3L4M D;  5AFU 3;  2P1Q B;  1FZ6 E;  4ESG A;  1XVC E;  4H5J A;  4G56 B;  4A2L A;  4FA4 D;  5FLX g;  3RMA A;  2B7M A;  4FJ7 A;  2UZY B;  3EWE A;  5FXY A;  2JHC A;  4FVM A;  1MG3 A;  1FS1 A;  5JWZ A;  3E4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...