2OVPB

Structure of the skp1-fbw7 complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
444
structure length
441
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 441
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovpB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovpB02
3OGMB 2E32A 2H9MA 4JXMA 2IUQA 4GGAA 3RSEC 3IIYA 4A0AA 3SN6B 4X3EA 2CNXA 2OK4A 1B9YA 2I3TA 4PNKB 2QC5A 2IURA 4GQ2P 4GMBA 3RMZD 2J56H 4A0BA 5HQGA 3JPXA 3UVMA 4PBZA 4BH6A 4CY2A 2PM6B 5HE1B 2PM9B 3DSMA 3OKYB 3C75H 4K3JB 2PM9A 1XIPA 3DXMC 1PBYB 3BG0A 3IJ0A 3PSLA 3IJCA 1OMWB 3ZWLB 4GM8A 4OZUA 2UZYB 3MZKA 5FA5B 2IWKA 3GFCA 1Q47A 4MK0B 5IGOA 2P1OB 4GGCA 2O9KA 4J81A 2OK6A 3N0DA 2P9PC 1JJUB 5IJ8E 2AGLA 4X60B 4E5ZB 1JOFA 5HE3B 4G56B 2IWFA 4GZ8A 5I5IA 4E5ZA 5GXIA 3PXWD 2P9UC 5TDHB 4CI1A 4ZOVA 3SVWD 1GOTB 4IA9A 5FQDA 3I7OA 1TYQC 3I7LA 5TEEA 4D6VA 4N14A 5IBKB 1JMXB 4A08B 2OVQB 4X63B 2H14A 2E31A 4QT8A 4A08A 4J0XA 4JSPC 4A7JA 3P4FA 5GSAA 1K8KC 4CZYA 2BCJB 3I7KA 4LG8A 3I8EA 3K27A 3I7HA 2PM7B 1FS1A 2AGWA 3PSCB 3A0FA 5IC7A 5EM2B 1VYHC 1GP2B 4ERYA 3UVKA 5EM2A 3AFCA 1U2VC 3V5WB 4K3ID 2P1PB 5GXHA 3HFQA 3UVOA 5EALA 3EI1B 4GQBB 1A0RB 2I0RA 5JWZA 1XHMA 3EI1A 3AL9A 3OL2B 1PI6A 1R5MA 5B4WA 5THAA 3SBRA 4FA1D 3SFZA 4CY3A 4CZXA 4EWRA 2H3XA 2P9SC 2H6QA 4JSXC 4ZOYA 3VGZA 4A2MA 2P9NC 4KFMB 5K1CC 4IMMA 3UR4A 3I7PA 5CYKB 1U4CA 2I0TA 1SHYB 2QXVA 3ORVD 4OWRA 4PC0A 5CYKA 4ERQA 4ES0A 5C2WB 2BBKH 3CFSB 3MKQA 4ESGA 4J79A 3I7NA 4Y5RD 2Z2PA 3MXXA 2P1NB 1K32A 2YNPA 1QNIA 5C9ZB 3L4MD 1YFQA 4O3UB 3EG6A 1MG2A 3NVNA 4ZOXA 2J57G 1ERJA 1B9XA 1N6DA 3EI2B 1MDAH 2H9LA 3RRMC 4CY1A 5A2Qg 3PE7A 2P1MB 3EI2A 1XKSA 2XU7A 3OKTA 3I8CA 3OKYA 2B5LA 2I3SA 4FAND 3C6OB 4FB1D 4GM9A 5FKRA 2AGXA 3AL8B 4J77A 3JZNA 3KRXB 3AL8A 3L4OD 3F3PA 5EARA 3RLMD 3RN1D 5KDOB 3EU7A 3PXTD 1SQJA 4CI2A 3E0CA 3V7DB 5SXMA 2CE8A 3KRWB 5K19A 4JSVC 4LG9A 3JB9L 1OLZA 2CN3A 4JT6C 3JAMg 4J86A 5TF2A 4I79A 5IJ7E 3F3GA 3C6PB 4O45A 4X61B 4QQEA 3PVWB 3J81g 3RN0D 3BG1A 3C9CA 3J80g 3EI3B 1FWXA 3N0EA 4BUJC 3EWEA 3EI3A 4L3GD 2YNNA 4E54B 3SXTD 3UKUC 5HE2B 2YB8B 4E54A 3NVXA 4O3TB 5FKTA 4J87A 4ZOZA 4CC9A 3VH0A 2Z2NA 3JROA 3SCYA 3SHFA 4FHLA 4J78A 5H14A 2PBIB 2GC7A 3IKOA 1LDKE 3AH8B 3UVLA 2HKRA 3OL2A 1TBGA 3WSOA 5FXYA 4J73A 5H17A 2B5MA 4FA4D 3RFHA 4GGDA 5C2VB 4J82A 4U1EI 2EBSA 4U7AA 1N6EA 2B5NA 4TZ4A 2H6KA 3NVQA 2IUPA 3C5MA 3EMHA 2AH0A 2P9IC 4AOWA 3EI4B 4L9OA 1L0QA 3C99A 2XL3A 3EI4A 4A09B 5H1MA 4PBYA 2YBAA 4FAVD 4A09A 3PXSD 2H9PA 3FRXA 2IAAA 3L2OB 3JRPA 5HE0B 2HESX 2Q7QA 4QRJA 3CFVA 4JT5C 4JSNC 3OGKB 4O9DA 4A0AB 4CY5A 1PGUA 3DWLC 3IIWA 5HYNB 3GREA 2H13A 5GMKn 3UVNA 2CE9A 3OTTA 1SQ9A 4J0WA 2TRCB 2H68A 4A11B 4FA9D 4A0BB 5IT9g 1N6FA 4PSXB 3ODTA 2H6NA 4A11A 2AH1A 3VA6A 4I6JB 5EMMB 3SMRA 3MMYA 3DM0A 1PEVA 4L3HD 4PSWB 3CIKB 2P9LC 3UKRC 4ERZA 5FKQA 4A2LA 2HJBA 3DXKC 3PVUB 4BL0A 2H9NA 4JD2C 4J84A 2UZXB 3B7FA 3IJ1A 3OKWA 3MKSB 2H47A 2AGYA 3C6NB 2MTAH 2P1QB 4GM3A 4O1QD 4Y7RA 4L1QD 2XL2A 3K26A 4NSXA 2GNQA 5AJAA 2YMUA 3SBPA 4D0KA 3SLED 4HDJA 3W15A 3F3FA 4ZN4A 4XEIC 2OVPB 5EMKB 1GXRA 1S4UX 2XYIA 5CXCB 4H5JA 5EAMA 2OJYA 3SBQA 2HJ4A 5CXCA 4QL1A 3ULEC 3SWSD 2CN2A 4J8BA 5CXBB 2HXCA 2CO0C 5FLXg 2IUVA 5EMLB 5CXBA 4XYHA 1GG2B 3V9FA 4YVDA 1NEXB 3OW8A 3MZLA 3I89A 2GC4A 2I0SA 2B4EA 5I5MA 3FGBA 3U4YA 1P22A 2CO0A 4H5IA 2HKMA 4PXWA 4CI3A 2OVRB 4LGNA 1RI6A 2AGZA 4Z8LA 3SJLD 3I2NA 1NR0A 4J8GA 4XYIA 2J55H 3JZHA 3RFGA 3BWSA 4FWWA 2OIZA 5FKSA 5AMSA 2W18A 4R7AB 4UI9R 1JMZB 4CZVA 3FM0A 2G9AA 2HYEA 2P9KC 4AEZA 2YNOA 3JZGA 5IGQA 5I5JA 4GQ1A 2AQ5A 2Z2OA 5EMJB 1MG3A 5TEFA 4CI8A 5EAPA 3OGLB 4FA5D 2G99A 5AFU3
chains in the Genus database with same CATH superfamily
3OGMB 2QR5A 3O4IA 1WAFA 2E32A 2H9MA 2OZSA 4JXMA 2IUQA 4IT5A 4GGAA 4NBMA 3RSEC 4NC4A 3CFOA 3UO3A 3IIYA 3QEVA 4A0AA 3SN6B 4X3EA 2CNXA 2OK4A 1B9YA 2I3TA 4DTOA 4DTMA 4PNKB 2QC5A 2IURA 4GQ2P 4AKIA 4KI4A 4GMBA 4KHUA 3RMZD 1QFSA 2J56H 5HQGA 4A0BA 3JPXA 3UVMA 4PBZA 4BH6A 4CY2A 2PM6B 4BCDA 5HE1B 2PM9B 3DSMA 2JQTA 3C75H 3OKYB 3DDUA 4K3JB 3TL8B 5M5SA 2B7MA 2PM9A 1XIPA 3DXMC 1PBYB 1M1XA 2EIEA 3BG0A 3IJ0A 3PSLA 2VDQA 1OMWB 3IJCA 4BCBA 3OF7A 3VI4A 3ZWLB 4GM8A 4OZUA 4DTPA 3KD5E 2EIBA 3SUNA 1JV2A 2UZYB 4IRZA 3MZKA 5FA5B 2IWKA 3GFCA 3SUPA 1Q47A 4MK0B 1FZ7E 3L0MA 2P1OB 4DU1A 2JH8A 4EP9A 3EQ9A 5IGOA 4GGCA 2O9KA 3L8BA 4J81A 1VZ3A 2OK6A 3N0DA 3K71A 4FJ8A 4B08A 3K6SA 4ADNA 3SCXA 2P9PC 3SJJA 3HGKE 1JJUB 2VDPA 5IJ8E 3LZIA 2AGLA 4NENA 4X60B 4E5ZB 1JOFA 5HE3B 4G56B 4FJNA 2IWFA 4GZ8A 5I5IA 1XVDE 3VI3A 1XMHE 4E5ZA 2FW3A 4JS5A 4FJ7A 1MTYG 5GXIA 3PXWD 2P9UC 4WK0A 5TDHB 1FXXA 4CI1A 4ZOVA 5C92A 3SVWD 1GOTB 4FJLA 4FJXA 4IA9A 3UO2A 5FQDA 3I7OA 1TYQC 4G55A 4KHSA 1TYEA 3I7LA 5TEEA 4D6VA 3SQ2A 4N14A 1XU3E 5IBKB 1JMXB 4A08B 2OVQB 3HGLA 4X63B 4J2AA 4DTJA 1BPOA 2E31A 2H14A 3ZDXA 5E6UA 4FK2A 3KD1E 4QT8A 4EYWA 4A08A 4RL5A 4J0XA 4JSPC 4A7JA 3P4FA 5GSAA 3EI1A 1K8KC 4CZYA 2BCJB 3I7KA 4LG8A 3MVDK 3I8EA 3SPYA 3K27A 3I7HA 3NCIA 2PM7B 5E6RA 2PFVA 4AMYA 1FZIE 1FS1A 2AGWA 3PSCB 3A0FA 2EICA 4Z7NA 1H2YA 4JHNA 3QEPA 2ATQA 5IC7A 5EM2B 1VYHC 1GP2B 4ERYA 3UVKA 5EM2A 1FPOA 2HU5A 3AFCA 5E6SA 1U2VC 2BKLA 3V5WB 4K3ID 2P1PB 1IH7A 5GXHA 3HFQA 3UVOA 4FJGA 5EALA 3LDBA 3EI1B 1Q9XA 4FJMA 3FCSA 4GQBB 5M5TA 1A0RB 2I0RA 2JH9A 5JWZA 1XHMA 5M5VA 1VZ2A 3AL9A 1PI6A 1R5MA 3OL2B 5B4WA 5THAA 4X5MA 1Q9YA 1H2WA 3K72A 3SBRA 3TAGA 3S9HA 3FCUA 3SFZA 4FVMA 4CY3A 4CZXA 4FA1D 4EWRA 1UOOA 2H3XA 2P9SC 2H6QA 2HU7A 4JSXC 4ZOYA 3VGZA 2LF3A 3RMAA 4KI6A 4KHQA 3ZDZA 4QAMA 4A2MA 2P9NC 4KFMB 3NAEA 5K1CC 3NIGA 4AMZA 1VE7A 4IMMA 3UR4A 3I7PA 5CYKB 4DNUA 1U4CA 2I0TA 1SHYB 2QXVA 3ORVD 4OWRA 4PC0A 5CYKA 4ERQA 4ES0A 5C2WB 2BBKH 3CFSB 4EPHA 4QNCA 3SPZA 3MKQA 3I7NA 3NIFA 4J79A 3T3MA 4ESGA 3NHGA 3QESA 4Y5RD 2Z2PA 4DNWA 4AN1A 1XVGE 3MXXA 1JW2A 2P1NB 1K32A 2YNPA 2MMBA 1QNIA 5FFOA 5C9ZB 4AKHA 3L4MD 4FJ9A 1YFQA 1E8MA 4JS4A 2VDLA 2P5OA 4L1MA 4O3UB 4E3SA 1MG2A 3EG6A 3NVNA 4ZOXA 2HU8A 3IUNA 3J27A 2J57G 4JRPA 1MHYG 1U8CA 1ERJA 1B9XA 1N6DA 3EI2B 1MDAH 1FZHE 2H9LA 3RRMC 4CY1A 5A2Qg 3NDKA 3PE7A 3GC3B 3ZE2A 4BCCA 2P1MB 3EI2A 1XKSA 1O6FA 2XU7A 3I8CA 3OKTA 3OKYA 4I9QA 3N1BA 2B5LA 2I3SA 3V4VA 3C6OB 4FB1D 1E5TA 4GM9A 5FKRA 4FAND 2AGXA 1XVBE 1CLQA 3E4YA 3AL8B 4J77A 3JZNA 3KRXB 1FZ4E 4RNGA 2VDOA 3AL8A 3L4OD 2P5GA 3F3PA 4GAMC 5EARA 3RLMD 1JTDB 3RN1D 5KDOB 2OYQA 3EU7A 3PXTD 4M3UA 1SQJA 3V4PA 1N1CA 4CI2A 3E0CA 4M3TA 3V7DB 5SXMA 3CFRA 3RWUA 3SI6A 4QNDA 2CE8A 1UOQA 3KRWB 3QERA 5K19A 4JSVC 4O2WA 3MUNA 4LG9A 4I9LA 1FZ8E 1VE6A 3JB9L 3IJEA 4D9SA 2EIDA 1OLZA 2CN3A 4JT6C 2H4TA 3SUOA 4AN0A 4M3RA 1E8NA 3QNNA 4FK0A 4M3YA 4MMZA 3JAMg 3CQ8A 4M42A 3TJYA 4J86A 5TF2A 3CFPA 5M5RA 4I79A 5H37A 5IJ7E 3C6PB 3F3GA 4O45A 3IUJA 1QFMA 1FZ3E 4X61B 3IURA 4QQEA 1FZ6E 4WK2A 3PVWB 2JHAA 2VDKA 3RMDA 4KHNA 3J81g 1XMGE 3BG1A 3RN0D 1GOGA 3C9CA 1GOHA 4ICGC 3GD1I 1FZ9E 3J80g 3EI3B 1FWXA 3N0EA 4BUJC 3EWEA 3EI3A 4L3GD 2YNNA 2VIXA 2FYOA 2VZ1A 2HD0A 4E54B 3SXTD 3UKUC 5HE2B 3UIQA 2YB8B 4E54A 2DY4A 3NVXA 4O3TB 5FKTA 2VDNA 4J87A 4ZOZA 1WAJA 1XVCE 4CC9A 2VDMA 3VH0A 2Z2NA 3JROA 3QI0A 3SCYA 2VC2A 3SHFA 3BVOA 3QEWA 4FHLA 4J78A 3ZE1A 4BP9A 4Z7QA 5H14A 2PBIB 2GC7A 3J2PA 3IKOA 1LDKE 4ADOA 1C9LA 3RMBA 3AH8B 3LD8A 2HKRA 3EQ8A 3UVLA 1K3IA 4M45A 1TBGA 3WSOA 2MW2A 3OL2A 2QZPA 2OZMA 5M61A 1MMOG 5FXYA 3QEXA 4J73A 5H17A 3TAFA 4HCBA 2B5MA 3RFHA 4GGDA 4MMYA 4FA4D 1A12A 5C2VB 4J82A 4U1EI 2EBSA 4U7AA 1N6EA 2XZGA 2B5NA 4FJHA 5M5UA 4TZ4A 4HCCA 2H6KA 3NVQA 3O4GA 2DTUA 2IUPA 3C5MA 3EMHA 1IG9A 2AH0A 3IULA 2P9IC 4FJ5A 2B8IA 1YR2A 4AOWA 1XVEE 3EI4B 4L9OA 1L0QA 3C99A 2XL3A 2JPNA 3EI4A 4A09B 2RCUA 5H1MA 4PBYA 1UOPA 2YBAA 4FAVD 3IVMA 1I2MB 3PXSD 2H9PA 4RE5A 4A09A 4DU4A 4M3ZA 1O6GA 4DNVA 1FZ2E 3SQ4A 3FRXA 4BP8A 4AI6A 2IAAA 3L2OB 4UM8A 3SVIA 3JRPA 5HE0B 2HESX 2Q7QA 5HDBA 4UM9A 4QRJA 3CFVA 4JT5C 4JSNC 3OGKB 4AKGA 4O9DA 4A0AB 4CY5A 1PGUA 4E4BA 3DWLC 3T3PA 3IIWA 5HYNB 3GREA 2H13A 5GMKn 1XL3C 3UVNA 2CE9A 3OTTA 1SQ9A 4J0WA 1H2XA 2TRCB 4DTUA 2H68A 2JHCA 3ZE0A 5IREA 4A11B 3NIDA 4FA9D 4A0BB 5IT9g 1N6FA 4PSXB 3ODTA 2H6NA 4G1MA 4DTXA 4A11A 2AH1A 3VA6A 4I6JB 5EMMB 3SMRA 3MMYA 4DTNA 3DM0A 1PEVA 4L3HD 4PSWB 3CIKB 2P9LC 4WK4A 3HP9A 3UKRC 3E4WA 4ERZA 5FKQA 4A2LA 3LDSA 3NGIA 2LF6A 2VJ4A 4M41A 2HJBA 3DXKC 3PVUB 4BL0A 2H9NA 2XE4A 3IUMA 4JD2C 3IJ1A 2UZXB 2VZ3A 3B7FA 3OKWA 3MKSB 3TAEA 4J84A 4MMXA 2H47A 4AX4A 1FZ1E 4J2EA 2AGYA 3C6NB 4JHPC 2MTAH 2P1QB 3O4HA 3K2OA 4GM3A 4O1QD 4L1QD 4Y7RA 2XL2A 3QEIA 3C95A 4M3XA 2GNQA 2WQ8A 3K26A 4NSXA 3QHYB 3ZDYA 1UTCA 5AJAA 2YMUA 4WJKA 2JKXA 3SBPA 4D0KA 4RE6A 4HDJA 3SLED 4KHYA 4O02A 3KCIA 3W15A 3HL8A 3F3FA 4XEIC 3O4JA 4ZN4A 3L1NA 2OVPB 5EMKB 1GXRA 1S4UX 4J2DA 4FK4A 5FFGA 3RMCA 2RKHA 2XYIA 5CXCB 4DTSA 4H5JA 5EAMA 2OJYA 2XDWA 3SBQA 2HJ4A 5CXCA 4QL1A 3ULEC 3SWSD 2MZWB 2JHPA 2CN2A 1C9IA 4J8BA 1H2ZA 5CXBB 3QNOA 2HXCA 2CO0C 5FLXg 2IUVA 2K5SA 5EMLB 1XMFE 5CXBA 4XYHA 1GG2B 3V9FA 4JRQA 2QXFA 3TABA 4YVDA 1NEXB 3OW8A 4M3WA 3MZLA 3I89A 1FYZE 2GC4A 1XU5E 2I0SA 1L5GA 2B4EA 2VDRA 5I5MA 3FGBA 3U4YA 1P22A 2CO0A 3SNNA 1FZ5E 2HKMA 4H5IA 4DTRA 4PXWA 4CI3A 2OVRB 4LGNA 3IUQA 1RI6A 2AGZA 3EQ7A 4Z8LA 3SJLD 3I2NA 2YB5A 1NR0A 4J8GA 3N1EA 4XYIA 3QETA 4NAAA 2B1EA 2J55H 3JZHA 3RFGA 1FZ0E 3BWSA 3SUQA 4FWWA 5C86A 2OIZA 5FKSA 5AMSA 2W18A 3MUOA 4R7AB 3SQ1A 3C94A 4G1EA 4UI9R 1JMZB 5IZ7A 3NE6A 4FJKA 4CZVA 2PFTA 4J2BA 1GOFA 3FM0A 2G9AA 2HYEA 2P9KC 4FJJA 4X5NA 4DU3A 1T2XA 4AEZA 2YNOA 3JZGA 2DEBA 5IGQA 5I5JA 4GQ1A 2AQ5A 3SQ0A 2Z2OA 3LZJA 5EMJB 1XVFE 1MG3A 5TEFA 1MHZG 4Z7OA 4RG8A 4FJIA 4CI8A 4KHWA 5EAPA 3OGLB 4FA5D 2G99A 5AFU3 2VJ5A
chains in the Genus database with same CATH topology
3OGMB 1WAFA 2E32A 2H9MA 2OZSA 4JXMA 2IUQA 4GGAA 3RSEC 3CFOA 3IIYA 3QEVA 4A0AA 3SN6B 4X3EA 2CNXA 2OK4A 1B9YA 2I3TA 4DTOA 4DTMA 4PNKB 2QC5A 2IURA 4GQ2P 4AKIA 4KI4A 4GMBA 4KHUA 3RMZD 2J56H 4A0BA 5HQGA 3JPXA 3UVMA 4PBZA 4BH6A 4CY2A 2PM6B 5HE1B 2PM9B 3DSMA 3OKYB 3C75H 4K3JB 3TL8B 2B7MA 2PM9A 1XIPA 3DXMC 1PBYB 3BG0A 3IJ0A 3PSLA 3IJCA 1OMWB 3ZWLB 4GM8A 4OZUA 4DTPA 3KD5E 2UZYB 3SUNA 3MZKA 5FA5B 2IWKA 3GFCA 3SUPA 1Q47A 4MK0B 1FZ7E 3L0MA 2P1OB 4DU1A 2JH8A 4EP9A 5IGOA 4GGCA 2O9KA 3L8BA 4J81A 2OK6A 3N0DA 4FJ8A 4B08A 4ADNA 3SCXA 2P9PC 3SJJA 3HGKE 1JJUB 5IJ8E 3LZIA 2AGLA 4X60B 4E5ZB 1JOFA 5HE3B 4G56B 4FJNA 2IWFA 4GZ8A 5I5IA 1XVDE 1XMHE 4E5ZA 2FW3A 4JS5A 4FJ7A 1MTYG 5GXIA 3PXWD 2P9UC 5TDHB 1FXXA 4CI1A 4ZOVA 3SVWD 1GOTB 4FJLA 4FJXA 4IA9A 5FQDA 3I7OA 1TYQC 4KHSA 3I7LA 5TEEA 4D6VA 3SQ2A 4N14A 1XU3E 5IBKB 1JMXB 4A08B 2OVQB 3HGLA 4X63B 4J2AA 4DTJA 2H14A 2E31A 4FK2A 3KD1E 4QT8A 4EYWA 4A08A 4RL5A 4J0XA 4JSPC 4A7JA 3P4FA 5GSAA 1K8KC 4CZYA 2BCJB 3I7KA 4LG8A 3I8EA 3SPYA 3K27A 3I7HA 3NCIA 2PM7B 2PFVA 1FZIE 1FS1A 2AGWA 3PSCB 3A0FA 5IC7A 3QEPA 2ATQA 5EM2B 1VYHC 1GP2B 4ERYA 3UVKA 5EM2A 3AFCA 1U2VC 3V5WB 4K3ID 2P1PB 1IH7A 5GXHA 3HFQA 3UVOA 4FJGA 5EALA 3LDBA 3EI1B 1Q9XA 4FJMA 4GQBB 1A0RB 2I0RA 2JH9A 5JWZA 1XHMA 3EI1A 3AL9A 3OL2B 1PI6A 1R5MA 5B4WA 5THAA 3SBRA 4X5MA 1Q9YA 4FA1D 3SFZA 3TAGA 3S9HA 4CY3A 4CZXA 4FVMA 4EWRA 2H3XA 2P9SC 2H6QA 4JSXC 4ZOYA 3VGZA 2LF3A 3RMAA 4KI6A 4KHQA 4A2MA 2P9NC 4KFMB 3NAEA 5K1CC 4IMMA 3UR4A 3I7PA 5CYKB 1U4CA 2I0TA 1SHYB 2QXVA 3ORVD 4OWRA 4PC0A 5CYKA 4ERQA 4ES0A 5C2WB 2BBKH 3CFSB 4EPHA 4QNCA 3SPZA 3MKQA 3I7NA 4J79A 4ESGA 3NHGA 3QESA 4Y5RD 2Z2PA 1XVGE 3MXXA 2P1NB 1K32A 2YNPA 2MMBA 1QNIA 5C9ZB 4AKHA 3L4MD 4FJ9A 1YFQA 4JS4A 2P5OA 4O3UB 4E3SA 1MG2A 3EG6A 3NVNA 4ZOXA 3J27A 2J57G 4JRPA 1MHYG 1ERJA 1B9XA 1N6DA 3EI2B 1MDAH 1FZHE 2H9LA 3RRMC 4CY1A 5A2Qg 3NDKA 3PE7A 2P1MB 3EI2A 1XKSA 2XU7A 3OKTA 3I8CA 3OKYA 4I9QA 3N1BA 2B5LA 2I3SA 4FAND 3C6OB 4FB1D 4GM9A 5FKRA 2AGXA 1XVBE 1CLQA 3E4YA 3AL8B 4J77A 3JZNA 3KRXB 1FZ4E 4RNGA 3AL8A 3L4OD 2P5GA 3F3PA 4GAMC 5EARA 3RLMD 3RN1D 5KDOB 2OYQA 3EU7A 3PXTD 4M3UA 1SQJA 4CI2A 3E0CA 4M3TA 3V7DB 5SXMA 3CFRA 3RWUA 3SI6A 4QNDA 2CE8A 3KRWB 3QERA 5K19A 4JSVC 4LG9A 4I9LA 1FZ8E 3JB9L 1OLZA 2CN3A 4JT6C 2H4TA 3SUOA 4M3RA 3QNNA 4FK0A 4M3YA 3JAMg 3CQ8A 4M42A 3TJYA 4J86A 5TF2A 3CFPA 4I79A 5H37A 5IJ7E 3C6PB 3F3GA 4O45A 1FZ3E 4X61B 4QQEA 1FZ6E 3PVWB 2JHAA 3RMDA 4KHNA 3J81g 1XMGE 3BG1A 3RN0D 3C9CA 1FZ9E 3J80g 3EI3B 1FWXA 3N0EA 4BUJC 3EWEA 3EI3A 4L3GD 2YNNA 2VIXA 2FYOA 2HD0A 4E54B 3SXTD 3UKUC 5HE2B 3UIQA 2YB8B 4E54A 2DY4A 3NVXA 4O3TB 5FKTA 4J87A 4ZOZA 1WAJA 1XVCE 4CC9A 3VH0A 2Z2NA 3JROA 3SCYA 3SHFA 3QEWA 4FHLA 4J78A 5H14A 2PBIB 2GC7A 3J2PA 3IKOA 1LDKE 4ADOA 3AH8B 3RMBA 3UVLA 3LD8A 2HKRA 4M45A 1TBGA 3WSOA 3OL2A 2OZMA 1MMOG 5FXYA 3QEXA 4J73A 5H17A 3TAFA 4HCBA 2B5MA 3RFHA 4GGDA 4FA4D 5C2VB 4J82A 4U1EI 2EBSA 4U7AA 1N6EA 2B5NA 4FJHA 4TZ4A 4HCCA 2H6KA 3NVQA 2DTUA 2IUPA 3C5MA 3EMHA 1IG9A 2AH0A 2P9IC 4FJ5A 2B8IA 4AOWA 1XVEE 3EI4B 4L9OA 1L0QA 3C99A 2XL3A 2JPNA 3EI4A 4A09B 2RCUA 5H1MA 4PBYA 2YBAA 4FAVD 4A09A 3PXSD 2H9PA 4DU4A 4M3ZA 1FZ2E 3SQ4A 3FRXA 4AI6A 2IAAA 3L2OB 3SVIA 3JRPA 5HE0B 2HESX 2Q7QA 4QRJA 3CFVA 4JT5C 4JSNC 3OGKB 4AKGA 4O9DA 4A0AB 4CY5A 1PGUA 4E4BA 3DWLC 3IIWA 5HYNB 3GREA 2H13A 5GMKn 1XL3C 3UVNA 2CE9A 3OTTA 1SQ9A 4J0WA 2TRCB 4DTUA 2H68A 2JHCA 5IREA 4A11B 4FA9D 4A0BB 5IT9g 1N6FA 4PSXB 3ODTA 2H6NA 4DTXA 4A11A 2AH1A 3VA6A 4I6JB 5EMMB 3SMRA 3MMYA 4DTNA 3DM0A 1PEVA 4L3HD 4PSWB 3CIKB 2P9LC 3HP9A 3UKRC 3E4WA 4ERZA 5FKQA 4A2LA 3LDSA 3NGIA 2LF6A 2VJ4A 4M41A 2HJBA 3DXKC 3PVUB 4BL0A 2H9NA 4JD2C 3IJ1A 2UZXB 3B7FA 4J84A 3OKWA 3MKSB 3TAEA 2H47A 1FZ1E 4J2EA 2AGYA 3C6NB 2MTAH 2P1QB 4GM3A 3K2OA 4O1QD 4Y7RA 4L1QD 2XL2A 3QEIA 3C95A 4M3XA 2GNQA 3K26A 4NSXA 5AJAA 2YMUA 3SBPA 4D0KA 3SLED 4HDJA 3W15A 4KHYA 3HL8A 3F3FA 4XEIC 4ZN4A 3L1NA 2OVPB 5EMKB 1GXRA 1S4UX 4J2DA 4FK4A 3RMCA 2XYIA 5CXCB 4DTSA 4H5JA 5EAMA 2OJYA 3SBQA 2HJ4A 5CXCA 4QL1A 3ULEC 3SWSD 2MZWB 2JHPA 2CN2A 4J8BA 5CXBB 3QNOA 2HXCA 2CO0C 5FLXg 2IUVA 5EMLB 1XMFE 5CXBA 4XYHA 1GG2B 3V9FA 4JRQA 2QXFA 3TABA 4YVDA 1NEXB 3OW8A 4M3WA 3MZLA 3I89A 1FYZE 2GC4A 1XU5E 2I0SA 2B4EA 5I5MA 3FGBA 3U4YA 1P22A 2CO0A 3SNNA 1FZ5E 2HKMA 4H5IA 4DTRA 4PXWA 4CI3A 2OVRB 4LGNA 1RI6A 2AGZA 4Z8LA 3SJLD 3I2NA 2YB5A 1NR0A 4J8GA 3N1EA 4XYIA 3QETA 2B1EA 2J55H 3JZHA 3RFGA 1FZ0E 3BWSA 3SUQA 4FWWA 2OIZA 5FKSA 5AMSA 2W18A 4R7AB 3SQ1A 3C94A 4UI9R 1JMZB 5IZ7A 3NE6A 4FJKA 4CZVA 2PFTA 4J2BA 3FM0A 2G9AA 2HYEA 2P9KC 4FJJA 4X5NA 4DU3A 4AEZA 2YNOA 3JZGA 2DEBA 5IGQA 5I5JA 4GQ1A 2AQ5A 3SQ0A 2Z2OA 3LZJA 5EMJB 1XVFE 1MG3A 5TEFA 1MHZG 4RG8A 4FJIA 4CI8A 4KHWA 5EAPA 3OGLB 4FA5D 2G99A 5AFU3 2VJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGM B;  2E32 A;  2H9M A;  4JXM A;  2IUQ A;  4GGA A;  3RSE C;  3IIY A;  4A0A A;  3SN6 B;  4X3E A;  2CNX A;  2OK4 A;  1B9Y A;  2I3T A;  4PNK B;  2QC5 A;  2IUR A;  4GQ2 P;  4GMB A;  3RMZ D;  2J56 H;  4A0B A;  5HQG A;  3JPX A;  3UVM A;  4PBZ A;  4BH6 A;  4CY2 A;  2PM6 B;  5HE1 B;  2PM9 B;  3DSM A;  3OKY B;  3C75 H;  4K3J B;  2PM9 A;  1XIP A;  3DXM C;  1PBY B;  3BG0 A;  3IJ0 A;  3PSL A;  3IJC A;  1OMW B;  3ZWL B;  4GM8 A;  4OZU A;  2UZY B;  3MZK A;  5FA5 B;  2IWK A;  3GFC A;  1Q47 A;  4MK0 B;  5IGO A;  2P1O B;  4GGC A;  2O9K A;  4J81 A;  2OK6 A;  3N0D A;  2P9P C;  1JJU B;  5IJ8 E;  2AGL A;  4X60 B;  4E5Z B;  1JOF A;  5HE3 B;  4G56 B;  2IWF A;  4GZ8 A;  5I5I A;  4E5Z A;  5GXI A;  3PXW D;  2P9U C;  5TDH B;  4CI1 A;  4ZOV A;  3SVW D;  1GOT B;  4IA9 A;  5FQD A;  3I7O A;  1TYQ C;  3I7L A;  5TEE A;  4D6V A;  4N14 A;  5IBK B;  1JMX B;  4A08 B;  2OVQ B;  4X63 B;  2H14 A;  2E31 A;  4QT8 A;  4A08 A;  4J0X A;  4JSP C;  4A7J A;  3P4F A;  5GSA A;  1K8K C;  4CZY A;  2BCJ B;  3I7K A;  4LG8 A;  3I8E A;  3K27 A;  3I7H A;  2PM7 B;  1FS1 A;  2AGW A;  3PSC B;  3A0F A;  5IC7 A;  5EM2 B;  1VYH C;  1GP2 B;  4ERY A;  3UVK A;  5EM2 A;  3AFC A;  1U2V C;  3V5W B;  4K3I D;  2P1P B;  5GXH A;  3HFQ A;  3UVO A;  5EAL A;  3EI1 B;  4GQB B;  1A0R B;  2I0R A;  5JWZ A;  1XHM A;  3EI1 A;  3AL9 A;  3OL2 B;  1PI6 A;  1R5M A;  5B4W A;  5THA A;  3SBR A;  4FA1 D;  3SFZ A;  4CY3 A;  4CZX A;  4EWR A;  2H3X A;  2P9S C;  2H6Q A;  4JSX C;  4ZOY A;  3VGZ A;  4A2M A;  2P9N C;  4KFM B;  5K1C C;  4IMM A;  3UR4 A;  3I7P A;  5CYK B;  1U4C A;  2I0T A;  1SHY B;  2QXV A;  3ORV D;  4OWR A;  4PC0 A;  5CYK A;  4ERQ A;  4ES0 A;  5C2W B;  2BBK H;  3CFS B;  3MKQ A;  4ESG A;  4J79 A;  3I7N A;  4Y5R D;  2Z2P A;  3MXX A;  2P1N B;  1K32 A;  2YNP A;  1QNI A;  5C9Z B;  3L4M D;  1YFQ A;  4O3U B;  3EG6 A;  1MG2 A;  3NVN A;  4ZOX A;  2J57 G;  1ERJ A;  1B9X A;  1N6D A;  3EI2 B;  1MDA H;  2H9L A;  3RRM C;  4CY1 A;  5A2Q g;  3PE7 A;  2P1M B;  3EI2 A;  1XKS A;  2XU7 A;  3OKT A;  3I8C A;  3OKY A;  2B5L A;  2I3S A;  4FAN D;  3C6O B;  4FB1 D;  4GM9 A;  5FKR A;  2AGX A;  3AL8 B;  4J77 A;  3JZN A;  3KRX B;  3AL8 A;  3L4O D;  3F3P A;  5EAR A;  3RLM D;  3RN1 D;  5KDO B;  3EU7 A;  3PXT D;  1SQJ A;  4CI2 A;  3E0C A;  3V7D B;  5SXM A;  2CE8 A;  3KRW B;  5K19 A;  4JSV C;  4LG9 A;  3JB9 L;  1OLZ A;  2CN3 A;  4JT6 C;  3JAM g;  4J86 A;  5TF2 A;  4I79 A;  5IJ7 E;  3F3G A;  3C6P B;  4O45 A;  4X61 B;  4QQE A;  3PVW B;  3J81 g;  3RN0 D;  3BG1 A;  3C9C A;  3J80 g;  3EI3 B;  1FWX A;  3N0E A;  4BUJ C;  3EWE A;  3EI3 A;  4L3G D;  2YNN A;  4E54 B;  3SXT D;  3UKU C;  5HE2 B;  2YB8 B;  4E54 A;  3NVX A;  4O3T B;  5FKT A;  4J87 A;  4ZOZ A;  4CC9 A;  3VH0 A;  2Z2N A;  3JRO A;  3SCY A;  3SHF A;  4FHL A;  4J78 A;  5H14 A;  2PBI B;  2GC7 A;  3IKO A;  1LDK E;  3AH8 B;  3UVL A;  2HKR A;  3OL2 A;  1TBG A;  3WSO A;  5FXY A;  4J73 A;  5H17 A;  2B5M A;  4FA4 D;  3RFH A;  4GGD A;  5C2V B;  4J82 A;  4U1E I;  2EBS A;  4U7A A;  1N6E A;  2B5N A;  4TZ4 A;  2H6K A;  3NVQ A;  2IUP A;  3C5M A;  3EMH A;  2AH0 A;  2P9I C;  4AOW A;  3EI4 B;  4L9O A;  1L0Q A;  3C99 A;  2XL3 A;  3EI4 A;  4A09 B;  5H1M A;  4PBY A;  2YBA A;  4FAV D;  4A09 A;  3PXS D;  2H9P A;  3FRX A;  2IAA A;  3L2O B;  3JRP A;  5HE0 B;  2HES X;  2Q7Q A;  4QRJ A;  3CFV A;  4JT5 C;  4JSN C;  3OGK B;  4O9D A;  4A0A B;  4CY5 A;  1PGU A;  3DWL C;  3IIW A;  5HYN B;  3GRE A;  2H13 A;  5GMK n;  3UVN A;  2CE9 A;  3OTT A;  1SQ9 A;  4J0W A;  2TRC B;  2H68 A;  4A11 B;  4FA9 D;  4A0B B;  5IT9 g;  1N6F A;  4PSX B;  3ODT A;  2H6N A;  4A11 A;  2AH1 A;  3VA6 A;  4I6J B;  5EMM B;  3SMR A;  3MMY A;  3DM0 A;  1PEV A;  4L3H D;  4PSW B;  3CIK B;  2P9L C;  3UKR C;  4ERZ A;  5FKQ A;  4A2L A;  2HJB A;  3DXK C;  3PVU B;  4BL0 A;  2H9N A;  4JD2 C;  4J84 A;  2UZX B;  3B7F A;  3IJ1 A;  3OKW A;  3MKS B;  2H47 A;  2AGY A;  3C6N B;  2MTA H;  2P1Q B;  4GM3 A;  4O1Q D;  4Y7R A;  4L1Q D;  2XL2 A;  3K26 A;  4NSX A;  2GNQ A;  5AJA A;  2YMU A;  3SBP A;  4D0K A;  3SLE D;  4HDJ A;  3W15 A;  3F3F A;  4ZN4 A;  4XEI C;  2OVP B;  5EMK B;  1GXR A;  1S4U X;  2XYI A;  5CXC B;  4H5J A;  5EAM A;  2OJY A;  3SBQ A;  2HJ4 A;  5CXC A;  4QL1 A;  3ULE C;  3SWS D;  2CN2 A;  4J8B A;  5CXB B;  2HXC A;  2CO0 C;  5FLX g;  2IUV A;  5EML B;  5CXB A;  4XYH A;  1GG2 B;  3V9F A;  4YVD A;  1NEX B;  3OW8 A;  3MZL A;  3I89 A;  2GC4 A;  2I0S A;  2B4E A;  5I5M A;  3FGB A;  3U4Y A;  1P22 A;  2CO0 A;  4H5I A;  2HKM A;  4PXW A;  4CI3 A;  2OVR B;  4LGN A;  1RI6 A;  2AGZ A;  4Z8L A;  3SJL D;  3I2N A;  1NR0 A;  4J8G A;  4XYI A;  2J55 H;  3JZH A;  3RFG A;  3BWS A;  4FWW A;  2OIZ A;  5FKS A;  5AMS A;  2W18 A;  4R7A B;  4UI9 R;  1JMZ B;  4CZV A;  3FM0 A;  2G9A A;  2HYE A;  2P9K C;  4AEZ A;  2YNO A;  3JZG A;  5IGQ A;  5I5J A;  4GQ1 A;  2AQ5 A;  2Z2O A;  5EMJ B;  1MG3 A;  5TEF A;  4CI8 A;  5EAP A;  3OGL B;  4FA5 D;  2G99 A;  5AFU 3; 
#chains in the Genus database with same CATH topology
 3OGM B;  2QR5 A;  3O4I A;  1WAF A;  2E32 A;  2H9M A;  2OZS A;  4JXM A;  2IUQ A;  4IT5 A;  4GGA A;  4NBM A;  3RSE C;  4NC4 A;  3CFO A;  3UO3 A;  3IIY A;  3QEV A;  4A0A A;  3SN6 B;  4X3E A;  2CNX A;  2OK4 A;  1B9Y A;  2I3T A;  4DTO A;  4DTM A;  4PNK B;  2QC5 A;  2IUR A;  4GQ2 P;  4AKI A;  4KI4 A;  4GMB A;  4KHU A;  3RMZ D;  1QFS A;  2J56 H;  5HQG A;  4A0B A;  3JPX A;  3UVM A;  4PBZ A;  4BH6 A;  4CY2 A;  2PM6 B;  4BCD A;  5HE1 B;  2PM9 B;  3DSM A;  2JQT A;  3C75 H;  3OKY B;  3DDU A;  4K3J B;  3TL8 B;  5M5S A;  2B7M A;  2PM9 A;  1XIP A;  3DXM C;  1PBY B;  1M1X A;  2EIE A;  3BG0 A;  3IJ0 A;  3PSL A;  2VDQ A;  1OMW B;  3IJC A;  4BCB A;  3OF7 A;  3VI4 A;  3ZWL B;  4GM8 A;  4OZU A;  4DTP A;  3KD5 E;  2EIB A;  3SUN A;  1JV2 A;  2UZY B;  4IRZ A;  3MZK A;  5FA5 B;  2IWK A;  3GFC A;  3SUP A;  1Q47 A;  4MK0 B;  1FZ7 E;  3L0M A;  2P1O B;  4DU1 A;  2JH8 A;  4EP9 A;  3EQ9 A;  5IGO A;  4GGC A;  2O9K A;  3L8B A;  4J81 A;  1VZ3 A;  2OK6 A;  3N0D A;  3K71 A;  4FJ8 A;  4B08 A;  3K6S A;  4ADN A;  3SCX A;  2P9P C;  3SJJ A;  3HGK E;  1JJU B;  2VDP A;  5IJ8 E;  3LZI A;  2AGL A;  4NEN A;  4X60 B;  4E5Z B;  1JOF A;  5HE3 B;  4G56 B;  4FJN A;  2IWF A;  4GZ8 A;  5I5I A;  1XVD E;  3VI3 A;  1XMH E;  4E5Z A;  2FW3 A;  4JS5 A;  4FJ7 A;  1MTY G;  5GXI A;  3PXW D;  2P9U C;  4WK0 A;  5TDH B;  1FXX A;  4CI1 A;  4ZOV A;  5C92 A;  3SVW D;  1GOT B;  4FJL A;  4FJX A;  4IA9 A;  3UO2 A;  5FQD A;  3I7O A;  1TYQ C;  4G55 A;  4KHS A;  1TYE A;  3I7L A;  5TEE A;  4D6V A;  3SQ2 A;  4N14 A;  1XU3 E;  5IBK B;  1JMX B;  4A08 B;  2OVQ B;  3HGL A;  4X63 B;  4J2A A;  4DTJ A;  1BPO A;  2E31 A;  2H14 A;  3ZDX A;  5E6U A;  4FK2 A;  3KD1 E;  4QT8 A;  4EYW A;  4A08 A;  4RL5 A;  4J0X A;  4JSP C;  4A7J A;  3P4F A;  5GSA A;  3EI1 A;  1K8K C;  4CZY A;  2BCJ B;  3I7K A;  4LG8 A;  3MVD K;  3I8E A;  3SPY A;  3K27 A;  3I7H A;  3NCI A;  2PM7 B;  5E6R A;  2PFV A;  4AMY A;  1FZI E;  1FS1 A;  2AGW A;  3PSC B;  3A0F A;  2EIC A;  4Z7N A;  1H2Y A;  4JHN A;  3QEP A;  2ATQ A;  5IC7 A;  5EM2 B;  1VYH C;  1GP2 B;  4ERY A;  3UVK A;  5EM2 A;  1FPO A;  2HU5 A;  3AFC A;  5E6S A;  1U2V C;  2BKL A;  3V5W B;  4K3I D;  2P1P B;  1IH7 A;  5GXH A;  3HFQ A;  3UVO A;  4FJG A;  5EAL A;  3LDB A;  3EI1 B;  1Q9X A;  4FJM A;  3FCS A;  4GQB B;  5M5T A;  1A0R B;  2I0R A;  2JH9 A;  5JWZ A;  1XHM A;  5M5V A;  1VZ2 A;  3AL9 A;  1PI6 A;  1R5M A;  3OL2 B;  5B4W A;  5THA A;  4X5M A;  1Q9Y A;  1H2W A;  3K72 A;  3SBR A;  3TAG A;  3S9H A;  3FCU A;  3SFZ A;  4FVM A;  4CY3 A;  4CZX A;  4FA1 D;  4EWR A;  1UOO A;  2H3X A;  2P9S C;  2H6Q A;  2HU7 A;  4JSX C;  4ZOY A;  3VGZ A;  2LF3 A;  3RMA A;  4KI6 A;  4KHQ A;  3ZDZ A;  4QAM A;  4A2M A;  2P9N C;  4KFM B;  3NAE A;  5K1C C;  3NIG A;  4AMZ A;  1VE7 A;  4IMM A;  3UR4 A;  3I7P A;  5CYK B;  4DNU A;  1U4C A;  2I0T A;  1SHY B;  2QXV A;  3ORV D;  4OWR A;  4PC0 A;  5CYK A;  4ERQ A;  4ES0 A;  5C2W B;  2BBK H;  3CFS B;  4EPH A;  4QNC A;  3SPZ A;  3MKQ A;  3I7N A;  3NIF A;  4J79 A;  3T3M A;  4ESG A;  3NHG A;  3QES A;  4Y5R D;  2Z2P A;  4DNW A;  4AN1 A;  1XVG E;  3MXX A;  1JW2 A;  2P1N B;  1K32 A;  2YNP A;  2MMB A;  1QNI A;  5FFO A;  5C9Z B;  4AKH A;  3L4M D;  4FJ9 A;  1YFQ A;  1E8M A;  4JS4 A;  2VDL A;  2P5O A;  4L1M A;  4O3U B;  4E3S A;  1MG2 A;  3EG6 A;  3NVN A;  4ZOX A;  2HU8 A;  3IUN A;  3J27 A;  2J57 G;  4JRP A;  1MHY G;  1U8C A;  1ERJ A;  1B9X A;  1N6D A;  3EI2 B;  1MDA H;  1FZH E;  2H9L A;  3RRM C;  4CY1 A;  5A2Q g;  3NDK A;  3PE7 A;  3GC3 B;  3ZE2 A;  4BCC A;  2P1M B;  3EI2 A;  1XKS A;  1O6F A;  2XU7 A;  3I8C A;  3OKT A;  3OKY A;  4I9Q A;  3N1B A;  2B5L A;  2I3S A;  3V4V A;  3C6O B;  4FB1 D;  1E5T A;  4GM9 A;  5FKR A;  4FAN D;  2AGX A;  1XVB E;  1CLQ A;  3E4Y A;  3AL8 B;  4J77 A;  3JZN A;  3KRX B;  1FZ4 E;  4RNG A;  2VDO A;  3AL8 A;  3L4O D;  2P5G A;  3F3P A;  4GAM C;  5EAR A;  3RLM D;  1JTD B;  3RN1 D;  5KDO B;  2OYQ A;  3EU7 A;  3PXT D;  4M3U A;  1SQJ A;  3V4P A;  1N1C A;  4CI2 A;  3E0C A;  4M3T A;  3V7D B;  5SXM A;  3CFR A;  3RWU A;  3SI6 A;  4QND A;  2CE8 A;  1UOQ A;  3KRW B;  3QER A;  5K19 A;  4JSV C;  4O2W A;  3MUN A;  4LG9 A;  4I9L A;  1FZ8 E;  1VE6 A;  3JB9 L;  3IJE A;  4D9S A;  2EID A;  1OLZ A;  2CN3 A;  4JT6 C;  2H4T A;  3SUO A;  4AN0 A;  4M3R A;  1E8N A;  3QNN A;  4FK0 A;  4M3Y A;  4MMZ A;  3JAM g;  3CQ8 A;  4M42 A;  3TJY A;  4J86 A;  5TF2 A;  3CFP A;  5M5R A;  4I79 A;  5H37 A;  5IJ7 E;  3C6P B;  3F3G A;  4O45 A;  3IUJ A;  1QFM A;  1FZ3 E;  4X61 B;  3IUR A;  4QQE A;  1FZ6 E;  4WK2 A;  3PVW B;  2JHA A;  2VDK A;  3RMD A;  4KHN A;  3J81 g;  1XMG E;  3BG1 A;  3RN0 D;  1GOG A;  3C9C A;  1GOH A;  4ICG C;  3GD1 I;  1FZ9 E;  3J80 g;  3EI3 B;  1FWX A;  3N0E A;  4BUJ C;  3EWE A;  3EI3 A;  4L3G D;  2YNN A;  2VIX A;  2FYO A;  2VZ1 A;  2HD0 A;  4E54 B;  3SXT D;  3UKU C;  5HE2 B;  3UIQ A;  2YB8 B;  4E54 A;  2DY4 A;  3NVX A;  4O3T B;  5FKT A;  2VDN A;  4J87 A;  4ZOZ A;  1WAJ A;  1XVC E;  4CC9 A;  2VDM A;  3VH0 A;  2Z2N A;  3JRO A;  3QI0 A;  3SCY A;  2VC2 A;  3SHF A;  3BVO A;  3QEW A;  4FHL A;  4J78 A;  3ZE1 A;  4BP9 A;  4Z7Q A;  5H14 A;  2PBI B;  2GC7 A;  3J2P A;  3IKO A;  1LDK E;  4ADO A;  1C9L A;  3RMB A;  3AH8 B;  3LD8 A;  2HKR A;  3EQ8 A;  3UVL A;  1K3I A;  4M45 A;  1TBG A;  3WSO A;  2MW2 A;  3OL2 A;  2QZP A;  2OZM A;  5M61 A;  1MMO G;  5FXY A;  3QEX A;  4J73 A;  5H17 A;  3TAF A;  4HCB A;  2B5M A;  3RFH A;  4GGD A;  4MMY A;  4FA4 D;  1A12 A;  5C2V B;  4J82 A;  4U1E I;  2EBS A;  4U7A A;  1N6E A;  2XZG A;  2B5N A;  4FJH A;  5M5U A;  4TZ4 A;  4HCC A;  2H6K A;  3NVQ A;  3O4G A;  2DTU A;  2IUP A;  3C5M A;  3EMH A;  1IG9 A;  2AH0 A;  3IUL A;  2P9I C;  4FJ5 A;  2B8I A;  1YR2 A;  4AOW A;  1XVE E;  3EI4 B;  4L9O A;  1L0Q A;  3C99 A;  2XL3 A;  2JPN A;  3EI4 A;  4A09 B;  2RCU A;  5H1M A;  4PBY A;  1UOP A;  2YBA A;  4FAV D;  3IVM A;  1I2M B;  3PXS D;  2H9P A;  4RE5 A;  4A09 A;  4DU4 A;  4M3Z A;  1O6G A;  4DNV A;  1FZ2 E;  3SQ4 A;  3FRX A;  4BP8 A;  4AI6 A;  2IAA A;  3L2O B;  4UM8 A;  3SVI A;  3JRP A;  5HE0 B;  2HES X;  2Q7Q A;  5HDB A;  4UM9 A;  4QRJ A;  3CFV A;  4JT5 C;  4JSN C;  3OGK B;  4AKG A;  4O9D A;  4A0A B;  4CY5 A;  1PGU A;  4E4B A;  3DWL C;  3T3P A;  3IIW A;  5HYN B;  3GRE A;  2H13 A;  5GMK n;  1XL3 C;  3UVN A;  2CE9 A;  3OTT A;  1SQ9 A;  4J0W A;  1H2X A;  2TRC B;  4DTU A;  2H68 A;  2JHC A;  3ZE0 A;  5IRE A;  4A11 B;  3NID A;  4FA9 D;  4A0B B;  5IT9 g;  1N6F A;  4PSX B;  3ODT A;  2H6N A;  4G1M A;  4DTX A;  4A11 A;  2AH1 A;  3VA6 A;  4I6J B;  5EMM B;  3SMR A;  3MMY A;  4DTN A;  3DM0 A;  1PEV A;  4L3H D;  4PSW B;  3CIK B;  2P9L C;  4WK4 A;  3HP9 A;  3UKR C;  3E4W A;  4ERZ A;  5FKQ A;  4A2L A;  3LDS A;  3NGI A;  2LF6 A;  2VJ4 A;  4M41 A;  2HJB A;  3DXK C;  3PVU B;  4BL0 A;  2H9N A;  2XE4 A;  3IUM A;  4JD2 C;  3IJ1 A;  2UZX B;  2VZ3 A;  3B7F A;  3OKW A;  3MKS B;  3TAE A;  4J84 A;  4MMX A;  2H47 A;  4AX4 A;  1FZ1 E;  4J2E A;  2AGY A;  3C6N B;  4JHP C;  2MTA H;  2P1Q B;  3O4H A;  3K2O A;  4GM3 A;  4O1Q D;  4L1Q D;  4Y7R A;  2XL2 A;  3QEI A;  3C95 A;  4M3X A;  2GNQ A;  2WQ8 A;  3K26 A;  4NSX A;  3QHY B;  3ZDY A;  1UTC A;  5AJA A;  2YMU A;  4WJK A;  2JKX A;  3SBP A;  4D0K A;  4RE6 A;  4HDJ A;  3SLE D;  4KHY A;  4O02 A;  3KCI A;  3W15 A;  3HL8 A;  3F3F A;  4XEI C;  3O4J A;  4ZN4 A;  3L1N A;  2OVP B;  5EMK B;  1GXR A;  1S4U X;  4J2D A;  4FK4 A;  5FFG A;  3RMC A;  2RKH A;  2XYI A;  5CXC B;  4DTS A;  4H5J A;  5EAM A;  2OJY A;  2XDW A;  3SBQ A;  2HJ4 A;  5CXC A;  4QL1 A;  3ULE C;  3SWS D;  2MZW B;  2JHP A;  2CN2 A;  1C9I A;  4J8B A;  1H2Z A;  5CXB B;  3QNO A;  2HXC A;  2CO0 C;  5FLX g;  2IUV A;  2K5S A;  5EML B;  1XMF E;  5CXB A;  4XYH A;  1GG2 B;  3V9F A;  4JRQ A;  2QXF A;  3TAB A;  4YVD A;  1NEX B;  3OW8 A;  4M3W A;  3MZL A;  3I89 A;  1FYZ E;  2GC4 A;  1XU5 E;  2I0S A;  1L5G A;  2B4E A;  2VDR A;  5I5M A;  3FGB A;  3U4Y A;  1P22 A;  2CO0 A;  3SNN A;  1FZ5 E;  2HKM A;  4H5I A;  4DTR A;  4PXW A;  4CI3 A;  2OVR B;  4LGN A;  3IUQ A;  1RI6 A;  2AGZ A;  3EQ7 A;  4Z8L A;  3SJL D;  3I2N A;  2YB5 A;  1NR0 A;  4J8G A;  3N1E A;  4XYI A;  3QET A;  4NAA A;  2B1E A;  2J55 H;  3JZH A;  3RFG A;  1FZ0 E;  3BWS A;  3SUQ A;  4FWW A;  5C86 A;  2OIZ A;  5FKS A;  5AMS A;  2W18 A;  3MUO A;  4R7A B;  3SQ1 A;  3C94 A;  4G1E A;  4UI9 R;  1JMZ B;  5IZ7 A;  3NE6 A;  4FJK A;  4CZV A;  2PFT A;  4J2B A;  1GOF A;  3FM0 A;  2G9A A;  2HYE A;  2P9K C;  4FJJ A;  4X5N A;  4DU3 A;  1T2X A;  4AEZ A;  2YNO A;  3JZG A;  2DEB A;  5IGQ A;  5I5J A;  4GQ1 A;  2AQ5 A;  3SQ0 A;  2Z2O A;  3LZJ A;  5EMJ B;  1XVF E;  1MG3 A;  5TEF A;  1MHZ G;  4Z7O A;  4RG8 A;  4FJI A;  4CI8 A;  4KHW A;  5EAP A;  3OGL B;  4FA5 D;  2G99 A;  5AFU 3;  2VJ5 A; 
#chains in the Genus database with same CATH homology
 3OGM B;  1WAF A;  2E32 A;  2H9M A;  2OZS A;  4JXM A;  2IUQ A;  4GGA A;  3RSE C;  3CFO A;  3IIY A;  3QEV A;  4A0A A;  3SN6 B;  4X3E A;  2CNX A;  2OK4 A;  1B9Y A;  2I3T A;  4DTO A;  4DTM A;  4PNK B;  2QC5 A;  2IUR A;  4GQ2 P;  4AKI A;  4KI4 A;  4GMB A;  4KHU A;  3RMZ D;  2J56 H;  4A0B A;  5HQG A;  3JPX A;  3UVM A;  4PBZ A;  4BH6 A;  4CY2 A;  2PM6 B;  5HE1 B;  2PM9 B;  3DSM A;  3OKY B;  3C75 H;  4K3J B;  3TL8 B;  2B7M A;  2PM9 A;  1XIP A;  3DXM C;  1PBY B;  3BG0 A;  3IJ0 A;  3PSL A;  3IJC A;  1OMW B;  3ZWL B;  4GM8 A;  4OZU A;  4DTP A;  3KD5 E;  2UZY B;  3SUN A;  3MZK A;  5FA5 B;  2IWK A;  3GFC A;  3SUP A;  1Q47 A;  4MK0 B;  1FZ7 E;  3L0M A;  2P1O B;  4DU1 A;  2JH8 A;  4EP9 A;  5IGO A;  4GGC A;  2O9K A;  3L8B A;  4J81 A;  2OK6 A;  3N0D A;  4FJ8 A;  4B08 A;  4ADN A;  3SCX A;  2P9P C;  3SJJ A;  3HGK E;  1JJU B;  5IJ8 E;  3LZI A;  2AGL A;  4X60 B;  4E5Z B;  1JOF A;  5HE3 B;  4G56 B;  4FJN A;  2IWF A;  4GZ8 A;  5I5I A;  1XVD E;  1XMH E;  4E5Z A;  2FW3 A;  4JS5 A;  4FJ7 A;  1MTY G;  5GXI A;  3PXW D;  2P9U C;  5TDH B;  1FXX A;  4CI1 A;  4ZOV A;  3SVW D;  1GOT B;  4FJL A;  4FJX A;  4IA9 A;  5FQD A;  3I7O A;  1TYQ C;  4KHS A;  3I7L A;  5TEE A;  4D6V A;  3SQ2 A;  4N14 A;  1XU3 E;  5IBK B;  1JMX B;  4A08 B;  2OVQ B;  3HGL A;  4X63 B;  4J2A A;  4DTJ A;  2H14 A;  2E31 A;  4FK2 A;  3KD1 E;  4QT8 A;  4EYW A;  4A08 A;  4RL5 A;  4J0X A;  4JSP C;  4A7J A;  3P4F A;  5GSA A;  1K8K C;  4CZY A;  2BCJ B;  3I7K A;  4LG8 A;  3I8E A;  3SPY A;  3K27 A;  3I7H A;  3NCI A;  2PM7 B;  2PFV A;  1FZI E;  1FS1 A;  2AGW A;  3PSC B;  3A0F A;  5IC7 A;  3QEP A;  2ATQ A;  5EM2 B;  1VYH C;  1GP2 B;  4ERY A;  3UVK A;  5EM2 A;  3AFC A;  1U2V C;  3V5W B;  4K3I D;  2P1P B;  1IH7 A;  5GXH A;  3HFQ A;  3UVO A;  4FJG A;  5EAL A;  3LDB A;  3EI1 B;  1Q9X A;  4FJM A;  4GQB B;  1A0R B;  2I0R A;  2JH9 A;  5JWZ A;  1XHM A;  3EI1 A;  3AL9 A;  3OL2 B;  1PI6 A;  1R5M A;  5B4W A;  5THA A;  3SBR A;  4X5M A;  1Q9Y A;  4FA1 D;  3SFZ A;  3TAG A;  3S9H A;  4CY3 A;  4CZX A;  4FVM A;  4EWR A;  2H3X A;  2P9S C;  2H6Q A;  4JSX C;  4ZOY A;  3VGZ A;  2LF3 A;  3RMA A;  4KI6 A;  4KHQ A;  4A2M A;  2P9N C;  4KFM B;  3NAE A;  5K1C C;  4IMM A;  3UR4 A;  3I7P A;  5CYK B;  1U4C A;  2I0T A;  1SHY B;  2QXV A;  3ORV D;  4OWR A;  4PC0 A;  5CYK A;  4ERQ A;  4ES0 A;  5C2W B;  2BBK H;  3CFS B;  4EPH A;  4QNC A;  3SPZ A;  3MKQ A;  3I7N A;  4J79 A;  4ESG A;  3NHG A;  3QES A;  4Y5R D;  2Z2P A;  1XVG E;  3MXX A;  2P1N B;  1K32 A;  2YNP A;  2MMB A;  1QNI A;  5C9Z B;  4AKH A;  3L4M D;  4FJ9 A;  1YFQ A;  4JS4 A;  2P5O A;  4O3U B;  4E3S A;  1MG2 A;  3EG6 A;  3NVN A;  4ZOX A;  3J27 A;  2J57 G;  4JRP A;  1MHY G;  1ERJ A;  1B9X A;  1N6D A;  3EI2 B;  1MDA H;  1FZH E;  2H9L A;  3RRM C;  4CY1 A;  5A2Q g;  3NDK A;  3PE7 A;  2P1M B;  3EI2 A;  1XKS A;  2XU7 A;  3OKT A;  3I8C A;  3OKY A;  4I9Q A;  3N1B A;  2B5L A;  2I3S A;  4FAN D;  3C6O B;  4FB1 D;  4GM9 A;  5FKR A;  2AGX A;  1XVB E;  1CLQ A;  3E4Y A;  3AL8 B;  4J77 A;  3JZN A;  3KRX B;  1FZ4 E;  4RNG A;  3AL8 A;  3L4O D;  2P5G A;  3F3P A;  4GAM C;  5EAR A;  3RLM D;  3RN1 D;  5KDO B;  2OYQ A;  3EU7 A;  3PXT D;  4M3U A;  1SQJ A;  4CI2 A;  3E0C A;  4M3T A;  3V7D B;  5SXM A;  3CFR A;  3RWU A;  3SI6 A;  4QND A;  2CE8 A;  3KRW B;  3QER A;  5K19 A;  4JSV C;  4LG9 A;  4I9L A;  1FZ8 E;  3JB9 L;  1OLZ A;  2CN3 A;  4JT6 C;  2H4T A;  3SUO A;  4M3R A;  3QNN A;  4FK0 A;  4M3Y A;  3JAM g;  3CQ8 A;  4M42 A;  3TJY A;  4J86 A;  5TF2 A;  3CFP A;  4I79 A;  5H37 A;  5IJ7 E;  3C6P B;  3F3G A;  4O45 A;  1FZ3 E;  4X61 B;  4QQE A;  1FZ6 E;  3PVW B;  2JHA A;  3RMD A;  4KHN A;  3J81 g;  1XMG E;  3BG1 A;  3RN0 D;  3C9C A;  1FZ9 E;  3J80 g;  3EI3 B;  1FWX A;  3N0E A;  4BUJ C;  3EWE A;  3EI3 A;  4L3G D;  2YNN A;  2VIX A;  2FYO A;  2HD0 A;  4E54 B;  3SXT D;  3UKU C;  5HE2 B;  3UIQ A;  2YB8 B;  4E54 A;  2DY4 A;  3NVX A;  4O3T B;  5FKT A;  4J87 A;  4ZOZ A;  1WAJ A;  1XVC E;  4CC9 A;  3VH0 A;  2Z2N A;  3JRO A;  3SCY A;  3SHF A;  3QEW A;  4FHL A;  4J78 A;  5H14 A;  2PBI B;  2GC7 A;  3J2P A;  3IKO A;  1LDK E;  4ADO A;  3AH8 B;  3RMB A;  3UVL A;  3LD8 A;  2HKR A;  4M45 A;  1TBG A;  3WSO A;  3OL2 A;  2OZM A;  1MMO G;  5FXY A;  3QEX A;  4J73 A;  5H17 A;  3TAF A;  4HCB A;  2B5M A;  3RFH A;  4GGD A;  4FA4 D;  5C2V B;  4J82 A;  4U1E I;  2EBS A;  4U7A A;  1N6E A;  2B5N A;  4FJH A;  4TZ4 A;  4HCC A;  2H6K A;  3NVQ A;  2DTU A;  2IUP A;  3C5M A;  3EMH A;  1IG9 A;  2AH0 A;  2P9I C;  4FJ5 A;  2B8I A;  4AOW A;  1XVE E;  3EI4 B;  4L9O A;  1L0Q A;  3C99 A;  2XL3 A;  2JPN A;  3EI4 A;  4A09 B;  2RCU A;  5H1M A;  4PBY A;  2YBA A;  4FAV D;  4A09 A;  3PXS D;  2H9P A;  4DU4 A;  4M3Z A;  1FZ2 E;  3SQ4 A;  3FRX A;  4AI6 A;  2IAA A;  3L2O B;  3SVI A;  3JRP A;  5HE0 B;  2HES X;  2Q7Q A;  4QRJ A;  3CFV A;  4JT5 C;  4JSN C;  3OGK B;  4AKG A;  4O9D A;  4A0A B;  4CY5 A;  1PGU A;  4E4B A;  3DWL C;  3IIW A;  5HYN B;  3GRE A;  2H13 A;  5GMK n;  1XL3 C;  3UVN A;  2CE9 A;  3OTT A;  1SQ9 A;  4J0W A;  2TRC B;  4DTU A;  2H68 A;  2JHC A;  5IRE A;  4A11 B;  4FA9 D;  4A0B B;  5IT9 g;  1N6F A;  4PSX B;  3ODT A;  2H6N A;  4DTX A;  4A11 A;  2AH1 A;  3VA6 A;  4I6J B;  5EMM B;  3SMR A;  3MMY A;  4DTN A;  3DM0 A;  1PEV A;  4L3H D;  4PSW B;  3CIK B;  2P9L C;  3HP9 A;  3UKR C;  3E4W A;  4ERZ A;  5FKQ A;  4A2L A;  3LDS A;  3NGI A;  2LF6 A;  2VJ4 A;  4M41 A;  2HJB A;  3DXK C;  3PVU B;  4BL0 A;  2H9N A;  4JD2 C;  3IJ1 A;  2UZX B;  3B7F A;  4J84 A;  3OKW A;  3MKS B;  3TAE A;  2H47 A;  1FZ1 E;  4J2E A;  2AGY A;  3C6N B;  2MTA H;  2P1Q B;  4GM3 A;  3K2O A;  4O1Q D;  4Y7R A;  4L1Q D;  2XL2 A;  3QEI A;  3C95 A;  4M3X A;  2GNQ A;  3K26 A;  4NSX A;  5AJA A;  2YMU A;  3SBP A;  4D0K A;  3SLE D;  4HDJ A;  3W15 A;  4KHY A;  3HL8 A;  3F3F A;  4XEI C;  4ZN4 A;  3L1N A;  2OVP B;  5EMK B;  1GXR A;  1S4U X;  4J2D A;  4FK4 A;  3RMC A;  2XYI A;  5CXC B;  4DTS A;  4H5J A;  5EAM A;  2OJY A;  3SBQ A;  2HJ4 A;  5CXC A;  4QL1 A;  3ULE C;  3SWS D;  2MZW B;  2JHP A;  2CN2 A;  4J8B A;  5CXB B;  3QNO A;  2HXC A;  2CO0 C;  5FLX g;  2IUV A;  5EML B;  1XMF E;  5CXB A;  4XYH A;  1GG2 B;  3V9F A;  4JRQ A;  2QXF A;  3TAB A;  4YVD A;  1NEX B;  3OW8 A;  4M3W A;  3MZL A;  3I89 A;  1FYZ E;  2GC4 A;  1XU5 E;  2I0S A;  2B4E A;  5I5M A;  3FGB A;  3U4Y A;  1P22 A;  2CO0 A;  3SNN A;  1FZ5 E;  2HKM A;  4H5I A;  4DTR A;  4PXW A;  4CI3 A;  2OVR B;  4LGN A;  1RI6 A;  2AGZ A;  4Z8L A;  3SJL D;  3I2N A;  2YB5 A;  1NR0 A;  4J8G A;  3N1E A;  4XYI A;  3QET A;  2B1E A;  2J55 H;  3JZH A;  3RFG A;  1FZ0 E;  3BWS A;  3SUQ A;  4FWW A;  2OIZ A;  5FKS A;  5AMS A;  2W18 A;  4R7A B;  3SQ1 A;  3C94 A;  4UI9 R;  1JMZ B;  5IZ7 A;  3NE6 A;  4FJK A;  4CZV A;  2PFT A;  4J2B A;  3FM0 A;  2G9A A;  2HYE A;  2P9K C;  4FJJ A;  4X5N A;  4DU3 A;  4AEZ A;  2YNO A;  3JZG A;  2DEB A;  5IGQ A;  5I5J A;  4GQ1 A;  2AQ5 A;  3SQ0 A;  2Z2O A;  3LZJ A;  5EMJ B;  1XVF E;  1MG3 A;  5TEF A;  1MHZ G;  4RG8 A;  4FJI A;  4CI8 A;  4KHW A;  5EAP A;  3OGL B;  4FA5 D;  2G99 A;  5AFU 3;  2VJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...