2OVPB

Structure of the skp1-fbw7 complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
444
structure length
441
Chain Sequence
b'TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 122
structure length 441
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovpB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovpB02
2OK4A 1PI6A 2IUQA 3EI3B 2H9NA 4JT6C 4YVDA 4FAND 2OIZA 4CI2A 4A08B 3BG1A 4L3HD 4QRJA 4HDJA 1NEXB 5IJ8E 5AFU3 1GP2B 4QT8A 3V9FA 5I5JA 3JZHA 3OKYB 2QC5A 4JSNC 3CFSB 5EM2A 4GQ1A 4PNKB 5THAA 4ESGA 5AMSA 2TRCB 3AFCA 4PXWA 3K26A 2OK6A 4ERQA 5IGQA 3HFQA 3VA6A 1MDAH 2YNNA 2H6QA 3UVKA 4L9OA 2OVRB 3OGLB 2H14A 2H9MA 2XU7A 2B4EA 3I7LA 4I79A 3EI3A 1GG2B 3UKRC 2H47A 2CN2A 3KRXB 4GGCA 4D0KA 5HE3B 4J0WA 5FKRA 4A08A 4JD2C 5H14A 3SN6B 2YBAA 4KFMB 3JZGA 2PM9B 4A7JA 3JRPA 4ERZA 3PXWD 3I7PA 5GXHA 4IMMA 1TYQC 3EI2A 3SJLD 2P9LC 3OKYA 4X3EA 2OVQB 3F3PA 5HE0B 2BCJB 5CXCA 2HKRA 5FA5B 3IJCA 4PSXB 4EWRA 2OJYA 4ZN4A 3PXSD 4JSPC 4J84A 3SLED 4GM8A 3F3GA 4UI9R 4CY5A 3DSMA 2B5LA 5FQDA 2GNQA 3IIYA 3C6NB 4LGNA 1FWXA 2I0RA 3IJ1A 3AH8B 2HJ4A 2CNXA 3DWLC 2AH0A 3L4MD 2H9PA 2H3XA 3SBQA 3SBRA 5IJ7E 1JJUB 4H5JA 4CI3A 1Q47A 3RN0D 1N6DA 3IJ0A 1U4CA 4GQBB 4J87A 2PM9A 2IUVA 4CZYA 4LG8A 3ODTA 3RFGA 3I89A 1K8KC 3SHFA 3CFVA 2B5NA 4PBYA 3A0FA 3WSOA 4CZVA 1N6FA 5EMKB 3EI1B 3SXTD 4E5ZB 3DXMC 5EMMB 5FKSA 4X61B 3DXKC 3FGBA 3UVOA 5K19A 3VH0A 3AL8A 2AGZA 2CN3A 2PM6B 3PXTD 2Z2NA 4A11B 5EARA 4J86A 5I5IA 2P9SC 1MG2A 5B4WA 3P4FA 2E32A 5TEFA 2Q7QA 4GM9A 1PBYB 2I0SA 1P22A 4BH6A 3U4YA 5I5MA 3K27A 4MK0B 4FAVD 2PBIB 3OW8A 3SCYA 2HXCA 1S4UX 5TF2A 3PVUB 2AQ5A 3KRWB 3V7DB 4R7AB 3MZLA 5C2VB 2YMUA 1SQJA 3EI1A 3C6OB 5HE2B 2P9IC 1VYHC 2W18A 2HYEA 4GQ2P 2BBKH 3OKTA 4A11A 5JWZA 4A09B 4OZUA 5IBKB 3EI4B 4FHLA 3NVXA 4K3ID 4X63B 4GM3A 4JXMA 5IT9g 1YFQA 2G9AA 2IWKA 3PSLA 3ULEC 3JZNA 3RN1D 4QQEA 4U7AA 4CY1A 2AH1A 3MKQA 3BG0A 1XIPA 5EAPA 2XYIA 3OTTA 4GZ8A 4FA1D 4O45A 2H6KA 2P9PC 5HQGA 3UVNA 4ZOZA 2HKMA 1QNIA 4O1QD 4JSXC 4A0BB 5TEEA 2AGXA 4J8GA 4O9DA 1SHYB 3V5WB 3GFCA 4ZOYA 1GXRA 4FB1D 3EWEA 3EI4A 3I7OA 3OGMB 3I8CA 4CY3A 4OWRA 4ES0A 5FKQA 2UZYB 4N14A 5CYKB 4D6VA 4XYIA 5CXBB 4GGDA 2H13A 1R5MA 2YNOA 3RLMD 1GOTB 1JOFA 2O9KA 5GSAA 3FM0A 4I6JB 4K3JB 4Y5RD 3JPXA 2YNPA 2H9LA 3SMRA 3J80g 2E31A 4H5IA 4CI1A 3ZWLB 3E0CA 5IC7A 1OMWB 4A0BA 1U2VC 3GREA 2AGLA 5H17A 4FA9D 3UKUC 4XEIC 2J56H 4PBZA 3CIKB 2P1MB 5HYNB 4J78A 3SWSD 4BL0A 4ZOXA 2MTAH 5AJAA 4E54B 3NVQA 3DM0A 3EU7A 4CI8A 3OKWA 5CYKA 3L4OD 3F3FA 2P9KC 1MG3A 4NSXA 2EBSA 3OL2B 3ORVD 3I7KA 4J8BA 4BUJC 2G99A 4CC9A 3VGZA 5K1CC 5FLXg 4A2MA 2I0TA 4L3GD 4LG9A 2IAAA 4PC0A 1SQ9A 4J0XA 3SBPA 3N0EA 4FA4D 4E5ZA 5IGOA 2AGWA 2HESX 2J57G 3EI2B 4XYHA 2UZXB 2AGYA 4ZOVA 2CE8A 3BWSA 4A2LA 5GXIA 2IUPA 4CZXA 5CXCB 4A0AB 1B9XA 3MZKA 3B7FA 1XHMA 5HE1B 4E54A 3I2NA 3MKSB 3N0DA 3EMHA 3FRXA 4Z8LA 3JROA 3NVNA 4J81A 3C99A 4X60B 4J82A 5KDOB 4O3UB 3UVMA 2B5MA 3OL2A 1B9YA 2QXVA 3SFZA 2P1NB 5FXYA 1ERJA 3C6PB 3MXXA 2I3TA 4JT5C 2IWFA 2H68A 3IIWA 4G56B 4GGAA 3UVLA 3C75H 3W15A 3RRMC 2I3SA 2GC4A 2HJBA 1PGUA 3PSCB 3JAMg 3RMZD 2XL3A 3UR4A 2YB8B 3I7NA 1NR0A 2P9NC 5H1MA 5GMKn 4A09A 3RSEC 4A0AA 5EALA 4CY2A 2XL2A 3MMYA 1JMXB 2H6NA 1JMZB 5SXMA 1LDKE 3JB9L 2CO0C 2P1PB 2CO0A 4L1QD 3IKOA 3J81g 1N6EA 1OLZA 3PVWB 2P1OB 3AL8B 4JSVC 1XKSA 4J77A 1L0QA 4AEZA 4U1EI 5A2Qg 5EMLB 2PM7B 4AOWA 4TZ4A 3RFHA 4PSWB 4O3TB 4GMBA 2CE9A 3I7HA 1RI6A 1PEVA 3C5MA 2P9UC 2Z2PA 2J55H 4FA5D 1FS1A 1TBGA 4ERYA 5EM2B 2OVPB 2P1QB 5C9ZB 3PE7A 4QL1A 4Y7RA 3AL9A 3SVWD 3OGKB 1A0RB 2GC7A 1K32A 4IA9A 4FWWA 5FKTA 4J79A 5CXBA 5TDHB 3C9CA 5EMJB 2IURA 5C2WB 3EG6A 3L2OB 4J73A 3I8EA 5EAMA 2Z2OA
chains in the Genus database with same CATH superfamily
2OK4A 1PI6A 2IUQA 3T3MA 5M5TA 3EI3B 2H9NA 4JT6C 5E6RA 2JKXA 4YVDA 4FAND 5E6UA 2OIZA 4CI2A 4A08B 3BG1A 1FZ4E 4FJJA 4KI6A 4G1MA 4HDJA 4L3HD 4QRJA 1FZHE 1NEXB 5IJ8E 3V4PA 3K72A 5AFU3 3DDUA 1GP2B 2B8IA 2JH8A 5M5UA 3HP9A 1C9LA 2HD0A 2VDKA 4QT8A 3V9FA 4J2BA 1FZ8E 3JZHA 5I5JA 3OKYB 2QC5A 4JSNC 3CFSB 3C95A 5EM2A 4GQ1A 4PNKB 4M41A 3SCXA 5THAA 1GOGA 4ESGA 3SNNA 5AMSA 2TRCB 3AFCA 4PXWA 1JTDB 4WK2A 2DY4A 4BP9A 3K26A 1JV2A 4B08A 2OK6A 4ERQA 3SUPA 3SPZA 4L1MA 2HU8A 5IGQA 3HFQA 3VA6A 3QI0A 3N1EA 1XVBE 4AMZA 4E4BA 1MDAH 2YNNA 2H6QA 3T3PA 3UVKA 4FJGA 4L9OA 2OVRB 3OGLB 2H14A 2H9MA 2XU7A 2B4EA 3I7LA 4I79A 4NC4A 3EI3A 1GG2B 1VE7A 3UKRC 4FJXA 2CN2A 2H47A 3KRXB 4GGCA 4D0KA 3EQ7A 5HE3B 4J0WA 5FKRA 4A08A 4JD2C 5H14A 3SN6B 1XL3C 2YBAA 4IRZA 4KFMB 2VC2A 2PM9B 3JZGA 3JRPA 4A7JA 4ERZA 3PXWD 1FZ2E 3I7PA 2RCUA 3IURA 4D9SA 5GXHA 3UO3A 2JH9A 4ADNA 1TYQC 4IMMA 4NBMA 5M5VA 1MHZG 3EI2A 3SJLD 3UIQA 2P9LC 3OKYA 4Z7NA 2VJ4A 4X3EA 2OVQB 3F3PA 5HE0B 1N1CA 1FPOA 2BCJB 4DU4A 5CXCA 4FJ9A 2HKRA 4IT5A 5FA5B 3IJCA 1XVDE 3RWUA 4PSXB 3QEXA 4KHNA 3QHYB 1IH7A 3ZDXA 4EWRA 2P5GA 2OJYA 2DTUA 4ZN4A 3PXSD 1FZ5E 4JSPC 3O4IA 4J84A 1O6GA 3SLED 4GM8A 3F3GA 4UI9R 1UOOA 3NGIA 4CY5A 3DSMA 2B5LA 5FQDA 4G1EA 2GNQA 3IIYA 3C6NB 3UO2A 3QEWA 4J2AA 4LGNA 1FWXA 2I0RA 3IJ1A 4RE5A 3LZIA 3AH8B 2HJ4A 4JHPC 2CNXA 3DWLC 2AH0A 3L4MD 1FZ6E 1XMGE 2H9PA 2H3XA 3SBQA 3SBRA 4O2WA 2MMBA 3E4YA 3HGKE 5IJ7E 2XDWA 3V4VA 1JJUB 4H5JA 3QETA 3RMAA 4FJLA 1Q47A 3L8BA 4CI3A 5IREA 3RN0D 1N6DA 3IJ0A 1U4CA 4M3ZA 4GQBB 4J87A 2PM9A 3C94A 2IUVA 4CZYA 4LG8A 3ODTA 3RFGA 1M1XA 3I89A 1K8KC 3SHFA 4RNGA 3SUOA 3TJYA 1QFSA 4UM8A 3SPYA 3CFVA 2B5NA 4PBYA 3A0FA 3IVMA 2EIBA 3WSOA 4CZVA 3TAFA 1L5GA 1N6FA 5EMKB 1O6FA 3EI1B 2VIXA 3SXTD 4Z7QA 3DXMC 3IUQA 4E5ZB 5EMMB 5FKSA 4X61B 3DXKC 3QNOA 3FGBA 3UVOA 5K19A 3VH0A 3O4JA 3AL8A 1QFMA 1XVEE 2AGZA 2CN3A 2PM6B 3PXTD 4BCDA 2Z2NA 4AN1A 3NHGA 4FK2A 2HU5A 4M3RA 4M3XA 4A11B 5EARA 4NAAA 3QEVA 4J86A 5I5IA 3K2OA 5H37A 2P9SC 1MG2A 1VZ3A 3IUNA 3O4GA 3P4FA 5B4WA 3VI3A 4WK4A 2E32A 4AN0A 1FZ7E 2LF6A 5TEFA 2VDPA 5M5SA 4X5MA 2Q7QA 4GM9A 1PBYB 2I0SA 3K71A 1P22A 2WQ8A 4BH6A 3SQ1A 3U4YA 5I5MA 1XMFE 3K27A 4MK0B 3NAEA 2P5OA 4FAVD 4DNVA 3SUQA 2PBIB 1FZ1E 1FZ3E 3OW8A 1FZ0E 3TABA 3NE6A 3SCYA 4JRQA 4DTNA 2HXCA 4DTSA 5C86A 3CFPA 4MMYA 1S4UX 3LZJA 5TF2A 3PVUB 2JHPA 2AQ5A 2VDNA 3KRWB 3V7DB 4M3UA 1VZ2A 4R7AB 3FCSA 3MZLA 5C2VB 2YMUA 4FJMA 1SQJA 5M5RA 3ZDZA 3EI1A 3C6OB 5FFGA 5HE2B 4Z7OA 2P9IC 1VYHC 4M3WA 2QXFA 2W18A 3LDSA 2HYEA 1E8NA 4GQ2P 2BBKH 3OKTA 2B7MA 4EYWA 4AKHA 4A11A 5JWZA 4A09B 1BPOA 4OZUA 5IBKB 3EI4B 4FHLA 1FZIE 3NVXA 4K3ID 4X63B 4GM3A 3IJEA 4KHWA 4JXMA 5FFOA 5IT9g 3HL8A 1UOQA 1YFQA 2OZMA 2G9AA 3IULA 2OZSA 4O02A 2IWKA 4J2DA 3PSLA 3ULEC 3JZNA 3RN1D 3IUJA 4QQEA 5E6SA 4U7AA 4CY1A 2MZWB 2AH1A 3MKQA 3BG0A 1I2MB 2BKLA 4WJKA 4FJKA 2JHAA 1XIPA 4M42A 5EAPA 2XYIA 2VDMA 3OTTA 4GZ8A 4FA1D 4O45A 2H6KA 4ICGC 3J27A 2P9PC 2EIDA 3ZDYA 4DTPA 4DTUA 4BCCA 5HQGA 3CFOA 3UVNA 4ZOZA 2OYQA 2HKMA 3E4WA 4JS5A 1QNIA 4RG8A 4O1QD 2VZ3A 4JSXC 4A0BB 4AI6A 5C92A 3EQ8A 5TEEA 2FW3A 1H2YA 1MMOG 2AGXA 4J8GA 4O9DA 1SHYB 3NIDA 3V5WB 3GFCA 4ZOYA 1GXRA 4FB1D 3EWEA 3EI4A 1YR2A 3I7OA 3OGMB 3SI6A 3I8CA 2ATQA 4CY3A 4OWRA 4ES0A 5FKQA 2UZYB 2VDQA 4N14A 5CYKB 4XYIA 2XZGA 4QNCA 5CXBB 4D6VA 4JS4A 4GGDA 2H13A 1R5MA 2YNOA 3VI4A 3RLMD 1GOTB 4ADOA 5IZ7A 3QNNA 1JOFA 2O9KA 5GSAA 4AKIA 3FM0A 4FJ8A 4I6JB 3MUOA 4K3JB 4Y5RD 3JPXA 1E5TA 4JHNA 2YNPA 3CQ8A 1UTCA 2H9LA 4RL5A 1XVFE 3SQ4A 3SMRA 3J80g 3LD8A 2E31A 4MMZA 4E3SA 2B1EA 4H5IA 4I9LA 2VJ5A 4FJHA 4CI1A 3ZWLB 2VDRA 4FVMA 3E0CA 4KHQA 5IC7A 1GOFA 1OMWB 4A0BA 1U2VC 3GREA 2AGLA 3OF7A 5H17A 4FA9D 3UKUC 4XEIC 2J56H 4PBZA 3CIKB 1Q9YA 2P1MB 5HYNB 2DEBA 3HGLA 3SVIA 4J78A 3SWSD 4BL0A 4MMXA 2XE4A 4ZOXA 3BVOA 4DU3A 2PFVA 1CLQA 2MTAH 2FYOA 5AJAA 4E54B 3NVQA 1K3IA 3DM0A 4DNWA 3MUNA 3ZE1A 3EU7A 3NIFA 4CI8A 3QESA 3OKWA 2JPNA 5CYKA 4FK4A 3L4OD 3F3FA 4DU1A 2P9KC 4HCBA 1MG3A 2QR5A 4FJIA 4NSXA 4DTMA 4M3TA 4QAMA 3QERA 2EBSA 3OL2B 2VDLA 3I7KA 3ORVD 4J8BA 1XVCE 2G99A 4BUJC 4CC9A 3VGZA 5K1CC 4BCBA 5FLXg 4A2MA 4J2EA 2I0TA 4L3GD 4LG9A 2IAAA 4PC0A 4EP9A 4M45A 1SQ9A 4J0XA 4AMYA 1XVGE 3J2PA 2YB5A 3SBPA 3N0EA 4FA4D 4E5ZA 5IGOA 2AGWA 3RMBA 4KHSA 2HESX 1WAJA 3SUNA 2J57G 3EI2B 4XYHA 2UZXB 2EIEA 1MTYG 2H4TA 3LDBA 2AGYA 2CE8A 3BWSA 4WK0A 4ZOVA 4A2LA 5GXIA 1E8MA 3L0MA 2IUPA 4CZXA 5CXCB 4A0AB 1B9XA 2HU7A 2JHCA 4KHUA 3B7FA 3MZKA 1XHMA 5HE1B 4E54A 3I2NA 3MKSB 4HCCA 4FK0A 3N0DA 3L1NA 3EMHA 4FJNA 3FRXA 4Z8LA 3QEIA 3ZE0A 3JROA 3NVNA 4J81A 1Q9XA 3C99A 4KI4A 4X60B 2PFTA 3NIGA 4J82A 5KDOB 3N1BA 2RKHA 4O3UB 3NCIA 3UVMA 2B5MA 3OL2A 1B9YA 2QXVA 4DTJA 3KCIA 3SFZA 3UVLA 1MHYG 1XU3E 2P1NB 5HDBA 2K5SA 5FXYA 1TYEA 4DNUA 1ERJA 4DTXA 3C6PB 3MXXA 2I3TA 2IWFA 4DTRA 2H68A 3IIWA 1FZ9E 4G56B 4GGAA 3C75H 4JT5C 3NDKA 2I3SA 3RRMC 3W15A 2LF3A 3KD5E 2GC4A 2HJBA 1PGUA 3PSCB 3RMCA 3JAMg 3RMZD 2XL3A 3UR4A 2YB8B 4EPHA 3I7NA 4G55A 1H2WA 1NR0A 2P9NC 5H1MA 5GMKn 4A09A 3MVDK 3RSEC 4A0AA 5EALA 3SQ2A 4CY2A 1JMXB 2H6NA 2XL2A 1JMZB 3MMYA 5SXMA 1LDKE 3ZE2A 3JB9L 2CO0C 1U8CA 1H2ZA 2P1PB 1FYZE 4UM9A 4QNDA 2CO0A 4L1QD 3EQ9A 3IKOA 3TAGA 3J81g 4I9QA 1N6EA 1OLZA 3PVWB 2JQTA 2P1OB 3AL8B 4JSVC 2MW2A 2VZ1A 1XKSA 2VDOA 4J77A 1L0QA 4AEZA 1JW2A 1XMHE 3SQ0A 1FXXA 3K6SA 4U1EI 5A2Qg 4AKGA 3KD1E 4FJ5A 3GD1I 5EMLB 4BP8A 2PM7B 1VE6A 4TZ4A 3RFHA 4AOWA 4GAMC 4PSWB 4O3TB 4GMBA 2CE9A 3I7HA 1RI6A 1A12A 4X5NA 1PEVA 3C5MA 3S9HA 1IG9A 1C9IA 2P9UC 4DTOA 2Z2PA 2J55H 4FA5D 3GC3B 4FJ7A 1FS1A 3IUMA 4NENA 1T2XA 1TBGA 3O4HA 4ERYA 3CFRA 5EM2B 2OVPB 1H2XA 2P1QB 3RMDA 4M3YA 5C9ZB 3PE7A 2QZPA 4QL1A 4Y7RA 3AL9A 3SVWD 2EICA 3FCUA 3OGKB 1A0RB 2GC7A 1K32A 3SJJA 3TAEA 4RE6A 3QEPA 5M61A 4IA9A 4FWWA 1WAFA 5FKTA 4J79A 5CXBA 1XU5E 5TDHB 4AX4A 4JRPA 3C9CA 1UOPA 5EMJB 2IURA 3TL8B 3EG6A 5C2WB 3L2OB 4J73A 3I8EA 5EAMA 4KHYA 1GOHA 2Z2OA
chains in the Genus database with same CATH topology
2OK4A 1PI6A 2IUQA 3EI3B 2H9NA 4JT6C 4YVDA 4FAND 2OIZA 4CI2A 4A08B 3BG1A 1FZ4E 4FJJA 4KI6A 4L3HD 4HDJA 4QRJA 1FZHE 1NEXB 5IJ8E 5AFU3 1GP2B 2B8IA 2JH8A 3HP9A 2HD0A 4QT8A 3V9FA 4J2BA 1FZ8E 3JZHA 5I5JA 3OKYB 2QC5A 4JSNC 3CFSB 3C95A 5EM2A 4GQ1A 4PNKB 4M41A 3SCXA 5THAA 4ESGA 3SNNA 5AMSA 2TRCB 3AFCA 4PXWA 2DY4A 3K26A 4B08A 2OK6A 4ERQA 3SUPA 3SPZA 5IGQA 3HFQA 3VA6A 3N1EA 1XVBE 4E4BA 1MDAH 2YNNA 2H6QA 3UVKA 4FJGA 4L9OA 2OVRB 3OGLB 2H14A 2H9MA 2XU7A 2B4EA 3I7LA 4I79A 3EI3A 1GG2B 3UKRC 4FJXA 2CN2A 2H47A 3KRXB 4GGCA 4D0KA 5HE3B 4J0WA 5FKRA 4A08A 4JD2C 5H14A 3SN6B 1XL3C 2YBAA 4KFMB 3JZGA 2PM9B 4A7JA 3JRPA 4ERZA 3PXWD 1FZ2E 3I7PA 2RCUA 5GXHA 2JH9A 4ADNA 1TYQC 4IMMA 3EI2A 1MHZG 3SJLD 3UIQA 2P9LC 3OKYA 2VJ4A 4X3EA 2OVQB 3F3PA 5HE0B 2BCJB 4DU4A 5CXCA 4FJ9A 2HKRA 5FA5B 3IJCA 1XVDE 3RWUA 4PSXB 3QEXA 4KHNA 4EWRA 1IH7A 2P5GA 2OJYA 2DTUA 4ZN4A 3PXSD 1FZ5E 4JSPC 4J84A 3SLED 4GM8A 3F3GA 4UI9R 3NGIA 4CY5A 3DSMA 2B5LA 5FQDA 2GNQA 3IIYA 3C6NB 4LGNA 3QEWA 4J2AA 1FWXA 2I0RA 3IJ1A 3LZIA 3AH8B 2HJ4A 2CNXA 3DWLC 2AH0A 3L4MD 1FZ6E 1XMGE 2H9PA 2H3XA 3SBQA 3SBRA 2MMBA 3E4YA 3HGKE 5IJ7E 1JJUB 4H5JA 3QETA 3RMAA 4FJLA 1Q47A 3L8BA 4CI3A 5IREA 3RN0D 1N6DA 3IJ0A 1U4CA 4M3ZA 4GQBB 4J87A 2PM9A 3C94A 2IUVA 4CZYA 4LG8A 3ODTA 3RFGA 3I89A 1K8KC 3SHFA 4RNGA 3SUOA 3TJYA 3SPYA 3CFVA 2B5NA 4PBYA 3A0FA 3WSOA 4CZVA 3TAFA 1N6FA 5EMKB 3EI1B 2VIXA 3SXTD 4E5ZB 3DXMC 5EMMB 5FKSA 4X61B 3DXKC 3QNOA 3FGBA 3UVOA 5K19A 3VH0A 3AL8A 1XVEE 2AGZA 2CN3A 2PM6B 3PXTD 2Z2NA 3NHGA 4FK2A 4M3RA 4M3XA 4A11B 5EARA 3QEVA 4J86A 5I5IA 3K2OA 5H37A 2P9SC 1MG2A 5B4WA 3P4FA 2E32A 1FZ7E 2LF6A 5TEFA 4X5MA 2Q7QA 4GM9A 1PBYB 2I0SA 1P22A 4BH6A 3U4YA 3SQ1A 5I5MA 1XMFE 3K27A 4MK0B 3NAEA 2P5OA 4FAVD 3SUQA 2PBIB 1FZ1E 1FZ3E 3OW8A 1FZ0E 3TABA 3NE6A 3SCYA 4JRQA 4DTNA 2HXCA 4DTSA 3CFPA 1S4UX 3LZJA 5TF2A 3PVUB 2JHPA 2AQ5A 3KRWB 3V7DB 4M3UA 4R7AB 3MZLA 5C2VB 2YMUA 4FJMA 1SQJA 3EI1A 3C6OB 5HE2B 2P9IC 1VYHC 4M3WA 2QXFA 2W18A 3LDSA 2HYEA 4GQ2P 2BBKH 3OKTA 2B7MA 4EYWA 4AKHA 4A11A 5JWZA 4A09B 4OZUA 5IBKB 3EI4B 4FHLA 1FZIE 3NVXA 4K3ID 4X63B 4GM3A 4KHWA 4JXMA 5IT9g 3HL8A 1YFQA 2OZMA 2G9AA 2OZSA 2IWKA 4J2DA 3PSLA 3ULEC 3JZNA 3RN1D 4QQEA 4U7AA 4CY1A 2MZWB 2AH1A 3MKQA 3BG0A 4FJKA 2JHAA 1XIPA 4M42A 5EAPA 2XYIA 3OTTA 4GZ8A 4FA1D 4O45A 2H6KA 3J27A 2P9PC 4DTPA 4DTUA 5HQGA 3CFOA 3UVNA 4ZOZA 2OYQA 2HKMA 3E4WA 4JS5A 1QNIA 4RG8A 4O1QD 4JSXC 4A0BB 4AI6A 5TEEA 2FW3A 1MMOG 2AGXA 4J8GA 4O9DA 1SHYB 3V5WB 3GFCA 4ZOYA 1GXRA 4FB1D 3EWEA 3EI4A 3I7OA 3OGMB 3SI6A 3I8CA 2ATQA 4CY3A 4OWRA 4ES0A 5FKQA 2UZYB 4N14A 5CYKB 4D6VA 4XYIA 5CXBB 4QNCA 4JS4A 4GGDA 2H13A 1R5MA 2YNOA 3RLMD 1GOTB 4ADOA 5IZ7A 3QNNA 1JOFA 2O9KA 5GSAA 4AKIA 3FM0A 4FJ8A 4I6JB 4K3JB 4Y5RD 3JPXA 2YNPA 3CQ8A 2H9LA 4RL5A 1XVFE 3SQ4A 3SMRA 3J80g 3LD8A 2E31A 4E3SA 2B1EA 4H5IA 4I9LA 2VJ5A 4FJHA 4CI1A 3ZWLB 4FVMA 3E0CA 4KHQA 5IC7A 1OMWB 4A0BA 1U2VC 3GREA 2AGLA 5H17A 4FA9D 3UKUC 4XEIC 2J56H 4PBZA 3CIKB 1Q9YA 2P1MB 5HYNB 2DEBA 3HGLA 3SVIA 4J78A 3SWSD 4BL0A 4ZOXA 4DU3A 2PFVA 1CLQA 2MTAH 2FYOA 5AJAA 4E54B 3NVQA 3DM0A 3EU7A 4CI8A 3QESA 3OKWA 2JPNA 5CYKA 4FK4A 3L4OD 3F3FA 4DU1A 2P9KC 4HCBA 1MG3A 4FJIA 4NSXA 4DTMA 4M3TA 3QERA 2EBSA 3OL2B 3ORVD 3I7KA 4J8BA 4BUJC 1XVCE 2G99A 4CC9A 3VGZA 5K1CC 5FLXg 4A2MA 4J2EA 2I0TA 4L3GD 4LG9A 2IAAA 4PC0A 1SQ9A 4EP9A 4M45A 4J0XA 1XVGE 3J2PA 2YB5A 3SBPA 3N0EA 4FA4D 4E5ZA 5IGOA 2AGWA 3RMBA 4KHSA 2HESX 1WAJA 3SUNA 2J57G 3EI2B 4XYHA 2UZXB 1MTYG 2H4TA 3LDBA 2AGYA 2CE8A 3BWSA 4ZOVA 4A2LA 5GXIA 3L0MA 2IUPA 4CZXA 5CXCB 4A0AB 1B9XA 2JHCA 4KHUA 3B7FA 3MZKA 1XHMA 5HE1B 4E54A 3I2NA 3MKSB 4HCCA 4FK0A 3N0DA 3L1NA 3EMHA 4FJNA 3FRXA 4Z8LA 3QEIA 3JROA 3NVNA 4J81A 1Q9XA 3C99A 4KI4A 4X60B 2PFTA 4J82A 5KDOB 3N1BA 4O3UB 3NCIA 3UVMA 2B5MA 3OL2A 1B9YA 2QXVA 4DTJA 3SFZA 3UVLA 1MHYG 1XU3E 2P1NB 5FXYA 1ERJA 4DTXA 3C6PB 3MXXA 2I3TA 2IWFA 4DTRA 2H68A 3IIWA 1FZ9E 4G56B 4GGAA 3C75H 4JT5C 3NDKA 2I3SA 3RRMC 3W15A 2LF3A 3KD5E 2GC4A 2HJBA 1PGUA 3PSCB 3RMCA 3JAMg 3RMZD 2XL3A 3UR4A 2YB8B 4EPHA 3I7NA 1NR0A 2P9NC 5H1MA 5GMKn 4A09A 3RSEC 4A0AA 5EALA 3SQ2A 4CY2A 1JMXB 2H6NA 2XL2A 1JMZB 3MMYA 5SXMA 1LDKE 3JB9L 2CO0C 2P1PB 1FYZE 4QNDA 2CO0A 4L1QD 3IKOA 3TAGA 3J81g 4I9QA 1N6EA 1OLZA 3PVWB 2P1OB 3AL8B 4JSVC 1XKSA 4J77A 1L0QA 4AEZA 1XMHE 3SQ0A 1FXXA 4U1EI 5A2Qg 4AKGA 3KD1E 4FJ5A 5EMLB 2PM7B 4AOWA 4TZ4A 3RFHA 4GAMC 4PSWB 4O3TB 4GMBA 2CE9A 3I7HA 1RI6A 4X5NA 1PEVA 3C5MA 3S9HA 1IG9A 2P9UC 4DTOA 2Z2PA 2J55H 4FA5D 4FJ7A 1FS1A 1TBGA 4ERYA 3CFRA 5EM2B 2OVPB 2P1QB 3RMDA 4M3YA 5C9ZB 3PE7A 4QL1A 4Y7RA 3AL9A 3SVWD 3OGKB 1A0RB 2GC7A 1K32A 3SJJA 3TAEA 3QEPA 4IA9A 4FWWA 1WAFA 5FKTA 4J79A 5CXBA 1XU5E 5TDHB 4JRPA 3C9CA 5EMJB 2IURA 3TL8B 3EG6A 5C2WB 3L2OB 4J73A 3I8EA 5EAMA 4KHYA 2Z2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 A;  1PI6 A;  2IUQ A;  3EI3 B;  2H9N A;  4JT6 C;  4YVD A;  4FAN D;  2OIZ A;  4CI2 A;  4A08 B;  3BG1 A;  4L3H D;  4QRJ A;  4HDJ A;  1NEX B;  5IJ8 E;  5AFU 3;  1GP2 B;  4QT8 A;  3V9F A;  5I5J A;  3JZH A;  3OKY B;  2QC5 A;  4JSN C;  3CFS B;  5EM2 A;  4GQ1 A;  4PNK B;  5THA A;  4ESG A;  5AMS A;  2TRC B;  3AFC A;  4PXW A;  3K26 A;  2OK6 A;  4ERQ A;  5IGQ A;  3HFQ A;  3VA6 A;  1MDA H;  2YNN A;  2H6Q A;  3UVK A;  4L9O A;  2OVR B;  3OGL B;  2H14 A;  2H9M A;  2XU7 A;  2B4E A;  3I7L A;  4I79 A;  3EI3 A;  1GG2 B;  3UKR C;  2H47 A;  2CN2 A;  3KRX B;  4GGC A;  4D0K A;  5HE3 B;  4J0W A;  5FKR A;  4A08 A;  4JD2 C;  5H14 A;  3SN6 B;  2YBA A;  4KFM B;  3JZG A;  2PM9 B;  4A7J A;  3JRP A;  4ERZ A;  3PXW D;  3I7P A;  5GXH A;  4IMM A;  1TYQ C;  3EI2 A;  3SJL D;  2P9L C;  3OKY A;  4X3E A;  2OVQ B;  3F3P A;  5HE0 B;  2BCJ B;  5CXC A;  2HKR A;  5FA5 B;  3IJC A;  4PSX B;  4EWR A;  2OJY A;  4ZN4 A;  3PXS D;  4JSP C;  4J84 A;  3SLE D;  4GM8 A;  3F3G A;  4UI9 R;  4CY5 A;  3DSM A;  2B5L A;  5FQD A;  2GNQ A;  3IIY A;  3C6N B;  4LGN A;  1FWX A;  2I0R A;  3IJ1 A;  3AH8 B;  2HJ4 A;  2CNX A;  3DWL C;  2AH0 A;  3L4M D;  2H9P A;  2H3X A;  3SBQ A;  3SBR A;  5IJ7 E;  1JJU B;  4H5J A;  4CI3 A;  1Q47 A;  3RN0 D;  1N6D A;  3IJ0 A;  1U4C A;  4GQB B;  4J87 A;  2PM9 A;  2IUV A;  4CZY A;  4LG8 A;  3ODT A;  3RFG A;  3I89 A;  1K8K C;  3SHF A;  3CFV A;  2B5N A;  4PBY A;  3A0F A;  3WSO A;  4CZV A;  1N6F A;  5EMK B;  3EI1 B;  3SXT D;  4E5Z B;  3DXM C;  5EMM B;  5FKS A;  4X61 B;  3DXK C;  3FGB A;  3UVO A;  5K19 A;  3VH0 A;  3AL8 A;  2AGZ A;  2CN3 A;  2PM6 B;  3PXT D;  2Z2N A;  4A11 B;  5EAR A;  4J86 A;  5I5I A;  2P9S C;  1MG2 A;  5B4W A;  3P4F A;  2E32 A;  5TEF A;  2Q7Q A;  4GM9 A;  1PBY B;  2I0S A;  1P22 A;  4BH6 A;  3U4Y A;  5I5M A;  3K27 A;  4MK0 B;  4FAV D;  2PBI B;  3OW8 A;  3SCY A;  2HXC A;  1S4U X;  5TF2 A;  3PVU B;  2AQ5 A;  3KRW B;  3V7D B;  4R7A B;  3MZL A;  5C2V B;  2YMU A;  1SQJ A;  3EI1 A;  3C6O B;  5HE2 B;  2P9I C;  1VYH C;  2W18 A;  2HYE A;  4GQ2 P;  2BBK H;  3OKT A;  4A11 A;  5JWZ A;  4A09 B;  4OZU A;  5IBK B;  3EI4 B;  4FHL A;  3NVX A;  4K3I D;  4X63 B;  4GM3 A;  4JXM A;  5IT9 g;  1YFQ A;  2G9A A;  2IWK A;  3PSL A;  3ULE C;  3JZN A;  3RN1 D;  4QQE A;  4U7A A;  4CY1 A;  2AH1 A;  3MKQ A;  3BG0 A;  1XIP A;  5EAP A;  2XYI A;  3OTT A;  4GZ8 A;  4FA1 D;  4O45 A;  2H6K A;  2P9P C;  5HQG A;  3UVN A;  4ZOZ A;  2HKM A;  1QNI A;  4O1Q D;  4JSX C;  4A0B B;  5TEE A;  2AGX A;  4J8G A;  4O9D A;  1SHY B;  3V5W B;  3GFC A;  4ZOY A;  1GXR A;  4FB1 D;  3EWE A;  3EI4 A;  3I7O A;  3OGM B;  3I8C A;  4CY3 A;  4OWR A;  4ES0 A;  5FKQ A;  2UZY B;  4N14 A;  5CYK B;  4D6V A;  4XYI A;  5CXB B;  4GGD A;  2H13 A;  1R5M A;  2YNO A;  3RLM D;  1GOT B;  1JOF A;  2O9K A;  5GSA A;  3FM0 A;  4I6J B;  4K3J B;  4Y5R D;  3JPX A;  2YNP A;  2H9L A;  3SMR A;  3J80 g;  2E31 A;  4H5I A;  4CI1 A;  3ZWL B;  3E0C A;  5IC7 A;  1OMW B;  4A0B A;  1U2V C;  3GRE A;  2AGL A;  5H17 A;  4FA9 D;  3UKU C;  4XEI C;  2J56 H;  4PBZ A;  3CIK B;  2P1M B;  5HYN B;  4J78 A;  3SWS D;  4BL0 A;  4ZOX A;  2MTA H;  5AJA A;  4E54 B;  3NVQ A;  3DM0 A;  3EU7 A;  4CI8 A;  3OKW A;  5CYK A;  3L4O D;  3F3F A;  2P9K C;  1MG3 A;  4NSX A;  2EBS A;  3OL2 B;  3ORV D;  3I7K A;  4J8B A;  4BUJ C;  2G99 A;  4CC9 A;  3VGZ A;  5K1C C;  5FLX g;  4A2M A;  2I0T A;  4L3G D;  4LG9 A;  2IAA A;  4PC0 A;  1SQ9 A;  4J0X A;  3SBP A;  3N0E A;  4FA4 D;  4E5Z A;  5IGO A;  2AGW A;  2HES X;  2J57 G;  3EI2 B;  4XYH A;  2UZX B;  2AGY A;  4ZOV A;  2CE8 A;  3BWS A;  4A2L A;  5GXI A;  2IUP A;  4CZX A;  5CXC B;  4A0A B;  1B9X A;  3MZK A;  3B7F A;  1XHM A;  5HE1 B;  4E54 A;  3I2N A;  3MKS B;  3N0D A;  3EMH A;  3FRX A;  4Z8L A;  3JRO A;  3NVN A;  4J81 A;  3C99 A;  4X60 B;  4J82 A;  5KDO B;  4O3U B;  3UVM A;  2B5M A;  3OL2 A;  1B9Y A;  2QXV A;  3SFZ A;  2P1N B;  5FXY A;  1ERJ A;  3C6P B;  3MXX A;  2I3T A;  4JT5 C;  2IWF A;  2H68 A;  3IIW A;  4G56 B;  4GGA A;  3UVL A;  3C75 H;  3W15 A;  3RRM C;  2I3S A;  2GC4 A;  2HJB A;  1PGU A;  3PSC B;  3JAM g;  3RMZ D;  2XL3 A;  3UR4 A;  2YB8 B;  3I7N A;  1NR0 A;  2P9N C;  5H1M A;  5GMK n;  4A09 A;  3RSE C;  4A0A A;  5EAL A;  4CY2 A;  2XL2 A;  3MMY A;  1JMX B;  2H6N A;  1JMZ B;  5SXM A;  1LDK E;  3JB9 L;  2CO0 C;  2P1P B;  2CO0 A;  4L1Q D;  3IKO A;  3J81 g;  1N6E A;  1OLZ A;  3PVW B;  2P1O B;  3AL8 B;  4JSV C;  1XKS A;  4J77 A;  1L0Q A;  4AEZ A;  4U1E I;  5A2Q g;  5EML B;  2PM7 B;  4AOW A;  4TZ4 A;  3RFH A;  4PSW B;  4O3T B;  4GMB A;  2CE9 A;  3I7H A;  1RI6 A;  1PEV A;  3C5M A;  2P9U C;  2Z2P A;  2J55 H;  4FA5 D;  1FS1 A;  1TBG A;  4ERY A;  5EM2 B;  2OVP B;  2P1Q B;  5C9Z B;  3PE7 A;  4QL1 A;  4Y7R A;  3AL9 A;  3SVW D;  3OGK B;  1A0R B;  2GC7 A;  1K32 A;  4IA9 A;  4FWW A;  5FKT A;  4J79 A;  5CXB A;  5TDH B;  3C9C A;  5EMJ B;  2IUR A;  5C2W B;  3EG6 A;  3L2O B;  4J73 A;  3I8E A;  5EAM A;  2Z2O A; 
#chains in the Genus database with same CATH topology
 2OK4 A;  1PI6 A;  2IUQ A;  3T3M A;  5M5T A;  3EI3 B;  2H9N A;  4JT6 C;  5E6R A;  2JKX A;  4YVD A;  4FAN D;  5E6U A;  2OIZ A;  4CI2 A;  4A08 B;  3BG1 A;  1FZ4 E;  4FJJ A;  4KI6 A;  4G1M A;  4HDJ A;  4L3H D;  4QRJ A;  1FZH E;  1NEX B;  5IJ8 E;  3V4P A;  3K72 A;  5AFU 3;  3DDU A;  1GP2 B;  2B8I A;  2JH8 A;  5M5U A;  3HP9 A;  1C9L A;  2HD0 A;  2VDK A;  4QT8 A;  3V9F A;  4J2B A;  1FZ8 E;  3JZH A;  5I5J A;  3OKY B;  2QC5 A;  4JSN C;  3CFS B;  3C95 A;  5EM2 A;  4GQ1 A;  4PNK B;  4M41 A;  3SCX A;  5THA A;  1GOG A;  4ESG A;  3SNN A;  5AMS A;  2TRC B;  3AFC A;  4PXW A;  1JTD B;  4WK2 A;  2DY4 A;  4BP9 A;  3K26 A;  1JV2 A;  4B08 A;  2OK6 A;  4ERQ A;  3SUP A;  3SPZ A;  4L1M A;  2HU8 A;  5IGQ A;  3HFQ A;  3VA6 A;  3QI0 A;  3N1E A;  1XVB E;  4AMZ A;  4E4B A;  1MDA H;  2YNN A;  2H6Q A;  3T3P A;  3UVK A;  4FJG A;  4L9O A;  2OVR B;  3OGL B;  2H14 A;  2H9M A;  2XU7 A;  2B4E A;  3I7L A;  4I79 A;  4NC4 A;  3EI3 A;  1GG2 B;  1VE7 A;  3UKR C;  4FJX A;  2CN2 A;  2H47 A;  3KRX B;  4GGC A;  4D0K A;  3EQ7 A;  5HE3 B;  4J0W A;  5FKR A;  4A08 A;  4JD2 C;  5H14 A;  3SN6 B;  1XL3 C;  2YBA A;  4IRZ A;  4KFM B;  2VC2 A;  2PM9 B;  3JZG A;  3JRP A;  4A7J A;  4ERZ A;  3PXW D;  1FZ2 E;  3I7P A;  2RCU A;  3IUR A;  4D9S A;  5GXH A;  3UO3 A;  2JH9 A;  4ADN A;  1TYQ C;  4IMM A;  4NBM A;  5M5V A;  1MHZ G;  3EI2 A;  3SJL D;  3UIQ A;  2P9L C;  3OKY A;  4Z7N A;  2VJ4 A;  4X3E A;  2OVQ B;  3F3P A;  5HE0 B;  1N1C A;  1FPO A;  2BCJ B;  4DU4 A;  5CXC A;  4FJ9 A;  2HKR A;  4IT5 A;  5FA5 B;  3IJC A;  1XVD E;  3RWU A;  4PSX B;  3QEX A;  4KHN A;  3QHY B;  1IH7 A;  3ZDX A;  4EWR A;  2P5G A;  2OJY A;  2DTU A;  4ZN4 A;  3PXS D;  1FZ5 E;  4JSP C;  3O4I A;  4J84 A;  1O6G A;  3SLE D;  4GM8 A;  3F3G A;  4UI9 R;  1UOO A;  3NGI A;  4CY5 A;  3DSM A;  2B5L A;  5FQD A;  4G1E A;  2GNQ A;  3IIY A;  3C6N B;  3UO2 A;  3QEW A;  4J2A A;  4LGN A;  1FWX A;  2I0R A;  3IJ1 A;  4RE5 A;  3LZI A;  3AH8 B;  2HJ4 A;  4JHP C;  2CNX A;  3DWL C;  2AH0 A;  3L4M D;  1FZ6 E;  1XMG E;  2H9P A;  2H3X A;  3SBQ A;  3SBR A;  4O2W A;  2MMB A;  3E4Y A;  3HGK E;  5IJ7 E;  2XDW A;  3V4V A;  1JJU B;  4H5J A;  3QET A;  3RMA A;  4FJL A;  1Q47 A;  3L8B A;  4CI3 A;  5IRE A;  3RN0 D;  1N6D A;  3IJ0 A;  1U4C A;  4M3Z A;  4GQB B;  4J87 A;  2PM9 A;  3C94 A;  2IUV A;  4CZY A;  4LG8 A;  3ODT A;  3RFG A;  1M1X A;  3I89 A;  1K8K C;  3SHF A;  4RNG A;  3SUO A;  3TJY A;  1QFS A;  4UM8 A;  3SPY A;  3CFV A;  2B5N A;  4PBY A;  3A0F A;  3IVM A;  2EIB A;  3WSO A;  4CZV A;  3TAF A;  1L5G A;  1N6F A;  5EMK B;  1O6F A;  3EI1 B;  2VIX A;  3SXT D;  4Z7Q A;  3DXM C;  3IUQ A;  4E5Z B;  5EMM B;  5FKS A;  4X61 B;  3DXK C;  3QNO A;  3FGB A;  3UVO A;  5K19 A;  3VH0 A;  3O4J A;  3AL8 A;  1QFM A;  1XVE E;  2AGZ A;  2CN3 A;  2PM6 B;  3PXT D;  4BCD A;  2Z2N A;  4AN1 A;  3NHG A;  4FK2 A;  2HU5 A;  4M3R A;  4M3X A;  4A11 B;  5EAR A;  4NAA A;  3QEV A;  4J86 A;  5I5I A;  3K2O A;  5H37 A;  2P9S C;  1MG2 A;  1VZ3 A;  3IUN A;  3O4G A;  3P4F A;  5B4W A;  3VI3 A;  4WK4 A;  2E32 A;  4AN0 A;  1FZ7 E;  2LF6 A;  5TEF A;  2VDP A;  5M5S A;  4X5M A;  2Q7Q A;  4GM9 A;  1PBY B;  2I0S A;  3K71 A;  1P22 A;  2WQ8 A;  4BH6 A;  3SQ1 A;  3U4Y A;  5I5M A;  1XMF E;  3K27 A;  4MK0 B;  3NAE A;  2P5O A;  4FAV D;  4DNV A;  3SUQ A;  2PBI B;  1FZ1 E;  1FZ3 E;  3OW8 A;  1FZ0 E;  3TAB A;  3NE6 A;  3SCY A;  4JRQ A;  4DTN A;  2HXC A;  4DTS A;  5C86 A;  3CFP A;  4MMY A;  1S4U X;  3LZJ A;  5TF2 A;  3PVU B;  2JHP A;  2AQ5 A;  2VDN A;  3KRW B;  3V7D B;  4M3U A;  1VZ2 A;  4R7A B;  3FCS A;  3MZL A;  5C2V B;  2YMU A;  4FJM A;  1SQJ A;  5M5R A;  3ZDZ A;  3EI1 A;  3C6O B;  5FFG A;  5HE2 B;  4Z7O A;  2P9I C;  1VYH C;  4M3W A;  2QXF A;  2W18 A;  3LDS A;  2HYE A;  1E8N A;  4GQ2 P;  2BBK H;  3OKT A;  2B7M A;  4EYW A;  4AKH A;  4A11 A;  5JWZ A;  4A09 B;  1BPO A;  4OZU A;  5IBK B;  3EI4 B;  4FHL A;  1FZI E;  3NVX A;  4K3I D;  4X63 B;  4GM3 A;  3IJE A;  4KHW A;  4JXM A;  5FFO A;  5IT9 g;  3HL8 A;  1UOQ A;  1YFQ A;  2OZM A;  2G9A A;  3IUL A;  2OZS A;  4O02 A;  2IWK A;  4J2D A;  3PSL A;  3ULE C;  3JZN A;  3RN1 D;  3IUJ A;  4QQE A;  5E6S A;  4U7A A;  4CY1 A;  2MZW B;  2AH1 A;  3MKQ A;  3BG0 A;  1I2M B;  2BKL A;  4WJK A;  4FJK A;  2JHA A;  1XIP A;  4M42 A;  5EAP A;  2XYI A;  2VDM A;  3OTT A;  4GZ8 A;  4FA1 D;  4O45 A;  2H6K A;  4ICG C;  3J27 A;  2P9P C;  2EID A;  3ZDY A;  4DTP A;  4DTU A;  4BCC A;  5HQG A;  3CFO A;  3UVN A;  4ZOZ A;  2OYQ A;  2HKM A;  3E4W A;  4JS5 A;  1QNI A;  4RG8 A;  4O1Q D;  2VZ3 A;  4JSX C;  4A0B B;  4AI6 A;  5C92 A;  3EQ8 A;  5TEE A;  2FW3 A;  1H2Y A;  1MMO G;  2AGX A;  4J8G A;  4O9D A;  1SHY B;  3NID A;  3V5W B;  3GFC A;  4ZOY A;  1GXR A;  4FB1 D;  3EWE A;  3EI4 A;  1YR2 A;  3I7O A;  3OGM B;  3SI6 A;  3I8C A;  2ATQ A;  4CY3 A;  4OWR A;  4ES0 A;  5FKQ A;  2UZY B;  2VDQ A;  4N14 A;  5CYK B;  4XYI A;  2XZG A;  4QNC A;  5CXB B;  4D6V A;  4JS4 A;  4GGD A;  2H13 A;  1R5M A;  2YNO A;  3VI4 A;  3RLM D;  1GOT B;  4ADO A;  5IZ7 A;  3QNN A;  1JOF A;  2O9K A;  5GSA A;  4AKI A;  3FM0 A;  4FJ8 A;  4I6J B;  3MUO A;  4K3J B;  4Y5R D;  3JPX A;  1E5T A;  4JHN A;  2YNP A;  3CQ8 A;  1UTC A;  2H9L A;  4RL5 A;  1XVF E;  3SQ4 A;  3SMR A;  3J80 g;  3LD8 A;  2E31 A;  4MMZ A;  4E3S A;  2B1E A;  4H5I A;  4I9L A;  2VJ5 A;  4FJH A;  4CI1 A;  3ZWL B;  2VDR A;  4FVM A;  3E0C A;  4KHQ A;  5IC7 A;  1GOF A;  1OMW B;  4A0B A;  1U2V C;  3GRE A;  2AGL A;  3OF7 A;  5H17 A;  4FA9 D;  3UKU C;  4XEI C;  2J56 H;  4PBZ A;  3CIK B;  1Q9Y A;  2P1M B;  5HYN B;  2DEB A;  3HGL A;  3SVI A;  4J78 A;  3SWS D;  4BL0 A;  4MMX A;  2XE4 A;  4ZOX A;  3BVO A;  4DU3 A;  2PFV A;  1CLQ A;  2MTA H;  2FYO A;  5AJA A;  4E54 B;  3NVQ A;  1K3I A;  3DM0 A;  4DNW A;  3MUN A;  3ZE1 A;  3EU7 A;  3NIF A;  4CI8 A;  3QES A;  3OKW A;  2JPN A;  5CYK A;  4FK4 A;  3L4O D;  3F3F A;  4DU1 A;  2P9K C;  4HCB A;  1MG3 A;  2QR5 A;  4FJI A;  4NSX A;  4DTM A;  4M3T A;  4QAM A;  3QER A;  2EBS A;  3OL2 B;  2VDL A;  3I7K A;  3ORV D;  4J8B A;  1XVC E;  2G99 A;  4BUJ C;  4CC9 A;  3VGZ A;  5K1C C;  4BCB A;  5FLX g;  4A2M A;  4J2E A;  2I0T A;  4L3G D;  4LG9 A;  2IAA A;  4PC0 A;  4EP9 A;  4M45 A;  1SQ9 A;  4J0X A;  4AMY A;  1XVG E;  3J2P A;  2YB5 A;  3SBP A;  3N0E A;  4FA4 D;  4E5Z A;  5IGO A;  2AGW A;  3RMB A;  4KHS A;  2HES X;  1WAJ A;  3SUN A;  2J57 G;  3EI2 B;  4XYH A;  2UZX B;  2EIE A;  1MTY G;  2H4T A;  3LDB A;  2AGY A;  2CE8 A;  3BWS A;  4WK0 A;  4ZOV A;  4A2L A;  5GXI A;  1E8M A;  3L0M A;  2IUP A;  4CZX A;  5CXC B;  4A0A B;  1B9X A;  2HU7 A;  2JHC A;  4KHU A;  3B7F A;  3MZK A;  1XHM A;  5HE1 B;  4E54 A;  3I2N A;  3MKS B;  4HCC A;  4FK0 A;  3N0D A;  3L1N A;  3EMH A;  4FJN A;  3FRX A;  4Z8L A;  3QEI A;  3ZE0 A;  3JRO A;  3NVN A;  4J81 A;  1Q9X A;  3C99 A;  4KI4 A;  4X60 B;  2PFT A;  3NIG A;  4J82 A;  5KDO B;  3N1B A;  2RKH A;  4O3U B;  3NCI A;  3UVM A;  2B5M A;  3OL2 A;  1B9Y A;  2QXV A;  4DTJ A;  3KCI A;  3SFZ A;  3UVL A;  1MHY G;  1XU3 E;  2P1N B;  5HDB A;  2K5S A;  5FXY A;  1TYE A;  4DNU A;  1ERJ A;  4DTX A;  3C6P B;  3MXX A;  2I3T A;  2IWF A;  4DTR A;  2H68 A;  3IIW A;  1FZ9 E;  4G56 B;  4GGA A;  3C75 H;  4JT5 C;  3NDK A;  2I3S A;  3RRM C;  3W15 A;  2LF3 A;  3KD5 E;  2GC4 A;  2HJB A;  1PGU A;  3PSC B;  3RMC A;  3JAM g;  3RMZ D;  2XL3 A;  3UR4 A;  2YB8 B;  4EPH A;  3I7N A;  4G55 A;  1H2W A;  1NR0 A;  2P9N C;  5H1M A;  5GMK n;  4A09 A;  3MVD K;  3RSE C;  4A0A A;  5EAL A;  3SQ2 A;  4CY2 A;  1JMX B;  2H6N A;  2XL2 A;  1JMZ B;  3MMY A;  5SXM A;  1LDK E;  3ZE2 A;  3JB9 L;  2CO0 C;  1U8C A;  1H2Z A;  2P1P B;  1FYZ E;  4UM9 A;  4QND A;  2CO0 A;  4L1Q D;  3EQ9 A;  3IKO A;  3TAG A;  3J81 g;  4I9Q A;  1N6E A;  1OLZ A;  3PVW B;  2JQT A;  2P1O B;  3AL8 B;  4JSV C;  2MW2 A;  2VZ1 A;  1XKS A;  2VDO A;  4J77 A;  1L0Q A;  4AEZ A;  1JW2 A;  1XMH E;  3SQ0 A;  1FXX A;  3K6S A;  4U1E I;  5A2Q g;  4AKG A;  3KD1 E;  4FJ5 A;  3GD1 I;  5EML B;  4BP8 A;  2PM7 B;  1VE6 A;  4TZ4 A;  3RFH A;  4AOW A;  4GAM C;  4PSW B;  4O3T B;  4GMB A;  2CE9 A;  3I7H A;  1RI6 A;  1A12 A;  4X5N A;  1PEV A;  3C5M A;  3S9H A;  1IG9 A;  1C9I A;  2P9U C;  4DTO A;  2Z2P A;  2J55 H;  4FA5 D;  3GC3 B;  4FJ7 A;  1FS1 A;  3IUM A;  4NEN A;  1T2X A;  1TBG A;  3O4H A;  4ERY A;  3CFR A;  5EM2 B;  2OVP B;  1H2X A;  2P1Q B;  3RMD A;  4M3Y A;  5C9Z B;  3PE7 A;  2QZP A;  4QL1 A;  4Y7R A;  3AL9 A;  3SVW D;  2EIC A;  3FCU A;  3OGK B;  1A0R B;  2GC7 A;  1K32 A;  3SJJ A;  3TAE A;  4RE6 A;  3QEP A;  5M61 A;  4IA9 A;  4FWW A;  1WAF A;  5FKT A;  4J79 A;  5CXB A;  1XU5 E;  5TDH B;  4AX4 A;  4JRP A;  3C9C A;  1UOP A;  5EMJ B;  2IUR A;  3TL8 B;  3EG6 A;  5C2W B;  3L2O B;  4J73 A;  3I8E A;  5EAM A;  4KHY A;  1GOH A;  2Z2O A; 
#chains in the Genus database with same CATH homology
 2OK4 A;  1PI6 A;  2IUQ A;  3EI3 B;  2H9N A;  4JT6 C;  4YVD A;  4FAN D;  2OIZ A;  4CI2 A;  4A08 B;  3BG1 A;  1FZ4 E;  4FJJ A;  4KI6 A;  4L3H D;  4HDJ A;  4QRJ A;  1FZH E;  1NEX B;  5IJ8 E;  5AFU 3;  1GP2 B;  2B8I A;  2JH8 A;  3HP9 A;  2HD0 A;  4QT8 A;  3V9F A;  4J2B A;  1FZ8 E;  3JZH A;  5I5J A;  3OKY B;  2QC5 A;  4JSN C;  3CFS B;  3C95 A;  5EM2 A;  4GQ1 A;  4PNK B;  4M41 A;  3SCX A;  5THA A;  4ESG A;  3SNN A;  5AMS A;  2TRC B;  3AFC A;  4PXW A;  2DY4 A;  3K26 A;  4B08 A;  2OK6 A;  4ERQ A;  3SUP A;  3SPZ A;  5IGQ A;  3HFQ A;  3VA6 A;  3N1E A;  1XVB E;  4E4B A;  1MDA H;  2YNN A;  2H6Q A;  3UVK A;  4FJG A;  4L9O A;  2OVR B;  3OGL B;  2H14 A;  2H9M A;  2XU7 A;  2B4E A;  3I7L A;  4I79 A;  3EI3 A;  1GG2 B;  3UKR C;  4FJX A;  2CN2 A;  2H47 A;  3KRX B;  4GGC A;  4D0K A;  5HE3 B;  4J0W A;  5FKR A;  4A08 A;  4JD2 C;  5H14 A;  3SN6 B;  1XL3 C;  2YBA A;  4KFM B;  3JZG A;  2PM9 B;  4A7J A;  3JRP A;  4ERZ A;  3PXW D;  1FZ2 E;  3I7P A;  2RCU A;  5GXH A;  2JH9 A;  4ADN A;  1TYQ C;  4IMM A;  3EI2 A;  1MHZ G;  3SJL D;  3UIQ A;  2P9L C;  3OKY A;  2VJ4 A;  4X3E A;  2OVQ B;  3F3P A;  5HE0 B;  2BCJ B;  4DU4 A;  5CXC A;  4FJ9 A;  2HKR A;  5FA5 B;  3IJC A;  1XVD E;  3RWU A;  4PSX B;  3QEX A;  4KHN A;  4EWR A;  1IH7 A;  2P5G A;  2OJY A;  2DTU A;  4ZN4 A;  3PXS D;  1FZ5 E;  4JSP C;  4J84 A;  3SLE D;  4GM8 A;  3F3G A;  4UI9 R;  3NGI A;  4CY5 A;  3DSM A;  2B5L A;  5FQD A;  2GNQ A;  3IIY A;  3C6N B;  4LGN A;  3QEW A;  4J2A A;  1FWX A;  2I0R A;  3IJ1 A;  3LZI A;  3AH8 B;  2HJ4 A;  2CNX A;  3DWL C;  2AH0 A;  3L4M D;  1FZ6 E;  1XMG E;  2H9P A;  2H3X A;  3SBQ A;  3SBR A;  2MMB A;  3E4Y A;  3HGK E;  5IJ7 E;  1JJU B;  4H5J A;  3QET A;  3RMA A;  4FJL A;  1Q47 A;  3L8B A;  4CI3 A;  5IRE A;  3RN0 D;  1N6D A;  3IJ0 A;  1U4C A;  4M3Z A;  4GQB B;  4J87 A;  2PM9 A;  3C94 A;  2IUV A;  4CZY A;  4LG8 A;  3ODT A;  3RFG A;  3I89 A;  1K8K C;  3SHF A;  4RNG A;  3SUO A;  3TJY A;  3SPY A;  3CFV A;  2B5N A;  4PBY A;  3A0F A;  3WSO A;  4CZV A;  3TAF A;  1N6F A;  5EMK B;  3EI1 B;  2VIX A;  3SXT D;  4E5Z B;  3DXM C;  5EMM B;  5FKS A;  4X61 B;  3DXK C;  3QNO A;  3FGB A;  3UVO A;  5K19 A;  3VH0 A;  3AL8 A;  1XVE E;  2AGZ A;  2CN3 A;  2PM6 B;  3PXT D;  2Z2N A;  3NHG A;  4FK2 A;  4M3R A;  4M3X A;  4A11 B;  5EAR A;  3QEV A;  4J86 A;  5I5I A;  3K2O A;  5H37 A;  2P9S C;  1MG2 A;  5B4W A;  3P4F A;  2E32 A;  1FZ7 E;  2LF6 A;  5TEF A;  4X5M A;  2Q7Q A;  4GM9 A;  1PBY B;  2I0S A;  1P22 A;  4BH6 A;  3U4Y A;  3SQ1 A;  5I5M A;  1XMF E;  3K27 A;  4MK0 B;  3NAE A;  2P5O A;  4FAV D;  3SUQ A;  2PBI B;  1FZ1 E;  1FZ3 E;  3OW8 A;  1FZ0 E;  3TAB A;  3NE6 A;  3SCY A;  4JRQ A;  4DTN A;  2HXC A;  4DTS A;  3CFP A;  1S4U X;  3LZJ A;  5TF2 A;  3PVU B;  2JHP A;  2AQ5 A;  3KRW B;  3V7D B;  4M3U A;  4R7A B;  3MZL A;  5C2V B;  2YMU A;  4FJM A;  1SQJ A;  3EI1 A;  3C6O B;  5HE2 B;  2P9I C;  1VYH C;  4M3W A;  2QXF A;  2W18 A;  3LDS A;  2HYE A;  4GQ2 P;  2BBK H;  3OKT A;  2B7M A;  4EYW A;  4AKH A;  4A11 A;  5JWZ A;  4A09 B;  4OZU A;  5IBK B;  3EI4 B;  4FHL A;  1FZI E;  3NVX A;  4K3I D;  4X63 B;  4GM3 A;  4KHW A;  4JXM A;  5IT9 g;  3HL8 A;  1YFQ A;  2OZM A;  2G9A A;  2OZS A;  2IWK A;  4J2D A;  3PSL A;  3ULE C;  3JZN A;  3RN1 D;  4QQE A;  4U7A A;  4CY1 A;  2MZW B;  2AH1 A;  3MKQ A;  3BG0 A;  4FJK A;  2JHA A;  1XIP A;  4M42 A;  5EAP A;  2XYI A;  3OTT A;  4GZ8 A;  4FA1 D;  4O45 A;  2H6K A;  3J27 A;  2P9P C;  4DTP A;  4DTU A;  5HQG A;  3CFO A;  3UVN A;  4ZOZ A;  2OYQ A;  2HKM A;  3E4W A;  4JS5 A;  1QNI A;  4RG8 A;  4O1Q D;  4JSX C;  4A0B B;  4AI6 A;  5TEE A;  2FW3 A;  1MMO G;  2AGX A;  4J8G A;  4O9D A;  1SHY B;  3V5W B;  3GFC A;  4ZOY A;  1GXR A;  4FB1 D;  3EWE A;  3EI4 A;  3I7O A;  3OGM B;  3SI6 A;  3I8C A;  2ATQ A;  4CY3 A;  4OWR A;  4ES0 A;  5FKQ A;  2UZY B;  4N14 A;  5CYK B;  4D6V A;  4XYI A;  5CXB B;  4QNC A;  4JS4 A;  4GGD A;  2H13 A;  1R5M A;  2YNO A;  3RLM D;  1GOT B;  4ADO A;  5IZ7 A;  3QNN A;  1JOF A;  2O9K A;  5GSA A;  4AKI A;  3FM0 A;  4FJ8 A;  4I6J B;  4K3J B;  4Y5R D;  3JPX A;  2YNP A;  3CQ8 A;  2H9L A;  4RL5 A;  1XVF E;  3SQ4 A;  3SMR A;  3J80 g;  3LD8 A;  2E31 A;  4E3S A;  2B1E A;  4H5I A;  4I9L A;  2VJ5 A;  4FJH A;  4CI1 A;  3ZWL B;  4FVM A;  3E0C A;  4KHQ A;  5IC7 A;  1OMW B;  4A0B A;  1U2V C;  3GRE A;  2AGL A;  5H17 A;  4FA9 D;  3UKU C;  4XEI C;  2J56 H;  4PBZ A;  3CIK B;  1Q9Y A;  2P1M B;  5HYN B;  2DEB A;  3HGL A;  3SVI A;  4J78 A;  3SWS D;  4BL0 A;  4ZOX A;  4DU3 A;  2PFV A;  1CLQ A;  2MTA H;  2FYO A;  5AJA A;  4E54 B;  3NVQ A;  3DM0 A;  3EU7 A;  4CI8 A;  3QES A;  3OKW A;  2JPN A;  5CYK A;  4FK4 A;  3L4O D;  3F3F A;  4DU1 A;  2P9K C;  4HCB A;  1MG3 A;  4FJI A;  4NSX A;  4DTM A;  4M3T A;  3QER A;  2EBS A;  3OL2 B;  3ORV D;  3I7K A;  4J8B A;  4BUJ C;  1XVC E;  2G99 A;  4CC9 A;  3VGZ A;  5K1C C;  5FLX g;  4A2M A;  4J2E A;  2I0T A;  4L3G D;  4LG9 A;  2IAA A;  4PC0 A;  1SQ9 A;  4EP9 A;  4M45 A;  4J0X A;  1XVG E;  3J2P A;  2YB5 A;  3SBP A;  3N0E A;  4FA4 D;  4E5Z A;  5IGO A;  2AGW A;  3RMB A;  4KHS A;  2HES X;  1WAJ A;  3SUN A;  2J57 G;  3EI2 B;  4XYH A;  2UZX B;  1MTY G;  2H4T A;  3LDB A;  2AGY A;  2CE8 A;  3BWS A;  4ZOV A;  4A2L A;  5GXI A;  3L0M A;  2IUP A;  4CZX A;  5CXC B;  4A0A B;  1B9X A;  2JHC A;  4KHU A;  3B7F A;  3MZK A;  1XHM A;  5HE1 B;  4E54 A;  3I2N A;  3MKS B;  4HCC A;  4FK0 A;  3N0D A;  3L1N A;  3EMH A;  4FJN A;  3FRX A;  4Z8L A;  3QEI A;  3JRO A;  3NVN A;  4J81 A;  1Q9X A;  3C99 A;  4KI4 A;  4X60 B;  2PFT A;  4J82 A;  5KDO B;  3N1B A;  4O3U B;  3NCI A;  3UVM A;  2B5M A;  3OL2 A;  1B9Y A;  2QXV A;  4DTJ A;  3SFZ A;  3UVL A;  1MHY G;  1XU3 E;  2P1N B;  5FXY A;  1ERJ A;  4DTX A;  3C6P B;  3MXX A;  2I3T A;  2IWF A;  4DTR A;  2H68 A;  3IIW A;  1FZ9 E;  4G56 B;  4GGA A;  3C75 H;  4JT5 C;  3NDK A;  2I3S A;  3RRM C;  3W15 A;  2LF3 A;  3KD5 E;  2GC4 A;  2HJB A;  1PGU A;  3PSC B;  3RMC A;  3JAM g;  3RMZ D;  2XL3 A;  3UR4 A;  2YB8 B;  4EPH A;  3I7N A;  1NR0 A;  2P9N C;  5H1M A;  5GMK n;  4A09 A;  3RSE C;  4A0A A;  5EAL A;  3SQ2 A;  4CY2 A;  1JMX B;  2H6N A;  2XL2 A;  1JMZ B;  3MMY A;  5SXM A;  1LDK E;  3JB9 L;  2CO0 C;  2P1P B;  1FYZ E;  4QND A;  2CO0 A;  4L1Q D;  3IKO A;  3TAG A;  3J81 g;  4I9Q A;  1N6E A;  1OLZ A;  3PVW B;  2P1O B;  3AL8 B;  4JSV C;  1XKS A;  4J77 A;  1L0Q A;  4AEZ A;  1XMH E;  3SQ0 A;  1FXX A;  4U1E I;  5A2Q g;  4AKG A;  3KD1 E;  4FJ5 A;  5EML B;  2PM7 B;  4AOW A;  4TZ4 A;  3RFH A;  4GAM C;  4PSW B;  4O3T B;  4GMB A;  2CE9 A;  3I7H A;  1RI6 A;  4X5N A;  1PEV A;  3C5M A;  3S9H A;  1IG9 A;  2P9U C;  4DTO A;  2Z2P A;  2J55 H;  4FA5 D;  4FJ7 A;  1FS1 A;  1TBG A;  4ERY A;  3CFR A;  5EM2 B;  2OVP B;  2P1Q B;  3RMD A;  4M3Y A;  5C9Z B;  3PE7 A;  4QL1 A;  4Y7R A;  3AL9 A;  3SVW D;  3OGK B;  1A0R B;  2GC7 A;  1K32 A;  3SJJ A;  3TAE A;  3QEP A;  4IA9 A;  4FWW A;  1WAF A;  5FKT A;  4J79 A;  5CXB A;  1XU5 E;  5TDH B;  4JRP A;  3C9C A;  5EMJ B;  2IUR A;  3TL8 B;  3EG6 A;  5C2W B;  3L2O B;  4J73 A;  3I8E A;  5EAM A;  4KHY A;  2Z2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...