2OVPB

Structure of the skp1-fbw7 complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
444
structure length
441
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
total genus 122
structure length 441
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovpB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovpB02
2Z2OA 4FHLA 4FA5D 3MKSB 4X3EA 2AGYA 4LG8A 5HE0B 3JB9L 1JJUB 5K1CC 4CZXA 2UZXB 3NVNA 3V9FA 3IJ0A 5C2VB 3UVKA 5HYNB 2UZYB 4ZN4A 5GSAA 3B7FA 3E0CA 4JXMA 3SN6B 5IJ7E 2IAAA 3C6PB 5EM2A 2P1NB 5FKQA 2HJ4A 2PBIB 3KRXB 2OVRB 3OGLB 3SVWD 4J0WA 1NEXB 4JD2C 2J55H 2AGXA 1LDKE 2E31A 4ZOYA 2P9UC 3HFQA 2OJYA 5CYKB 2EBSA 3OL2A 3SLED 4FA4D 4OWRA 2XYIA 3CFVA 4A08A 1MDAH 3ODTA 4O3UB 4GZ8A 4XYHA 3EI2B 3GREA 3JRPA 2P9SC 3GFCA 2H6KA 3OKYA 3UVOA 3FRXA 4CI8A 3C6NB 5EMMB 2GC4A 3CFSB 3OTTA 4R7AB 2P1OB 1FS1A 2G99A 2P9NC 4L9OA 2I0TA 5C2WB 3I7KA 3N0EA 3RFGA 2HYEA 5AFU3 2TRCB 4A2MA 4J77A 1FWXA 2H9PA 4JSPC 4UI9R 5EAPA 3IIWA 4LGNA 1U4CA 5JWZA 3RSEC 4FWWA 2B5MA 2E32A 3I8EA 2IUVA 3BWSA 3EI3A 2YB8B 5CXBA 2OK6A 4PC0A 4CZYA 3KRWB 4JSVC 3I7LA 1JOFA 2QC5A 5GXIA 2AQ5A 3I7NA 3J81g 3CIKB 5IGOA 2Q7QA 3PSCB 4CI1A 4FB1D 2HKRA 4FAVD 5EMJB 4A7JA 4GGAA 3SBRA 1TBGA 3F3FA 4J78A 1GP2B 4CZVA 4AEZA 3RMZD 1YFQA 1A0RB 2I3TA 3JZGA 1QNIA 3AL9A 4EWRA 4D6VA 4A11B 4E5ZA 3EU7A 4JT5C 4X63B 2OIZA 4FA9D 3VH0A 4L3HD 5IT9g 2OK4A 1PI6A 2P9KC 1XKSA 2AGWA 1RI6A 2B5LA 2XL3A 4A0AA 3K27A 4A0BA 3AL8B 5AMSA 3IJCA 3V7DB 4QL1A 2AH0A 4FAND 4J82A 2H13A 3J80g 3EMHA 4BL0A 1SQ9A 5A2Qg 4ZOXA 2P1PB 3SWSD 5FXYA 4O1QD 1GG2B 4J73A 4A2LA 5GMKn 4O3TB 3NVQA 4PXWA 5HE2B 1JMZB 4GGCA 1TYQC 3IKOA 3OW8A 4ERQA 2GNQA 3VGZA 3OKWA 4GM3A 3VA6A 2H47A 1U2VC 4CY2A 4HDJA 3NVXA 5IGQA 4A0AB 3SXTD 4CY1A 5CXCA 5EM2B 4A0BB 5THAA 4A09B 4X60B 3L4MD 1GOTB 5CXCB 4OZUA 4GGDA 3PE7A 1S4UX 1PEVA 2CO0A 4J8GA 2P9LC 5TEEA 4ERZA 3U4YA 3EWEA 1SQJA 5IBKB 2CN2A 2YNNA 3RRMC 3SBQA 5CYKA 4JT6C 4FA1D 4O9DA 3MKQA 1OLZA 5TDHB 5FLXg 3F3PA 3OGKB 3MZLA 1XIPA 5FKTA 2J57G 4ES0A 3EI4A 3PVUB 3UVNA 5TEFA 3L2OB 4J87A 4NSXA 2IUPA 3JAMg 3OKTA 2OVQB 4CY3A 5FKSA 2YNOA 3C5MA 2BBKH 2PM7B 3A0FA 2B5NA 4XYIA 3C6OB 3I7HA 2W18A 4XEIC 3DXKC 4GQBB 2OVPB 4J86A 3MZKA 3I89A 4U1EI 1N6EA 4J79A 1MG2A 3AH8B 2P1QB 3WSOA 2AGZA 3C75H 3IJ1A 3PSLA 2H68A 4LG9A 5EMKB 3UKRC 4JSXC 5I5MA 3IIYA 3V5WB 2CE9A 2CO0C 2MTAH 2YNPA 4Z8LA 2I0SA 4IMMA 4QT8A 2HXCA 4I6JB 3SBPA 4AOWA 1N6FA 3JZHA 1NR0A 2H3XA 2CNXA 4CI2A 2PM9A 5SXMA 2CE8A 4QRJA 3JROA 4CI3A 3F3GA 2P9IC 1R5MA 5FQDA 4CY5A 4QQEA 2PM9B 4PBYA 4YVDA 2AGLA 4ZOVA 5B4WA 3ORVD 4L3GD 4PSWB 1P22A 5K19A 2IUQA 4TZ4A 5EAMA 3DXMC 2AH1A 2Z2PA 3P4FA 5CXBB 5AJAA 2QXVA 4KFMB 2CN3A 4PSXB 5I5IA 5HE1B 1VYHC 3BG1A 4JSNC 2H9LA 5HQGA 5IJ8E 4PNKB 2XL2A 3N0DA 3PVWB 4CC9A 3MXXA 3BG0A 3OL2B 3PXSD 2HESX 3DWLC 1PGUA 4GMBA 4A08B 3FGBA 4K3JB 1SHYB 3SJLD 2H6NA 3EI3B 4IA9A 3EI2A 5IC7A 4ESGA 3OKYB 4ZOZA 1GXRA 1K32A 4H5IA 3DSMA 4A11A 1ERJA 2HKMA 2IWFA 2PM6B 2P9PC 3K26A 3ZWLB 3DM0A 2H9MA 2YBAA 5FKRA 5KDOB 4J8BA 3I7OA 1N6DA 2B4EA 3OGMB 2BCJB 3AFCA 5GXHA 4D0KA 4K3ID 4MK0B 4GQ1A 1JMXB 5EARA 4E54A 1OMWB 1B9XA 3UVMA 3MMYA 2Z2NA 5EMLB 4E5ZB 2HJBA 1XHMA 4E54B 3RFHA 4GM8A 3C99A 5EALA 4O45A 3EG6A 1MG3A 5FA5B 5H1MA 2H14A 4N14A 3EI4B 2P1MB 2XU7A 2J56H 3I7PA 4X61B 4H5JA 5HE3B 3C9CA 5H14A 3SFZA 2IURA 4PBZA 4ERYA 3I2NA 1PBYB 3SCYA 4A09A 2IWKA 4J84A 3JPXA 4GM9A 3EI1B 2H6QA 2G9AA 3UR4A 1Q47A 3I8CA 5TF2A 3RN1D 1K8KC 4G56B 4I79A 4L1QD 3RLMD 3RN0D 4BUJC 3FM0A 5C9ZB 3W15A 1L0QA 4Y5RD 2I0RA 4U7AA 3UVLA 2YMUA 4J0XA 2O9KA 4J81A 2GC7A 3SHFA 3UKUC 3AL8A 4Y7RA 3SMRA 2I3SA 5I5JA 4BH6A 3ULEC 3PXWD 3EI1A 5H17A 3L4OD 3PXTD 4GQ2P 2H9NA 1B9YA 3JZNA
chains in the Genus database with same CATH superfamily
2VZ1A 4AMZA 1MMOG 2Z2OA 4FHLA 3KCIA 3MKSB 4FA5D 4X3EA 5HDBA 2AGYA 1MTYG 1VZ3A 1H2YA 4FJLA 4LG8A 5HE0B 1H2XA 4O2WA 3JB9L 1JJUB 3TAGA 5K1CC 4CZXA 3VI3A 3NE6A 1I2MB 3QEIA 2UZXB 3QEPA 5E6RA 4QNCA 3NVNA 3V9FA 3IJ0A 5C2VB 3UVKA 1L5GA 3IJEA 4HCBA 2UZYB 4ZN4A 2JH9A 5GSAA 3B7FA 5HYNB 5IREA 3E0CA 4E4BA 4JXMA 3SN6B 3QEWA 5IJ7E 3NHGA 1WAFA 2IAAA 4WJKA 3C6PB 5EM2A 4DTPA 4BCCA 2P1NB 3S9HA 5FKQA 5M5VA 4M3TA 3C95A 2HJ4A 4Z7NA 4KHQA 2OYQA 2PBIB 3KRXB 4G55A 4DTMA 1XU3E 1XVCE 2OVRB 3OGLB 4HCCA 1FZ2E 3SVWD 4DU1A 1A12A 1NEXB 4J0WA 4JD2C 2LF6A 3CFOA 2J55H 2AGXA 4KHNA 1LDKE 2E31A 4ZOYA 4DU4A 2P9UC 2K5SA 2RKHA 2RCUA 4FJGA 3HFQA 2OJYA 5CYKB 2EBSA 3OL2A 3SLED 4FA4D 4OWRA 2XYIA 3TABA 3CFVA 4A08A 1UOQA 1MDAH 3SNNA 3ODTA 4O3UB 4GZ8A 2FYOA 4NC4A 1XMGE 4XYHA 3EQ9A 3EI2B 3NIFA 2JQTA 2VDQA 3GREA 3JRPA 4M3ZA 2P9SC 3GFCA 3BVOA 2H6KA 3HGKE 2VC2A 3FRXA 3OKYA 3UVOA 3SJJA 4CI8A 3C6NB 5EMMB 1FZ7E 2GC4A 3CFSB 3OTTA 4R7AB 1FZHE 2P1OB 1FS1A 3IURA 3CFRA 2EICA 3LZJA 2G99A 1FZ3E 2P9NC 4L9OA 4M3YA 3LD8A 2I0TA 2XDWA 4AX4A 5C2WB 2VDMA 3I7KA 4X5NA 3N0EA 4FJ7A 3RFGA 1GOFA 2HYEA 5AFU3 4M3XA 2TRCB 4A2MA 4J77A 1FWXA 2H9PA 4JSPC 4RE5A 4UI9R 1GOGA 1FZ4E 5EAPA 3IIWA 4LGNA 1MHZG 1U4CA 5JWZA 3HL8A 4AKHA 1CLQA 5M5UA 3RSEC 4FWWA 2B5MA 2E32A 2OZMA 1E8MA 3I8EA 2IUVA 3BWSA 3EI3A 2YB8B 4I9QA 5CXBA 2OK6A 3NIDA 4PC0A 4CZYA 1N1CA 1FZ9E 1Q9XA 3KRWB 3KD5E 4JSVC 3I7LA 1JOFA 2QC5A 5GXIA 4NBMA 2AQ5A 3I7NA 3J81g 3CIKB 3EQ7A 5IGOA 2Q7QA 3PSCB 3SUPA 4CI1A 4FB1D 3TL8B 2HKRA 3LZIA 2HD0A 5IZ7A 4FJJA 4BCDA 4FAVD 5EMJB 2VDPA 3ZE1A 4A7JA 3MUNA 4GGAA 3SBRA 1XVGE 4KHWA 3ZDXA 3RMDA 1TBGA 2MMBA 1JW2A 1FZ0E 4BP9A 3F3FA 4J78A 1GP2B 3CQ8A 4CZVA 1T2XA 4QAMA 4DU3A 3K72A 3GC3B 3RMZD 4AEZA 3UIQA 5E6UA 1YFQA 1A0RB 5M61A 1XVEE 1UOOA 2I3TA 3JZGA 3QHYB 1QNIA 3AL9A 4EWRA 4D6VA 4FJKA 4A11B 4E5ZA 3EU7A 4JT5C 1FZ6E 4X63B 2OIZA 4FA9D 3VH0A 2VIXA 4L3HD 5IT9g 4FK2A 2OK4A 1PI6A 1FZ8E 1XKSA 2AGWA 2P9KC 2XE4A 1RI6A 2B5LA 3RWUA 1VZ2A 3C94A 2ATQA 2XL3A 3T3MA 4A0AA 3K27A 4JRQA 4A0BA 3AL8B 5AMSA 4AN0A 3FCSA 1O6GA 3IJCA 3V7DB 4QL1A 2AH0A 4FAND 3SUOA 4D9SA 4J82A 5M5TA 3K71A 2H13A 4AKIA 1JV2A 3J80g 3EMHA 3UO2A 3NAEA 3TAFA 4J2DA 1SQ9A 4G1MA 4ZOXA 4DTNA 4BL0A 2P1PB 5A2Qg 3SWSD 5FXYA 3N1BA 4J2AA 3SPYA 1GG2B 4J73A 3IUMA 4O1QD 3ZE0A 4A2LA 5GMKn 1E5TA 4O3TB 3NVQA 4PXWA 3MVDK 5HE2B 3N1EA 2P5OA 1JMZB 2BKLA 1H2WA 1MHYG 1IG9A 4GGCA 1K3IA 5C92A 1TYQC 4B08A 3IKOA 3OW8A 4ERQA 2GNQA 3VGZA 3OKWA 4GM3A 3HP9A 3VA6A 1JTDB 2H47A 1U2VC 1IH7A 3SQ0A 4HDJA 4CY2A 3NVXA 1XL3C 5IGQA 2B7MA 4A0AB 3SXTD 4CY1A 4DTXA 5CXCA 5EM2B 4A0BB 5THAA 3FCUA 4AMYA 4A09B 1XMHE 4X60B 3L4MD 1GOTB 5CXCB 4OZUA 4GGDA 4FJ9A 5FFGA 4GQ2P 4DTOA 4KI4A 3PE7A 1YR2A 1S4UX 3V4PA 1PEVA 2CO0A 4J8GA 2P9LC 4AKGA 5TEEA 4ERZA 3U4YA 4KHUA 3EWEA 1SQJA 5IBKB 2JHCA 2CN2A 2YNNA 3RRMC 5M5SA 5H37A 3SBQA 5CYKA 4JT6C 4FA1D 4O9DA 4J2BA 3MKQA 4JRPA 3SCXA 1OLZA 5TDHB 5FLXg 3F3PA 3OGKB 4I9LA 3MZLA 3VI4A 1XIPA 4X5MA 1BPOA 5FKTA 2J57G 4ES0A 3EI4A 4DTJA 3RMAA 3TJYA 3PVUB 3UVNA 3MUOA 5TEFA 3L2OB 4J87A 1VE6A 4NSXA 3QETA 3IUJA 4WK2A 2YB5A 4EPHA 2IUPA 3NGIA 3JAMg 4O02A 3OKTA 2OVQB 4M42A 4CY3A 5FKSA 2YNOA 2MW2A 3O4HA 3O4GA 2VJ5A 3C5MA 2BBKH 1FZIE 2PM7B 3A0FA 2B5NA 4NAAA 4XYIA 1XMFE 4FJIA 3C6OB 3I7HA 2W18A 4XEIC 3DXKC 3SVIA 4GQBB 2OVPB 3UO3A 3O4IA 3SI6A 4J86A 3MZKA 3I89A 4U1EI 4JS5A 1N6EA 4J79A 1MG2A 2VDOA 3AH8B 2P1QB 3WSOA 4FK4A 2AGZA 3C75H 2FW3A 3IUNA 3IJ1A 3QERA 3PSLA 2H68A 4LG9A 5EMKB 3UKRC 4JSXC 2PFVA 3RMBA 3GD1I 2OZSA 5I5MA 4UM8A 1XU5E 3IIYA 2CE9A 2CO0C 3V5WB 3QNOA 3NDKA 4FVMA 2MTAH 2VDNA 4L1MA 2YNPA 5E6SA 4Z8LA 4KHSA 1O6FA 2EIEA 2I0SA 4IMMA 1H2ZA 2HU8A 4QT8A 1U8CA 5C86A 2HXCA 4I6JB 3SBPA 4AOWA 1N6FA 3JZHA 1GOHA 1NR0A 2H3XA 2QZPA 2B1EA 4EYWA 3K6SA 2CNXA 3SUQA 1VE7A 2PM9A 4ICGC 5SXMA 4CI2A 2CE8A 4QRJA 4RL5A 3JROA 4CI3A 3F3GA 2P9IC 1R5MA 4G1EA 3HGLA 5FQDA 4QQEA 2PM9B 4CY5A 4MMXA 4DNUA 4PBYA 3QEXA 2JKXA 3IUQA 4YVDA 3NCIA 2AGLA 4ZOVA 5B4WA 3ORVD 4L3GD 4PSWB 1P22A 3O4JA 5K19A 2IUQA 4M45A 3J27A 4DTSA 4TZ4A 5EAMA 1QFSA 3DXMC 2QR5A 2AH1A 2Z2PA 2DTUA 3P4FA 1WAJA 5CXBB 4E3SA 4DTRA 1UTCA 3LDSA 2VZ3A 5AJAA 2DEBA 2QXVA 4KFMB 2CN3A 4FJXA 4PSXB 5I5IA 3LDBA 1QFMA 5HE1B 3RMCA 1VYHC 3BG1A 3SQ2A 4JSNC 4RE6A 3QNNA 2H9LA 5HQGA 5IJ8E 4PNKB 4WK4A 2XL2A 3J2PA 3N0DA 3PVWB 4CC9A 3MXXA 3L1NA 3BG0A 3OL2B 3PXSD 1FPOA 1FZ5E 4FJ8A 2HESX 3CFPA 2EIDA 3DWLC 1PGUA 4GMBA 1XVBE 3FGBA 4K3JB 4A08B 4DNWA 4J2EA 1SHYB 2JHPA 2VJ4A 2VDRA 3SJLD 2H6NA 4M41A 3EI3B 4IA9A 3EI2A 3L0MA 3SQ1A 5IC7A 4ESGA 3OKYB 4ZOZA 1GXRA 1K32A 4H5IA 3DSMA 4A11A 4MMYA 1ERJA 2HKMA 2IWFA 2XZGA 1XVDE 2PM6B 2PFTA 2P9PC 2VDKA 3K26A 3ZWLB 3DM0A 2H9MA 1M1XA 1TYEA 2YBAA 5M5RA 5FKRA 5KDOB 1C9IA 3I7OA 4J8BA 1N6DA 1FZ1E 2B4EA 4QNDA 4NENA 4DNVA 3OGMB 2JH8A 2BCJB 3AFCA 4Z7QA 5GXHA 4IRZA 4K3ID 5FFOA 4D0KA 4WK0A 4MK0B 4GQ1A 1JMXB 4FJ5A 3OF7A 5EARA 4M3WA 4AN1A 1OMWB 4E54A 1B9XA 3UVMA 2DY4A 3MMYA 4BCBA 3KD1E 1E8NA 3E4YA 1C9LA 2Z2NA 5EMLB 4E5ZB 2HU5A 4Z7OA 2HJBA 1XHMA 4E54B 3RFHA 2LF3A 4GM8A 3C99A 3ZE2A 5EALA 4O45A 4EP9A 3EG6A 1MG3A 5FA5B 5H1MA 3IULA 2H14A 3QI0A 3NIGA 3QESA 4N14A 3ZDYA 4MMZA 3EQ8A 1XVFE 2B8IA 3EI4B 2HU7A 2VDLA 3SUNA 2P1MB 4AI6A 2H4TA 2J56H 2XU7A 3I7PA 4X61B 4KI6A 4H5JA 4JS4A 5HE3B 4FK0A 3C9CA 4GAMC 5H14A 3SFZA 2IURA 4PBZA 3DDUA 4ERYA 3I2NA 1PBYB 3SCYA 4A09A 4DTUA 4UM9A 2IWKA 4J84A 3JPXA 2EIBA 4GM9A 3EI1B 2H6QA 2G9AA 3SPZA 1Q9YA 3IVMA 3UR4A 4FJMA 3QEVA 1Q47A 3I8CA 5TF2A 3RN1D 3T3PA 2JHAA 2MZWB 3L8BA 1K8KC 3TAEA 2WQ8A 3E4WA 4G56B 4I79A 4L1QD 3RLMD 3RN0D 4BUJC 3FM0A 5C9ZB 3W15A 1L0QA 4Y5RD 2I0RA 4ADNA 2JPNA 4U7AA 4RNGA 4JHPC 3UVLA 1FYZE 3SQ4A 2YMUA 3ZDZA 4J0XA 4JHNA 4M3RA 2O9KA 4IT5A 4J81A 2GC7A 4ADOA 3SHFA 3V4VA 4FJHA 4KHYA 1UOPA 3K2OA 3UKUC 3AL8A 4Y7RA 3SMRA 4RG8A 2I3SA 5I5JA 4BP8A 4BH6A 3ULEC 3PXWD 1FXXA 3EI1A 5H17A 3L4OD 3PXTD 2P5GA 4FJNA 2QXFA 2H9NA 4M3UA 1B9YA 3JZNA
chains in the Genus database with same CATH topology
1MMOG 2Z2OA 4FHLA 4FA5D 3MKSB 4X3EA 2AGYA 1MTYG 4FJLA 4LG8A 5HE0B 3JB9L 1JJUB 3TAGA 5K1CC 4CZXA 3NE6A 3QEIA 2UZXB 3QEPA 4QNCA 3NVNA 3V9FA 3IJ0A 5C2VB 3UVKA 5HYNB 4HCBA 2UZYB 4ZN4A 2JH9A 5GSAA 3B7FA 5IREA 3E0CA 4E4BA 4JXMA 3SN6B 3QEWA 5IJ7E 3NHGA 1WAFA 2IAAA 3C6PB 5EM2A 4DTPA 2P1NB 3S9HA 5FKQA 4M3TA 3C95A 2HJ4A 4KHQA 2OYQA 2PBIB 3KRXB 4DTMA 1XU3E 1XVCE 2OVRB 3OGLB 4HCCA 1FZ2E 3SVWD 4DU1A 4J0WA 1NEXB 4JD2C 2LF6A 3CFOA 2J55H 2AGXA 4KHNA 1LDKE 2E31A 4ZOYA 4DU4A 2P9UC 4FJGA 2RCUA 3HFQA 2OJYA 5CYKB 2EBSA 3OL2A 3SLED 4FA4D 4OWRA 2XYIA 3TABA 3CFVA 4A08A 1MDAH 3SNNA 3ODTA 4O3UB 4GZ8A 2FYOA 1XMGE 4XYHA 3EI2B 3GREA 3JRPA 4M3ZA 2P9SC 3GFCA 2H6KA 3OKYA 3HGKE 3FRXA 3UVOA 4CI8A 3SJJA 3C6NB 5EMMB 1FZ7E 2GC4A 3CFSB 3OTTA 4R7AB 1FZHE 2P1OB 1FS1A 3CFRA 3LZJA 2G99A 1FZ3E 2P9NC 4L9OA 4M3YA 3LD8A 2I0TA 5C2WB 3I7KA 4X5NA 3N0EA 4FJ7A 3RFGA 2HYEA 5AFU3 4M3XA 2TRCB 4A2MA 4J77A 1FWXA 2H9PA 4JSPC 4UI9R 1FZ4E 5EAPA 3IIWA 4LGNA 1MHZG 1U4CA 5JWZA 3HL8A 4AKHA 1CLQA 3RSEC 4FWWA 2B5MA 2E32A 2OZMA 3I8EA 2IUVA 3BWSA 3EI3A 2YB8B 4I9QA 5CXBA 2OK6A 4PC0A 4CZYA 1FZ9E 1Q9XA 3KRWB 3KD5E 4JSVC 3I7LA 1JOFA 2QC5A 5GXIA 2AQ5A 3I7NA 3J81g 3CIKB 5IGOA 2Q7QA 3PSCB 3SUPA 4CI1A 4FB1D 3TL8B 2HKRA 3LZIA 2HD0A 5IZ7A 4FJJA 4FAVD 5EMJB 4A7JA 4GGAA 3SBRA 1XVGE 4KHWA 3RMDA 1TBGA 2MMBA 1FZ0E 3F3FA 4J78A 1GP2B 3CQ8A 4CZVA 4DU3A 4AEZA 3RMZD 3UIQA 1YFQA 1A0RB 1XVEE 2I3TA 3JZGA 1QNIA 3AL9A 4EWRA 4D6VA 4FJKA 4A11B 4E5ZA 3EU7A 4JT5C 1FZ6E 4X63B 2OIZA 4FA9D 3VH0A 2VIXA 4L3HD 5IT9g 4FK2A 2OK4A 1PI6A 1FZ8E 2AGWA 1XKSA 2P9KC 1RI6A 2B5LA 3RWUA 3C94A 2ATQA 2XL3A 4A0AA 3K27A 4JRQA 4A0BA 3AL8B 5AMSA 3IJCA 3V7DB 4QL1A 2AH0A 4FAND 3SUOA 4J82A 2H13A 4AKIA 3J80g 3EMHA 3NAEA 3TAFA 4J2DA 1SQ9A 4BL0A 5A2Qg 4ZOXA 4DTNA 2P1PB 3SWSD 5FXYA 3N1BA 4J2AA 3SPYA 1GG2B 4J73A 4O1QD 4A2LA 5GMKn 4O3TB 3NVQA 4PXWA 5HE2B 3N1EA 2P5OA 1JMZB 1MHYG 1IG9A 4GGCA 1TYQC 4B08A 3IKOA 3OW8A 4ERQA 2GNQA 3VGZA 3OKWA 4GM3A 3HP9A 3VA6A 2H47A 1U2VC 1IH7A 3SQ0A 4HDJA 4CY2A 3NVXA 1XL3C 5IGQA 2B7MA 4A0AB 3SXTD 4CY1A 4DTXA 5CXCA 5EM2B 4A0BB 5THAA 4A09B 1XMHE 4X60B 3L4MD 1GOTB 5CXCB 4OZUA 4GGDA 4FJ9A 4GQ2P 4DTOA 4KI4A 3PE7A 1S4UX 1PEVA 2CO0A 4J8GA 2P9LC 4AKGA 5TEEA 4ERZA 3U4YA 4KHUA 3EWEA 1SQJA 5IBKB 2JHCA 2CN2A 2YNNA 3RRMC 5H37A 3SBQA 5CYKA 4JT6C 4FA1D 4O9DA 4J2BA 3MKQA 4JRPA 3SCXA 1OLZA 5TDHB 5FLXg 3F3PA 3OGKB 4I9LA 3MZLA 1XIPA 4X5MA 5FKTA 2J57G 4ES0A 3EI4A 4DTJA 3RMAA 3TJYA 3PVUB 3UVNA 5TEFA 3L2OB 4J87A 4NSXA 3QETA 2YB5A 4EPHA 2IUPA 3NGIA 3JAMg 3OKTA 2OVQB 4M42A 4CY3A 5FKSA 2YNOA 2VJ5A 3C5MA 2BBKH 1FZIE 2PM7B 3A0FA 2B5NA 4XYIA 1XMFE 4FJIA 3C6OB 3I7HA 2W18A 4XEIC 3DXKC 3SVIA 4GQBB 2OVPB 3SI6A 4J86A 3MZKA 3I89A 4U1EI 4JS5A 1N6EA 4J79A 1MG2A 3AH8B 2P1QB 3WSOA 4FK4A 2AGZA 3C75H 2FW3A 3IJ1A 3QERA 3PSLA 2H68A 4LG9A 5EMKB 3UKRC 4JSXC 2PFVA 3RMBA 2OZSA 5I5MA 1XU5E 3IIYA 2CE9A 2CO0C 3V5WB 3QNOA 3NDKA 4FVMA 2MTAH 2YNPA 4Z8LA 4KHSA 2I0SA 4IMMA 4QT8A 2HXCA 4I6JB 3SBPA 4AOWA 1N6FA 3JZHA 1NR0A 2H3XA 2B1EA 4EYWA 2CNXA 3SUQA 4CI2A 2PM9A 5SXMA 2CE8A 4QRJA 4RL5A 3JROA 4CI3A 3F3GA 2P9IC 1R5MA 5FQDA 3HGLA 4CY5A 4QQEA 2PM9B 4PBYA 3QEXA 4YVDA 3NCIA 2AGLA 4ZOVA 5B4WA 3ORVD 4L3GD 4PSWB 1P22A 5K19A 2IUQA 4M45A 3J27A 4DTSA 4TZ4A 5EAMA 3DXMC 2AH1A 2Z2PA 2DTUA 3P4FA 1WAJA 5CXBB 4E3SA 4DTRA 3LDSA 5AJAA 2DEBA 2QXVA 4KFMB 2CN3A 4FJXA 4PSXB 5I5IA 3LDBA 5HE1B 3RMCA 1VYHC 3BG1A 3SQ2A 4JSNC 3QNNA 2H9LA 5HQGA 5IJ8E 4PNKB 2XL2A 3J2PA 3N0DA 3PVWB 4CC9A 3MXXA 3L1NA 3BG0A 3OL2B 3PXSD 1FZ5E 4FJ8A 2HESX 3CFPA 3DWLC 1PGUA 4GMBA 1XVBE 3FGBA 4K3JB 4A08B 4J2EA 1SHYB 2JHPA 2VJ4A 3SJLD 2H6NA 4M41A 3EI3B 4IA9A 3EI2A 3L0MA 3SQ1A 5IC7A 4ESGA 3OKYB 4ZOZA 1GXRA 1K32A 4H5IA 3DSMA 4A11A 1ERJA 2HKMA 2IWFA 1XVDE 2PM6B 2PFTA 2P9PC 3K26A 3ZWLB 3DM0A 2H9MA 2YBAA 5FKRA 5KDOB 4J8BA 3I7OA 1N6DA 1FZ1E 2B4EA 4QNDA 3OGMB 2JH8A 2BCJB 3AFCA 5GXHA 4D0KA 4K3ID 4MK0B 4GQ1A 1JMXB 4FJ5A 5EARA 4M3WA 4E54A 1OMWB 1B9XA 3UVMA 2DY4A 3MMYA 3KD1E 3E4YA 2Z2NA 5EMLB 4E5ZB 2HJBA 1XHMA 4E54B 3RFHA 2LF3A 4GM8A 3C99A 5EALA 4O45A 4EP9A 3EG6A 1MG3A 5FA5B 5H1MA 2H14A 3QESA 4N14A 1XVFE 2B8IA 3EI4B 3SUNA 2P1MB 4AI6A 2H4TA 2J56H 2XU7A 3I7PA 4X61B 4KI6A 4H5JA 4JS4A 5HE3B 4FK0A 3C9CA 4GAMC 5H14A 3SFZA 2IURA 4PBZA 4ERYA 3I2NA 1PBYB 3SCYA 4A09A 4DTUA 2IWKA 4J84A 3JPXA 4GM9A 3EI1B 2H6QA 2G9AA 3SPZA 1Q9YA 3UR4A 4FJMA 3QEVA 1Q47A 3I8CA 5TF2A 3RN1D 2JHAA 2MZWB 3L8BA 1K8KC 3TAEA 4G56B 3E4WA 4I79A 4L1QD 3RLMD 3RN0D 4BUJC 3FM0A 5C9ZB 3W15A 1L0QA 4Y5RD 2I0RA 4ADNA 2JPNA 4U7AA 4RNGA 3UVLA 1FYZE 3SQ4A 2YMUA 4J0XA 4M3RA 2O9KA 4J81A 2GC7A 4ADOA 3SHFA 4FJHA 4KHYA 3K2OA 3UKUC 3AL8A 4Y7RA 3SMRA 4RG8A 2I3SA 5I5JA 4BH6A 3ULEC 3PXWD 1FXXA 3EI1A 5H17A 3L4OD 3PXTD 2P5GA 4FJNA 2QXFA 2H9NA 4M3UA 1B9YA 3JZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z2O A;  4FHL A;  4FA5 D;  3MKS B;  4X3E A;  2AGY A;  4LG8 A;  5HE0 B;  3JB9 L;  1JJU B;  5K1C C;  4CZX A;  2UZX B;  3NVN A;  3V9F A;  3IJ0 A;  5C2V B;  3UVK A;  5HYN B;  2UZY B;  4ZN4 A;  5GSA A;  3B7F A;  3E0C A;  4JXM A;  3SN6 B;  5IJ7 E;  2IAA A;  3C6P B;  5EM2 A;  2P1N B;  5FKQ A;  2HJ4 A;  2PBI B;  3KRX B;  2OVR B;  3OGL B;  3SVW D;  4J0W A;  1NEX B;  4JD2 C;  2J55 H;  2AGX A;  1LDK E;  2E31 A;  4ZOY A;  2P9U C;  3HFQ A;  2OJY A;  5CYK B;  2EBS A;  3OL2 A;  3SLE D;  4FA4 D;  4OWR A;  2XYI A;  3CFV A;  4A08 A;  1MDA H;  3ODT A;  4O3U B;  4GZ8 A;  4XYH A;  3EI2 B;  3GRE A;  3JRP A;  2P9S C;  3GFC A;  2H6K A;  3OKY A;  3UVO A;  3FRX A;  4CI8 A;  3C6N B;  5EMM B;  2GC4 A;  3CFS B;  3OTT A;  4R7A B;  2P1O B;  1FS1 A;  2G99 A;  2P9N C;  4L9O A;  2I0T A;  5C2W B;  3I7K A;  3N0E A;  3RFG A;  2HYE A;  5AFU 3;  2TRC B;  4A2M A;  4J77 A;  1FWX A;  2H9P A;  4JSP C;  4UI9 R;  5EAP A;  3IIW A;  4LGN A;  1U4C A;  5JWZ A;  3RSE C;  4FWW A;  2B5M A;  2E32 A;  3I8E A;  2IUV A;  3BWS A;  3EI3 A;  2YB8 B;  5CXB A;  2OK6 A;  4PC0 A;  4CZY A;  3KRW B;  4JSV C;  3I7L A;  1JOF A;  2QC5 A;  5GXI A;  2AQ5 A;  3I7N A;  3J81 g;  3CIK B;  5IGO A;  2Q7Q A;  3PSC B;  4CI1 A;  4FB1 D;  2HKR A;  4FAV D;  5EMJ B;  4A7J A;  4GGA A;  3SBR A;  1TBG A;  3F3F A;  4J78 A;  1GP2 B;  4CZV A;  4AEZ A;  3RMZ D;  1YFQ A;  1A0R B;  2I3T A;  3JZG A;  1QNI A;  3AL9 A;  4EWR A;  4D6V A;  4A11 B;  4E5Z A;  3EU7 A;  4JT5 C;  4X63 B;  2OIZ A;  4FA9 D;  3VH0 A;  4L3H D;  5IT9 g;  2OK4 A;  1PI6 A;  2P9K C;  1XKS A;  2AGW A;  1RI6 A;  2B5L A;  2XL3 A;  4A0A A;  3K27 A;  4A0B A;  3AL8 B;  5AMS A;  3IJC A;  3V7D B;  4QL1 A;  2AH0 A;  4FAN D;  4J82 A;  2H13 A;  3J80 g;  3EMH A;  4BL0 A;  1SQ9 A;  5A2Q g;  4ZOX A;  2P1P B;  3SWS D;  5FXY A;  4O1Q D;  1GG2 B;  4J73 A;  4A2L A;  5GMK n;  4O3T B;  3NVQ A;  4PXW A;  5HE2 B;  1JMZ B;  4GGC A;  1TYQ C;  3IKO A;  3OW8 A;  4ERQ A;  2GNQ A;  3VGZ A;  3OKW A;  4GM3 A;  3VA6 A;  2H47 A;  1U2V C;  4CY2 A;  4HDJ A;  3NVX A;  5IGQ A;  4A0A B;  3SXT D;  4CY1 A;  5CXC A;  5EM2 B;  4A0B B;  5THA A;  4A09 B;  4X60 B;  3L4M D;  1GOT B;  5CXC B;  4OZU A;  4GGD A;  3PE7 A;  1S4U X;  1PEV A;  2CO0 A;  4J8G A;  2P9L C;  5TEE A;  4ERZ A;  3U4Y A;  3EWE A;  1SQJ A;  5IBK B;  2CN2 A;  2YNN A;  3RRM C;  3SBQ A;  5CYK A;  4JT6 C;  4FA1 D;  4O9D A;  3MKQ A;  1OLZ A;  5TDH B;  5FLX g;  3F3P A;  3OGK B;  3MZL A;  1XIP A;  5FKT A;  2J57 G;  4ES0 A;  3EI4 A;  3PVU B;  3UVN A;  5TEF A;  3L2O B;  4J87 A;  4NSX A;  2IUP A;  3JAM g;  3OKT A;  2OVQ B;  4CY3 A;  5FKS A;  2YNO A;  3C5M A;  2BBK H;  2PM7 B;  3A0F A;  2B5N A;  4XYI A;  3C6O B;  3I7H A;  2W18 A;  4XEI C;  3DXK C;  4GQB B;  2OVP B;  4J86 A;  3MZK A;  3I89 A;  4U1E I;  1N6E A;  4J79 A;  1MG2 A;  3AH8 B;  2P1Q B;  3WSO A;  2AGZ A;  3C75 H;  3IJ1 A;  3PSL A;  2H68 A;  4LG9 A;  5EMK B;  3UKR C;  4JSX C;  5I5M A;  3IIY A;  3V5W B;  2CE9 A;  2CO0 C;  2MTA H;  2YNP A;  4Z8L A;  2I0S A;  4IMM A;  4QT8 A;  2HXC A;  4I6J B;  3SBP A;  4AOW A;  1N6F A;  3JZH A;  1NR0 A;  2H3X A;  2CNX A;  4CI2 A;  2PM9 A;  5SXM A;  2CE8 A;  4QRJ A;  3JRO A;  4CI3 A;  3F3G A;  2P9I C;  1R5M A;  5FQD A;  4CY5 A;  4QQE A;  2PM9 B;  4PBY A;  4YVD A;  2AGL A;  4ZOV A;  5B4W A;  3ORV D;  4L3G D;  4PSW B;  1P22 A;  5K19 A;  2IUQ A;  4TZ4 A;  5EAM A;  3DXM C;  2AH1 A;  2Z2P A;  3P4F A;  5CXB B;  5AJA A;  2QXV A;  4KFM B;  2CN3 A;  4PSX B;  5I5I A;  5HE1 B;  1VYH C;  3BG1 A;  4JSN C;  2H9L A;  5HQG A;  5IJ8 E;  4PNK B;  2XL2 A;  3N0D A;  3PVW B;  4CC9 A;  3MXX A;  3BG0 A;  3OL2 B;  3PXS D;  2HES X;  3DWL C;  1PGU A;  4GMB A;  4A08 B;  3FGB A;  4K3J B;  1SHY B;  3SJL D;  2H6N A;  3EI3 B;  4IA9 A;  3EI2 A;  5IC7 A;  4ESG A;  3OKY B;  4ZOZ A;  1GXR A;  1K32 A;  4H5I A;  3DSM A;  4A11 A;  1ERJ A;  2HKM A;  2IWF A;  2PM6 B;  2P9P C;  3K26 A;  3ZWL B;  3DM0 A;  2H9M A;  2YBA A;  5FKR A;  5KDO B;  4J8B A;  3I7O A;  1N6D A;  2B4E A;  3OGM B;  2BCJ B;  3AFC A;  5GXH A;  4D0K A;  4K3I D;  4MK0 B;  4GQ1 A;  1JMX B;  5EAR A;  4E54 A;  1OMW B;  1B9X A;  3UVM A;  3MMY A;  2Z2N A;  5EML B;  4E5Z B;  2HJB A;  1XHM A;  4E54 B;  3RFH A;  4GM8 A;  3C99 A;  5EAL A;  4O45 A;  3EG6 A;  1MG3 A;  5FA5 B;  5H1M A;  2H14 A;  4N14 A;  3EI4 B;  2P1M B;  2XU7 A;  2J56 H;  3I7P A;  4X61 B;  4H5J A;  5HE3 B;  3C9C A;  5H14 A;  3SFZ A;  2IUR A;  4PBZ A;  4ERY A;  3I2N A;  1PBY B;  3SCY A;  4A09 A;  2IWK A;  4J84 A;  3JPX A;  4GM9 A;  3EI1 B;  2H6Q A;  2G9A A;  3UR4 A;  1Q47 A;  3I8C A;  5TF2 A;  3RN1 D;  1K8K C;  4G56 B;  4I79 A;  4L1Q D;  3RLM D;  3RN0 D;  4BUJ C;  3FM0 A;  5C9Z B;  3W15 A;  1L0Q A;  4Y5R D;  2I0R A;  4U7A A;  3UVL A;  2YMU A;  4J0X A;  2O9K A;  4J81 A;  2GC7 A;  3SHF A;  3UKU C;  3AL8 A;  4Y7R A;  3SMR A;  2I3S A;  5I5J A;  4BH6 A;  3ULE C;  3PXW D;  3EI1 A;  5H17 A;  3L4O D;  3PXT D;  4GQ2 P;  2H9N A;  1B9Y A;  3JZN A; 
#chains in the Genus database with same CATH topology
 2VZ1 A;  4AMZ A;  1MMO G;  2Z2O A;  4FHL A;  3KCI A;  3MKS B;  4FA5 D;  4X3E A;  5HDB A;  2AGY A;  1MTY G;  1VZ3 A;  1H2Y A;  4FJL A;  4LG8 A;  5HE0 B;  1H2X A;  4O2W A;  3JB9 L;  1JJU B;  3TAG A;  5K1C C;  4CZX A;  3VI3 A;  3NE6 A;  1I2M B;  3QEI A;  2UZX B;  3QEP A;  5E6R A;  4QNC A;  3NVN A;  3V9F A;  3IJ0 A;  5C2V B;  3UVK A;  1L5G A;  3IJE A;  4HCB A;  2UZY B;  4ZN4 A;  2JH9 A;  5GSA A;  3B7F A;  5HYN B;  5IRE A;  3E0C A;  4E4B A;  4JXM A;  3SN6 B;  3QEW A;  5IJ7 E;  3NHG A;  1WAF A;  2IAA A;  4WJK A;  3C6P B;  5EM2 A;  4DTP A;  4BCC A;  2P1N B;  3S9H A;  5FKQ A;  5M5V A;  4M3T A;  3C95 A;  2HJ4 A;  4Z7N A;  4KHQ A;  2OYQ A;  2PBI B;  3KRX B;  4G55 A;  4DTM A;  1XU3 E;  1XVC E;  2OVR B;  3OGL B;  4HCC A;  1FZ2 E;  3SVW D;  4DU1 A;  1A12 A;  1NEX B;  4J0W A;  4JD2 C;  2LF6 A;  3CFO A;  2J55 H;  2AGX A;  4KHN A;  1LDK E;  2E31 A;  4ZOY A;  4DU4 A;  2P9U C;  2K5S A;  2RKH A;  2RCU A;  4FJG A;  3HFQ A;  2OJY A;  5CYK B;  2EBS A;  3OL2 A;  3SLE D;  4FA4 D;  4OWR A;  2XYI A;  3TAB A;  3CFV A;  4A08 A;  1UOQ A;  1MDA H;  3SNN A;  3ODT A;  4O3U B;  4GZ8 A;  2FYO A;  4NC4 A;  1XMG E;  4XYH A;  3EQ9 A;  3EI2 B;  3NIF A;  2JQT A;  2VDQ A;  3GRE A;  3JRP A;  4M3Z A;  2P9S C;  3GFC A;  3BVO A;  2H6K A;  3HGK E;  2VC2 A;  3FRX A;  3OKY A;  3UVO A;  3SJJ A;  4CI8 A;  3C6N B;  5EMM B;  1FZ7 E;  2GC4 A;  3CFS B;  3OTT A;  4R7A B;  1FZH E;  2P1O B;  1FS1 A;  3IUR A;  3CFR A;  2EIC A;  3LZJ A;  2G99 A;  1FZ3 E;  2P9N C;  4L9O A;  4M3Y A;  3LD8 A;  2I0T A;  2XDW A;  4AX4 A;  5C2W B;  2VDM A;  3I7K A;  4X5N A;  3N0E A;  4FJ7 A;  3RFG A;  1GOF A;  2HYE A;  5AFU 3;  4M3X A;  2TRC B;  4A2M A;  4J77 A;  1FWX A;  2H9P A;  4JSP C;  4RE5 A;  4UI9 R;  1GOG A;  1FZ4 E;  5EAP A;  3IIW A;  4LGN A;  1MHZ G;  1U4C A;  5JWZ A;  3HL8 A;  4AKH A;  1CLQ A;  5M5U A;  3RSE C;  4FWW A;  2B5M A;  2E32 A;  2OZM A;  1E8M A;  3I8E A;  2IUV A;  3BWS A;  3EI3 A;  2YB8 B;  4I9Q A;  5CXB A;  2OK6 A;  3NID A;  4PC0 A;  4CZY A;  1N1C A;  1FZ9 E;  1Q9X A;  3KRW B;  3KD5 E;  4JSV C;  3I7L A;  1JOF A;  2QC5 A;  5GXI A;  4NBM A;  2AQ5 A;  3I7N A;  3J81 g;  3CIK B;  3EQ7 A;  5IGO A;  2Q7Q A;  3PSC B;  3SUP A;  4CI1 A;  4FB1 D;  3TL8 B;  2HKR A;  3LZI A;  2HD0 A;  5IZ7 A;  4FJJ A;  4BCD A;  4FAV D;  5EMJ B;  2VDP A;  3ZE1 A;  4A7J A;  3MUN A;  4GGA A;  3SBR A;  1XVG E;  4KHW A;  3ZDX A;  3RMD A;  1TBG A;  2MMB A;  1JW2 A;  1FZ0 E;  4BP9 A;  3F3F A;  4J78 A;  1GP2 B;  3CQ8 A;  4CZV A;  1T2X A;  4QAM A;  4DU3 A;  3K72 A;  3GC3 B;  3RMZ D;  4AEZ A;  3UIQ A;  5E6U A;  1YFQ A;  1A0R B;  5M61 A;  1XVE E;  1UOO A;  2I3T A;  3JZG A;  3QHY B;  1QNI A;  3AL9 A;  4EWR A;  4D6V A;  4FJK A;  4A11 B;  4E5Z A;  3EU7 A;  4JT5 C;  1FZ6 E;  4X63 B;  2OIZ A;  4FA9 D;  3VH0 A;  2VIX A;  4L3H D;  5IT9 g;  4FK2 A;  2OK4 A;  1PI6 A;  1FZ8 E;  1XKS A;  2AGW A;  2P9K C;  2XE4 A;  1RI6 A;  2B5L A;  3RWU A;  1VZ2 A;  3C94 A;  2ATQ A;  2XL3 A;  3T3M A;  4A0A A;  3K27 A;  4JRQ A;  4A0B A;  3AL8 B;  5AMS A;  4AN0 A;  3FCS A;  1O6G A;  3IJC A;  3V7D B;  4QL1 A;  2AH0 A;  4FAN D;  3SUO A;  4D9S A;  4J82 A;  5M5T A;  3K71 A;  2H13 A;  4AKI A;  1JV2 A;  3J80 g;  3EMH A;  3UO2 A;  3NAE A;  3TAF A;  4J2D A;  1SQ9 A;  4G1M A;  4ZOX A;  4DTN A;  4BL0 A;  2P1P B;  5A2Q g;  3SWS D;  5FXY A;  3N1B A;  4J2A A;  3SPY A;  1GG2 B;  4J73 A;  3IUM A;  4O1Q D;  3ZE0 A;  4A2L A;  5GMK n;  1E5T A;  4O3T B;  3NVQ A;  4PXW A;  3MVD K;  5HE2 B;  3N1E A;  2P5O A;  1JMZ B;  2BKL A;  1H2W A;  1MHY G;  1IG9 A;  4GGC A;  1K3I A;  5C92 A;  1TYQ C;  4B08 A;  3IKO A;  3OW8 A;  4ERQ A;  2GNQ A;  3VGZ A;  3OKW A;  4GM3 A;  3HP9 A;  3VA6 A;  1JTD B;  2H47 A;  1U2V C;  1IH7 A;  3SQ0 A;  4HDJ A;  4CY2 A;  3NVX A;  1XL3 C;  5IGQ A;  2B7M A;  4A0A B;  3SXT D;  4CY1 A;  4DTX A;  5CXC A;  5EM2 B;  4A0B B;  5THA A;  3FCU A;  4AMY A;  4A09 B;  1XMH E;  4X60 B;  3L4M D;  1GOT B;  5CXC B;  4OZU A;  4GGD A;  4FJ9 A;  5FFG A;  4GQ2 P;  4DTO A;  4KI4 A;  3PE7 A;  1YR2 A;  1S4U X;  3V4P A;  1PEV A;  2CO0 A;  4J8G A;  2P9L C;  4AKG A;  5TEE A;  4ERZ A;  3U4Y A;  4KHU A;  3EWE A;  1SQJ A;  5IBK B;  2JHC A;  2CN2 A;  2YNN A;  3RRM C;  5M5S A;  5H37 A;  3SBQ A;  5CYK A;  4JT6 C;  4FA1 D;  4O9D A;  4J2B A;  3MKQ A;  4JRP A;  3SCX A;  1OLZ A;  5TDH B;  5FLX g;  3F3P A;  3OGK B;  4I9L A;  3MZL A;  3VI4 A;  1XIP A;  4X5M A;  1BPO A;  5FKT A;  2J57 G;  4ES0 A;  3EI4 A;  4DTJ A;  3RMA A;  3TJY A;  3PVU B;  3UVN A;  3MUO A;  5TEF A;  3L2O B;  4J87 A;  1VE6 A;  4NSX A;  3QET A;  3IUJ A;  4WK2 A;  2YB5 A;  4EPH A;  2IUP A;  3NGI A;  3JAM g;  4O02 A;  3OKT A;  2OVQ B;  4M42 A;  4CY3 A;  5FKS A;  2YNO A;  2MW2 A;  3O4H A;  3O4G A;  2VJ5 A;  3C5M A;  2BBK H;  1FZI E;  2PM7 B;  3A0F A;  2B5N A;  4NAA A;  4XYI A;  1XMF E;  4FJI A;  3C6O B;  3I7H A;  2W18 A;  4XEI C;  3DXK C;  3SVI A;  4GQB B;  2OVP B;  3UO3 A;  3O4I A;  3SI6 A;  4J86 A;  3MZK A;  3I89 A;  4U1E I;  4JS5 A;  1N6E A;  4J79 A;  1MG2 A;  2VDO A;  3AH8 B;  2P1Q B;  3WSO A;  4FK4 A;  2AGZ A;  3C75 H;  2FW3 A;  3IUN A;  3IJ1 A;  3QER A;  3PSL A;  2H68 A;  4LG9 A;  5EMK B;  3UKR C;  4JSX C;  2PFV A;  3RMB A;  3GD1 I;  2OZS A;  5I5M A;  4UM8 A;  1XU5 E;  3IIY A;  2CE9 A;  2CO0 C;  3V5W B;  3QNO A;  3NDK A;  4FVM A;  2MTA H;  2VDN A;  4L1M A;  2YNP A;  5E6S A;  4Z8L A;  4KHS A;  1O6F A;  2EIE A;  2I0S A;  4IMM A;  1H2Z A;  2HU8 A;  4QT8 A;  1U8C A;  5C86 A;  2HXC A;  4I6J B;  3SBP A;  4AOW A;  1N6F A;  3JZH A;  1GOH A;  1NR0 A;  2H3X A;  2QZP A;  2B1E A;  4EYW A;  3K6S A;  2CNX A;  3SUQ A;  1VE7 A;  2PM9 A;  4ICG C;  5SXM A;  4CI2 A;  2CE8 A;  4QRJ A;  4RL5 A;  3JRO A;  4CI3 A;  3F3G A;  2P9I C;  1R5M A;  4G1E A;  3HGL A;  5FQD A;  4QQE A;  2PM9 B;  4CY5 A;  4MMX A;  4DNU A;  4PBY A;  3QEX A;  2JKX A;  3IUQ A;  4YVD A;  3NCI A;  2AGL A;  4ZOV A;  5B4W A;  3ORV D;  4L3G D;  4PSW B;  1P22 A;  3O4J A;  5K19 A;  2IUQ A;  4M45 A;  3J27 A;  4DTS A;  4TZ4 A;  5EAM A;  1QFS A;  3DXM C;  2QR5 A;  2AH1 A;  2Z2P A;  2DTU A;  3P4F A;  1WAJ A;  5CXB B;  4E3S A;  4DTR A;  1UTC A;  3LDS A;  2VZ3 A;  5AJA A;  2DEB A;  2QXV A;  4KFM B;  2CN3 A;  4FJX A;  4PSX B;  5I5I A;  3LDB A;  1QFM A;  5HE1 B;  3RMC A;  1VYH C;  3BG1 A;  3SQ2 A;  4JSN C;  4RE6 A;  3QNN A;  2H9L A;  5HQG A;  5IJ8 E;  4PNK B;  4WK4 A;  2XL2 A;  3J2P A;  3N0D A;  3PVW B;  4CC9 A;  3MXX A;  3L1N A;  3BG0 A;  3OL2 B;  3PXS D;  1FPO A;  1FZ5 E;  4FJ8 A;  2HES X;  3CFP A;  2EID A;  3DWL C;  1PGU A;  4GMB A;  1XVB E;  3FGB A;  4K3J B;  4A08 B;  4DNW A;  4J2E A;  1SHY B;  2JHP A;  2VJ4 A;  2VDR A;  3SJL D;  2H6N A;  4M41 A;  3EI3 B;  4IA9 A;  3EI2 A;  3L0M A;  3SQ1 A;  5IC7 A;  4ESG A;  3OKY B;  4ZOZ A;  1GXR A;  1K32 A;  4H5I A;  3DSM A;  4A11 A;  4MMY A;  1ERJ A;  2HKM A;  2IWF A;  2XZG A;  1XVD E;  2PM6 B;  2PFT A;  2P9P C;  2VDK A;  3K26 A;  3ZWL B;  3DM0 A;  2H9M A;  1M1X A;  1TYE A;  2YBA A;  5M5R A;  5FKR A;  5KDO B;  1C9I A;  3I7O A;  4J8B A;  1N6D A;  1FZ1 E;  2B4E A;  4QND A;  4NEN A;  4DNV A;  3OGM B;  2JH8 A;  2BCJ B;  3AFC A;  4Z7Q A;  5GXH A;  4IRZ A;  4K3I D;  5FFO A;  4D0K A;  4WK0 A;  4MK0 B;  4GQ1 A;  1JMX B;  4FJ5 A;  3OF7 A;  5EAR A;  4M3W A;  4AN1 A;  1OMW B;  4E54 A;  1B9X A;  3UVM A;  2DY4 A;  3MMY A;  4BCB A;  3KD1 E;  1E8N A;  3E4Y A;  1C9L A;  2Z2N A;  5EML B;  4E5Z B;  2HU5 A;  4Z7O A;  2HJB A;  1XHM A;  4E54 B;  3RFH A;  2LF3 A;  4GM8 A;  3C99 A;  3ZE2 A;  5EAL A;  4O45 A;  4EP9 A;  3EG6 A;  1MG3 A;  5FA5 B;  5H1M A;  3IUL A;  2H14 A;  3QI0 A;  3NIG A;  3QES A;  4N14 A;  3ZDY A;  4MMZ A;  3EQ8 A;  1XVF E;  2B8I A;  3EI4 B;  2HU7 A;  2VDL A;  3SUN A;  2P1M B;  4AI6 A;  2H4T A;  2J56 H;  2XU7 A;  3I7P A;  4X61 B;  4KI6 A;  4H5J A;  4JS4 A;  5HE3 B;  4FK0 A;  3C9C A;  4GAM C;  5H14 A;  3SFZ A;  2IUR A;  4PBZ A;  3DDU A;  4ERY A;  3I2N A;  1PBY B;  3SCY A;  4A09 A;  4DTU A;  4UM9 A;  2IWK A;  4J84 A;  3JPX A;  2EIB A;  4GM9 A;  3EI1 B;  2H6Q A;  2G9A A;  3SPZ A;  1Q9Y A;  3IVM A;  3UR4 A;  4FJM A;  3QEV A;  1Q47 A;  3I8C A;  5TF2 A;  3RN1 D;  3T3P A;  2JHA A;  2MZW B;  3L8B A;  1K8K C;  3TAE A;  2WQ8 A;  3E4W A;  4G56 B;  4I79 A;  4L1Q D;  3RLM D;  3RN0 D;  4BUJ C;  3FM0 A;  5C9Z B;  3W15 A;  1L0Q A;  4Y5R D;  2I0R A;  4ADN A;  2JPN A;  4U7A A;  4RNG A;  4JHP C;  3UVL A;  1FYZ E;  3SQ4 A;  2YMU A;  3ZDZ A;  4J0X A;  4JHN A;  4M3R A;  2O9K A;  4IT5 A;  4J81 A;  2GC7 A;  4ADO A;  3SHF A;  3V4V A;  4FJH A;  4KHY A;  1UOP A;  3K2O A;  3UKU C;  3AL8 A;  4Y7R A;  3SMR A;  4RG8 A;  2I3S A;  5I5J A;  4BP8 A;  4BH6 A;  3ULE C;  3PXW D;  1FXX A;  3EI1 A;  5H17 A;  3L4O D;  3PXT D;  2P5G A;  4FJN A;  2QXF A;  2H9N A;  4M3U A;  1B9Y A;  3JZN A; 
#chains in the Genus database with same CATH homology
 1MMO G;  2Z2O A;  4FHL A;  4FA5 D;  3MKS B;  4X3E A;  2AGY A;  1MTY G;  4FJL A;  4LG8 A;  5HE0 B;  3JB9 L;  1JJU B;  3TAG A;  5K1C C;  4CZX A;  3NE6 A;  3QEI A;  2UZX B;  3QEP A;  4QNC A;  3NVN A;  3V9F A;  3IJ0 A;  5C2V B;  3UVK A;  5HYN B;  4HCB A;  2UZY B;  4ZN4 A;  2JH9 A;  5GSA A;  3B7F A;  5IRE A;  3E0C A;  4E4B A;  4JXM A;  3SN6 B;  3QEW A;  5IJ7 E;  3NHG A;  1WAF A;  2IAA A;  3C6P B;  5EM2 A;  4DTP A;  2P1N B;  3S9H A;  5FKQ A;  4M3T A;  3C95 A;  2HJ4 A;  4KHQ A;  2OYQ A;  2PBI B;  3KRX B;  4DTM A;  1XU3 E;  1XVC E;  2OVR B;  3OGL B;  4HCC A;  1FZ2 E;  3SVW D;  4DU1 A;  4J0W A;  1NEX B;  4JD2 C;  2LF6 A;  3CFO A;  2J55 H;  2AGX A;  4KHN A;  1LDK E;  2E31 A;  4ZOY A;  4DU4 A;  2P9U C;  4FJG A;  2RCU A;  3HFQ A;  2OJY A;  5CYK B;  2EBS A;  3OL2 A;  3SLE D;  4FA4 D;  4OWR A;  2XYI A;  3TAB A;  3CFV A;  4A08 A;  1MDA H;  3SNN A;  3ODT A;  4O3U B;  4GZ8 A;  2FYO A;  1XMG E;  4XYH A;  3EI2 B;  3GRE A;  3JRP A;  4M3Z A;  2P9S C;  3GFC A;  2H6K A;  3OKY A;  3HGK E;  3FRX A;  3UVO A;  4CI8 A;  3SJJ A;  3C6N B;  5EMM B;  1FZ7 E;  2GC4 A;  3CFS B;  3OTT A;  4R7A B;  1FZH E;  2P1O B;  1FS1 A;  3CFR A;  3LZJ A;  2G99 A;  1FZ3 E;  2P9N C;  4L9O A;  4M3Y A;  3LD8 A;  2I0T A;  5C2W B;  3I7K A;  4X5N A;  3N0E A;  4FJ7 A;  3RFG A;  2HYE A;  5AFU 3;  4M3X A;  2TRC B;  4A2M A;  4J77 A;  1FWX A;  2H9P A;  4JSP C;  4UI9 R;  1FZ4 E;  5EAP A;  3IIW A;  4LGN A;  1MHZ G;  1U4C A;  5JWZ A;  3HL8 A;  4AKH A;  1CLQ A;  3RSE C;  4FWW A;  2B5M A;  2E32 A;  2OZM A;  3I8E A;  2IUV A;  3BWS A;  3EI3 A;  2YB8 B;  4I9Q A;  5CXB A;  2OK6 A;  4PC0 A;  4CZY A;  1FZ9 E;  1Q9X A;  3KRW B;  3KD5 E;  4JSV C;  3I7L A;  1JOF A;  2QC5 A;  5GXI A;  2AQ5 A;  3I7N A;  3J81 g;  3CIK B;  5IGO A;  2Q7Q A;  3PSC B;  3SUP A;  4CI1 A;  4FB1 D;  3TL8 B;  2HKR A;  3LZI A;  2HD0 A;  5IZ7 A;  4FJJ A;  4FAV D;  5EMJ B;  4A7J A;  4GGA A;  3SBR A;  1XVG E;  4KHW A;  3RMD A;  1TBG A;  2MMB A;  1FZ0 E;  3F3F A;  4J78 A;  1GP2 B;  3CQ8 A;  4CZV A;  4DU3 A;  4AEZ A;  3RMZ D;  3UIQ A;  1YFQ A;  1A0R B;  1XVE E;  2I3T A;  3JZG A;  1QNI A;  3AL9 A;  4EWR A;  4D6V A;  4FJK A;  4A11 B;  4E5Z A;  3EU7 A;  4JT5 C;  1FZ6 E;  4X63 B;  2OIZ A;  4FA9 D;  3VH0 A;  2VIX A;  4L3H D;  5IT9 g;  4FK2 A;  2OK4 A;  1PI6 A;  1FZ8 E;  2AGW A;  1XKS A;  2P9K C;  1RI6 A;  2B5L A;  3RWU A;  3C94 A;  2ATQ A;  2XL3 A;  4A0A A;  3K27 A;  4JRQ A;  4A0B A;  3AL8 B;  5AMS A;  3IJC A;  3V7D B;  4QL1 A;  2AH0 A;  4FAN D;  3SUO A;  4J82 A;  2H13 A;  4AKI A;  3J80 g;  3EMH A;  3NAE A;  3TAF A;  4J2D A;  1SQ9 A;  4BL0 A;  5A2Q g;  4ZOX A;  4DTN A;  2P1P B;  3SWS D;  5FXY A;  3N1B A;  4J2A A;  3SPY A;  1GG2 B;  4J73 A;  4O1Q D;  4A2L A;  5GMK n;  4O3T B;  3NVQ A;  4PXW A;  5HE2 B;  3N1E A;  2P5O A;  1JMZ B;  1MHY G;  1IG9 A;  4GGC A;  1TYQ C;  4B08 A;  3IKO A;  3OW8 A;  4ERQ A;  2GNQ A;  3VGZ A;  3OKW A;  4GM3 A;  3HP9 A;  3VA6 A;  2H47 A;  1U2V C;  1IH7 A;  3SQ0 A;  4HDJ A;  4CY2 A;  3NVX A;  1XL3 C;  5IGQ A;  2B7M A;  4A0A B;  3SXT D;  4CY1 A;  4DTX A;  5CXC A;  5EM2 B;  4A0B B;  5THA A;  4A09 B;  1XMH E;  4X60 B;  3L4M D;  1GOT B;  5CXC B;  4OZU A;  4GGD A;  4FJ9 A;  4GQ2 P;  4DTO A;  4KI4 A;  3PE7 A;  1S4U X;  1PEV A;  2CO0 A;  4J8G A;  2P9L C;  4AKG A;  5TEE A;  4ERZ A;  3U4Y A;  4KHU A;  3EWE A;  1SQJ A;  5IBK B;  2JHC A;  2CN2 A;  2YNN A;  3RRM C;  5H37 A;  3SBQ A;  5CYK A;  4JT6 C;  4FA1 D;  4O9D A;  4J2B A;  3MKQ A;  4JRP A;  3SCX A;  1OLZ A;  5TDH B;  5FLX g;  3F3P A;  3OGK B;  4I9L A;  3MZL A;  1XIP A;  4X5M A;  5FKT A;  2J57 G;  4ES0 A;  3EI4 A;  4DTJ A;  3RMA A;  3TJY A;  3PVU B;  3UVN A;  5TEF A;  3L2O B;  4J87 A;  4NSX A;  3QET A;  2YB5 A;  4EPH A;  2IUP A;  3NGI A;  3JAM g;  3OKT A;  2OVQ B;  4M42 A;  4CY3 A;  5FKS A;  2YNO A;  2VJ5 A;  3C5M A;  2BBK H;  1FZI E;  2PM7 B;  3A0F A;  2B5N A;  4XYI A;  1XMF E;  4FJI A;  3C6O B;  3I7H A;  2W18 A;  4XEI C;  3DXK C;  3SVI A;  4GQB B;  2OVP B;  3SI6 A;  4J86 A;  3MZK A;  3I89 A;  4U1E I;  4JS5 A;  1N6E A;  4J79 A;  1MG2 A;  3AH8 B;  2P1Q B;  3WSO A;  4FK4 A;  2AGZ A;  3C75 H;  2FW3 A;  3IJ1 A;  3QER A;  3PSL A;  2H68 A;  4LG9 A;  5EMK B;  3UKR C;  4JSX C;  2PFV A;  3RMB A;  2OZS A;  5I5M A;  1XU5 E;  3IIY A;  2CE9 A;  2CO0 C;  3V5W B;  3QNO A;  3NDK A;  4FVM A;  2MTA H;  2YNP A;  4Z8L A;  4KHS A;  2I0S A;  4IMM A;  4QT8 A;  2HXC A;  4I6J B;  3SBP A;  4AOW A;  1N6F A;  3JZH A;  1NR0 A;  2H3X A;  2B1E A;  4EYW A;  2CNX A;  3SUQ A;  4CI2 A;  2PM9 A;  5SXM A;  2CE8 A;  4QRJ A;  4RL5 A;  3JRO A;  4CI3 A;  3F3G A;  2P9I C;  1R5M A;  5FQD A;  3HGL A;  4CY5 A;  4QQE A;  2PM9 B;  4PBY A;  3QEX A;  4YVD A;  3NCI A;  2AGL A;  4ZOV A;  5B4W A;  3ORV D;  4L3G D;  4PSW B;  1P22 A;  5K19 A;  2IUQ A;  4M45 A;  3J27 A;  4DTS A;  4TZ4 A;  5EAM A;  3DXM C;  2AH1 A;  2Z2P A;  2DTU A;  3P4F A;  1WAJ A;  5CXB B;  4E3S A;  4DTR A;  3LDS A;  5AJA A;  2DEB A;  2QXV A;  4KFM B;  2CN3 A;  4FJX A;  4PSX B;  5I5I A;  3LDB A;  5HE1 B;  3RMC A;  1VYH C;  3BG1 A;  3SQ2 A;  4JSN C;  3QNN A;  2H9L A;  5HQG A;  5IJ8 E;  4PNK B;  2XL2 A;  3J2P A;  3N0D A;  3PVW B;  4CC9 A;  3MXX A;  3L1N A;  3BG0 A;  3OL2 B;  3PXS D;  1FZ5 E;  4FJ8 A;  2HES X;  3CFP A;  3DWL C;  1PGU A;  4GMB A;  1XVB E;  3FGB A;  4K3J B;  4A08 B;  4J2E A;  1SHY B;  2JHP A;  2VJ4 A;  3SJL D;  2H6N A;  4M41 A;  3EI3 B;  4IA9 A;  3EI2 A;  3L0M A;  3SQ1 A;  5IC7 A;  4ESG A;  3OKY B;  4ZOZ A;  1GXR A;  1K32 A;  4H5I A;  3DSM A;  4A11 A;  1ERJ A;  2HKM A;  2IWF A;  1XVD E;  2PM6 B;  2PFT A;  2P9P C;  3K26 A;  3ZWL B;  3DM0 A;  2H9M A;  2YBA A;  5FKR A;  5KDO B;  4J8B A;  3I7O A;  1N6D A;  1FZ1 E;  2B4E A;  4QND A;  3OGM B;  2JH8 A;  2BCJ B;  3AFC A;  5GXH A;  4D0K A;  4K3I D;  4MK0 B;  4GQ1 A;  1JMX B;  4FJ5 A;  5EAR A;  4M3W A;  4E54 A;  1OMW B;  1B9X A;  3UVM A;  2DY4 A;  3MMY A;  3KD1 E;  3E4Y A;  2Z2N A;  5EML B;  4E5Z B;  2HJB A;  1XHM A;  4E54 B;  3RFH A;  2LF3 A;  4GM8 A;  3C99 A;  5EAL A;  4O45 A;  4EP9 A;  3EG6 A;  1MG3 A;  5FA5 B;  5H1M A;  2H14 A;  3QES A;  4N14 A;  1XVF E;  2B8I A;  3EI4 B;  3SUN A;  2P1M B;  4AI6 A;  2H4T A;  2J56 H;  2XU7 A;  3I7P A;  4X61 B;  4KI6 A;  4H5J A;  4JS4 A;  5HE3 B;  4FK0 A;  3C9C A;  4GAM C;  5H14 A;  3SFZ A;  2IUR A;  4PBZ A;  4ERY A;  3I2N A;  1PBY B;  3SCY A;  4A09 A;  4DTU A;  2IWK A;  4J84 A;  3JPX A;  4GM9 A;  3EI1 B;  2H6Q A;  2G9A A;  3SPZ A;  1Q9Y A;  3UR4 A;  4FJM A;  3QEV A;  1Q47 A;  3I8C A;  5TF2 A;  3RN1 D;  2JHA A;  2MZW B;  3L8B A;  1K8K C;  3TAE A;  4G56 B;  3E4W A;  4I79 A;  4L1Q D;  3RLM D;  3RN0 D;  4BUJ C;  3FM0 A;  5C9Z B;  3W15 A;  1L0Q A;  4Y5R D;  2I0R A;  4ADN A;  2JPN A;  4U7A A;  4RNG A;  3UVL A;  1FYZ E;  3SQ4 A;  2YMU A;  4J0X A;  4M3R A;  2O9K A;  4J81 A;  2GC7 A;  4ADO A;  3SHF A;  4FJH A;  4KHY A;  3K2O A;  3UKU C;  3AL8 A;  4Y7R A;  3SMR A;  4RG8 A;  2I3S A;  5I5J A;  4BH6 A;  3ULE C;  3PXW D;  1FXX A;  3EI1 A;  5H17 A;  3L4O D;  3PXT D;  2P5G A;  4FJN A;  2QXF A;  2H9N A;  4M3U A;  1B9Y A;  3JZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...