2OVPB

Structure of the skp1-fbw7 complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
444
structure length
441
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 122
structure length 441
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovpB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovpB02
2HJ4A 4J87A 3PVUB 4QQEA 3MXXA 4GMBA 3SVWD 1PBYB 3IKOA 2B5MA 2HKRA 2E32A 4L3HD 3C6NB 3OL2A 1P22A 4CZYA 3SWSD 3P4FA 2P1PB 2B4EA 5AMSA 4FAND 3I7HA 4TZ4A 3SCYA 3I7KA 4PXWA 3SFZA 4K3ID 3V9FA 2OVPB 4XYHA 1NR0A 2P9IC 3JROA 5FKQA 4FWWA 3UR4A 4A2MA 2J56H 4A09B 2IWFA 3CFSB 1JMZB 3K26A 2AH0A 3EU7A 4J81A 3SXTD 5C9ZB 3AL9A 4FB1D 3N0DA 2QXVA 4HDJA 5AFU3 2O9KA 2AGXA 3I89A 3KRXB 4PSWB 2AGWA 2BBKH 4QL1A 2P9UC 1XKSA 3UVOA 2P9KC 4J86A 2H47A 1JOFA 3SJLD 1QNIA 4JSXC 2TRCB 4JXMA 2BCJB 3I7NA 5IGOA 4MK0B 4X61B 5GMKn 2P9PC 4ZOZA 3EI1A 2XU7A 3DWLC 3I7PA 3JZGA 1YFQA 2I0RA 2YNOA 3E0CA 3JZNA 2PM9A 4IMMA 1TBGA 3V5WB 2B5LA 2IUVA 5CYKA 4X3EA 2I3TA 3OL2B 1GP2B 3PSCB 4BL0A 2B5NA 2H13A 1N6FA 5IGQA 4H5IA 3IIYA 3MMYA 3OKYA 5TEFA 5A2Qg 4GGCA 4FA4D 3ODTA 3JB9L 3A0FA 3EI2A 3AFCA 3JPXA 4J73A 3EMHA 5HE1B 3F3GA 2AH1A 3K27A 5I5JA 3JZHA 3OGMB 4A11A 4GM8A 5FKSA 5HYNB 2H14A 3I7OA 4CI3A 5EMJB 2IAAA 3I2NA 3PXSD 4IA9A 3C6PB 4JT5C 5IC7A 4CZXA 4FA9D 2OK4A 3EWEA 3SN6B 4J82A 2H6QA 5EMKB 3U4YA 4PNKB 3EG6A 1K8KC 4A2LA 5EARA 3EI1B 4JD2C 5FQDA 4J79A 2P1OB 3SHFA 3L4MD 3C75H 3PE7A 1MG2A 4A0AB 2H68A 4J0WA 4K3JB 5TF2A 5H17A 2PM9B 3L4OD 2CE9A 4FAVD 3SMRA 1U4CA 5FA5B 5CYKB 3I8EA 2AGLA 2E31A 5C2WB 4H5JA 5I5MA 4GQ1A 2H9NA 4NSXA 5EMLB 3OKYB 4OZUA 2OJYA 1XHMA 5K1CC 1JMXB 4YVDA 2OIZA 4KFMB 3MZLA 4CY2A 3GREA 5SXMA 5THAA 4CC9A 4ES0A 3CIKB 4LG8A 2H9LA 4U1EI 3N0EA 1NEXB 3JRPA 2IWKA 1OMWB 4A11B 3AH8B 4E5ZA 4ZN4A 4CY3A 4XEIC 3C6OB 2Q7QA 3PSLA 4O1QD 2AGZA 2I0TA 3UVNA 3OGKB 3MZKA 3C99A 1XIPA 2I0SA 2P9NC 2AGYA 2J57G 1B9YA 3NVXA 1SQ9A 2HJBA 5CXCA 1ERJA 2YNPA 3SBRA 4JSVC 5EM2A 4PC0A 2CN2A 2AQ5A 2CN3A 2UZXB 4A7JA 4Y5RD 2H9MA 5HE0B 2YB8B 2GNQA 3W15A 1S4UX 2CO0A 3PVWB 4U7AA 3RMZD 1K32A 1FS1A 4G56B 3UKUC 3J81g 3CFVA 5H1MA 3UVKA 5KDOB 1GXRA 3F3FA 2CO0C 3PXWD 5EMMB 5EAMA 4E5ZB 2XYIA 3IJ0A 3IJ1A 4A08A 1FWXA 3HFQA 2XL2A 5B4WA 3IIWA 3RN0D 1PGUA 4CY1A 4JT6C 3L2OB 4L1QD 5IBKB 2HYEA 5IT9g 2OVQB 3J80g 3PXTD 4ERQA 1LDKE 4Y7RA 3I7LA 3RLMD 5CXBA 5FKRA 3VH0A 1MG3A 4FA1D 2HXCA 4AEZA 3VGZA 3F3PA 2P1NB 4XYIA 5EM2B 3AL8A 3RSEC 5H14A 3BWSA 4CY5A 5GXHA 1L0QA 5C2VB 4CI1A 4J84A 3RFGA 3DM0A 3OKTA 4BUJC 1GG2B 3KRWB 2J55H 1MDAH 4UI9R 4JSNC 2Z2OA 4L3GD 5FLXg 3SBQA 3C5MA 3OKWA 2GC4A 1U2VC 3OGLB 3FM0A 4J78A 3EI2B 5JWZA 3DXMC 2I3SA 3OTTA 4J8BA 3BG0A 3ORVD 3DXKC 4BH6A 3JAMg 2PBIB 2GC7A 4O45A 2YBAA 2EBSA 4JSPC 2G99A 2UZYB 3EI4A 4X60B 5TDHB 3MKQA 1PEVA 1Q47A 1SHYB 2P9SC 2P9LC 4D6VA 1JJUB 2P1QB 3IJCA 4J77A 5HE2B 5GSAA 2OK6A 3RFHA 4A08B 3EI3A 4CI8A 3RRMC 1PI6A 3BG1A 1R5MA 4CZVA 4ERYA 5I5IA 4CI2A 4GQBB 3MKSB 5GXIA 4QRJA 3NVNA 2HESX 2IUPA 5CXBB 4E54A 4PBZA 3DSMA 4A0BA 3WSOA 3UKRC 2OVRB 4I6JB 3B7FA 2YMUA 3AL8B 2P1MB 3I8CA 4AOWA 5AJAA 1VYHC 2XL3A 4A0AA 4X63B 4OWRA 4O9DA 4O3UB 4GGAA 4R7AB 3VA6A 2PM7B 5FKTA 1TYQC 4D0KA 4J0XA 2YNNA 5EALA 4LGNA 5HQGA 4ERZA 5EAPA 2G9AA 4GM9A 2H6KA 1OLZA 4PBYA 4EWRA 2H9PA 2W18A 5HE3B 1N6DA 4N14A 4PSXB 3SLED 5IJ7E 2Z2NA 4FHLA 4I79A 4ZOYA 4GM3A 3FGBA 2H3XA 1GOTB 4ZOVA 4GGDA 3EI4B 3UVMA 4A09A 1RI6A 2IURA 2MTAH 2QC5A 4LG9A 2IUQA 4ZOXA 3V7DB 2CNXA 2H6NA 2HKMA 4ESGA 2Z2PA 3GFCA 5TEEA 4FA5D 1B9XA 3EI3B 1A0RB 4L9OA 2PM6B 3C9CA 4J8GA 2CE8A 3NVQA 4GZ8A 3ZWLB 4GQ2P 5IJ8E 5K19A 1SQJA 4QT8A 1N6EA 4O3TB 5CXCB 4E54B 5FXYA 4Z8LA 3OW8A 3ULEC 4A0BB 3SBPA 3UVLA 3RN1D 3FRXA
chains in the Genus database with same CATH superfamily
2HJ4A 4J87A 4DU4A 1XU5E 1JW2A 3PVUB 4QQEA 3C95A 2ATQA 3MXXA 4DTUA 4GMBA 3SVWD 1PBYB 2K5SA 5C86A 3SUPA 3IKOA 4AX4A 2B5MA 2YB5A 2HKRA 2E32A 4L3HD 3C6NB 4M45A 2OZSA 3OL2A 2JHPA 1P22A 4NAAA 4DTSA 4CZYA 3SWSD 3P4FA 4KHUA 3RWUA 2P1PB 4DTPA 3HL8A 4KHSA 3SI6A 4J2DA 1UOQA 2B4EA 5AMSA 1WAFA 3I7HA 4QNCA 4TZ4A 3SCYA 4FAND 3I7KA 4PXWA 3SFZA 4K3ID 3V9FA 2JKXA 2EIEA 2HD0A 3SPYA 4I9QA 3O4HA 2OVPB 5IREA 4XYHA 2JHCA 1NR0A 2P9IC 3ZE0A 3JROA 5FKQA 4FWWA 3UR4A 4A2MA 2J56H 4A09B 1H2XA 2EICA 2IWFA 3CFSB 1JMZB 3KD5E 3K26A 2AH0A 2VDPA 3EU7A 4J81A 3SXTD 5C9ZB 4BCDA 4NBMA 3AL9A 3SJJA 4FB1D 3N0DA 4RNGA 2XDWA 2QXVA 4HDJA 5AFU3 2O9KA 3K2OA 1VE6A 2AGXA 3I89A 3KRXB 4PSWB 2AGWA 3SCXA 1FZ6E 2BBKH 4QL1A 2P9UC 1JV2A 1XKSA 2HU8A 1FZ0E 1XL3C 3UVOA 2P9KC 4J86A 2H47A 1JOFA 3SJLD 1BPOA 1QNIA 3L1NA 2TRCB 1JTDB 4JSXC 3E4YA 2BCJB 3I7NA 4JXMA 3ZDXA 4DNVA 3SQ0A 1O6GA 5IGOA 4MK0B 4X61B 5GMKn 2P9PC 4KHWA 4RE6A 4ZOZA 3EI1A 2XU7A 3DWLC 3GD1I 3I7PA 3JZGA 4AKGA 4MMZA 1YFQA 3NAEA 2I0RA 2QR5A 2YNOA 3E0CA 3JZNA 2PM9A 4JHPC 4IMMA 1UOPA 1TBGA 4ADOA 3V5WB 2B5LA 2IUVA 5CYKA 4X3EA 2I3TA 3OL2B 1GP2B 3PSCB 4E3SA 3T3PA 4BL0A 2B5NA 2H13A 1N6FA 3HGKE 4JHNA 2JH9A 3TAEA 5IGQA 4H5IA 3QESA 3IIYA 2QXFA 3MMYA 1XVBE 3QNOA 3OKYA 5TEFA 4FJ5A 4ICGC 4FJ7A 5A2Qg 4GGCA 4BP8A 4EP9A 5HDBA 4FA4D 3KD1E 3ODTA 3JB9L 1YR2A 5M5VA 4DTXA 3A0FA 3EI2A 3QEIA 3IJEA 3AFCA 3JPXA 1I2MB 1UTCA 4J73A 3EMHA 2P5GA 5HE1B 3F3GA 4A08B 2AH1A 3K27A 1MHYG 5I5JA 2VDLA 4M3WA 3JZHA 3OGMB 4A11A 4FJLA 4GM8A 3EQ7A 5FKSA 3LDSA 5HYNB 4EPHA 3SQ4A 2H14A 4DU1A 3I7OA 4CI3A 3EQ8A 2IAAA 5EMJB 3I2NA 3PXSD 3K72A 4FJHA 1FZ2E 4RE5A 4IA9A 2VZ1A 3C6PB 3FCSA 4NC4A 3CFRA 4FJMA 4KHYA 1FZ4E 4JT5C 5IC7A 4CZXA 4FA9D 2OK4A 3NCIA 4QNDA 3EWEA 3SN6B 4J82A 3FRXA 2EIBA 2H6QA 2VC2A 5EMKB 3U4YA 4M41A 4NENA 4PNKB 3EG6A 1K8KC 3VI4A 4DTMA 4A2LA 1A12A 5EARA 3EI1B 4JD2C 5FQDA 4J79A 2B7MA 2P1OB 3L4MD 3SHFA 3EQ9A 3C75H 3PE7A 1MG2A 4A0AB 2H68A 4J0WA 4K3JB 4J2BA 4FJJA 4DTNA 5E6SA 2B1EA 5TF2A 5H17A 1XVDE 4E4BA 3ZE2A 2PM9B 4X5MA 3IUJA 4WJKA 3L4OD 4G1EA 4MMYA 2CE9A 4FAVD 3SMRA 3LDBA 1U4CA 5FA5B 5CYKB 1FZ9E 3I8EA 4BCBA 3GC3B 2VZ3A 1K3IA 3UO2A 4UM9A 1U8CA 2AGLA 3VI3A 3ZDZA 2E31A 5C2WB 4H5JA 5I5MA 1XVEE 3TAGA 2H9NA 3LD8A 4GQ1A 1C9IA 4NSXA 5EMLB 1XVFE 3OKYB 1O6FA 4OZUA 2DTUA 2OJYA 1XHMA 2P5OA 4KI4A 1JMXB 4YVDA 1VZ3A 2JHAA 2OIZA 4KFMB 1MMOG 5K1CC 4X5NA 3MZLA 4CY2A 2OYQA 3GREA 4G1MA 3S9HA 5SXMA 2VDOA 3NDKA 4AI6A 5THAA 4CC9A 4ES0A 3CIKB 4LG8A 3CQ8A 2H9LA 4U1EI 5M5SA 3N0EA 1NEXB 3J27A 3JRPA 2MW2A 4FJIA 4DNUA 2JPNA 2IWKA 2PFVA 1OMWB 4A11B 3AH8B 4E5ZA 1FPOA 4QAMA 4ZN4A 3N1EA 1TYEA 4CY3A 1XMGE 4XEIC 1UOOA 3RMCA 3C6OB 3RMBA 4AKIA 4AN0A 2PFTA 4O2WA 2Q7QA 1FZIE 4AMYA 4FJXA 3SQ1A 1E8MA 3PSLA 4O1QD 2XZGA 4FJ9A 2AGZA 2I0TA 1M1XA 3UVNA 3OGKB 4M42A 3MZKA 4DTJA 3C99A 1XIPA 4I9LA 2I0SA 2P9NC 2AGYA 2J57G 2RCUA 1B9YA 3QERA 5M61A 3NVXA 4Z7NA 4BP9A 1SQ9A 2HJBA 2VJ5A 4DU3A 5CXCA 1ERJA 3QETA 1MTYG 2YNPA 3SBRA 4JSVC 5EM2A 1H2ZA 3QHYB 2BKLA 4PC0A 3MVDK 3KCIA 2CN2A 2MZWB 2AQ5A 1MHZG 2CN3A 2UZXB 4A7JA 1XMHE 4Y5RD 4WK4A 1FZ1E 2FYOA 3DDUA 2VDRA 3IUQA 4B08A 2H9MA 2VDMA 5HE0B 1GOGA 2YB8B 4J2EA 4M3XA 3L8BA 2GNQA 3SQ2A 3W15A 1S4UX 2CO0A 3PVWB 4U7AA 3RMZD 1CLQA 1K32A 1FS1A 3NIDA 4DTOA 4G56B 3UKUC 1FZHE 3J81g 1L5GA 3CFVA 3IULA 5H37A 2OZMA 5H1MA 3UVKA 5KDOB 1GXRA 3F3FA 3SNNA 2CO0C 5E6RA 3PXWD 5EMMB 3SPZA 1GOFA 3TJYA 5EAMA 4E5ZB 2XYIA 3IJ0A 4FJ8A 3IJ1A 4A08A 1FWXA 3HFQA 4G55A 2XL2A 5B4WA 4WK0A 3IIWA 3RN0D 3LZJA 1PGUA 4CY1A 3TAFA 3QNNA 4JT6C 3L2OB 4GAMC 5IBKB 4L1QD 4EYWA 1Q9YA 3SBPA 2HYEA 2OVQB 5IT9g 3J80g 3PXTD 3CFOA 1XU3E 4ERQA 4DNWA 1LDKE 3NE6A 3IURA 5FFGA 3NIFA 4Y7RA 3I7LA 4FK4A 3MUNA 3QEVA 3RLMD 2H4TA 5CXBA 3LZIA 3BVOA 5FKRA 3VH0A 3IVMA 1MG3A 4M3RA 4JRQA 2RKHA 2HXCA 4MMXA 4AEZA 1T2XA 3QEWA 4FA1D 5M5UA 4FJNA 5IZ7A 3VGZA 3F3PA 2EIDA 1FZ5E 4ADNA 2P1NB 4XYIA 5EM2B 3AL8A 3RSEC 5H14A 1WAJA 5M5RA 3BWSA 4FJGA 1FZ7E 4CY5A 1H2WA 4AMZA 1L0QA 5C2VB 4CI1A 4J84A 4UM8A 5GXHA 3T3MA 3RFGA 4D9SA 3DM0A 3TABA 3OKTA 4L1MA 4Z7QA 3RMDA 4BUJC 1GG2B 4WK2A 3KRWB 2J55H 1MDAH 4UI9R 4JSNC 2Z2OA 4L3GD 4RL5A 5FLXg 3K6SA 3SBQA 3C5MA 3OKWA 2JQTA 2VDKA 2GC4A 1U2VC 3OGLB 3FM0A 4KHQA 1VE7A 4J78A 3EI2B 5JWZA 3DXMC 2I3SA 1FYZE 2LF3A 3OTTA 4J8BA 4HCCA 3BG0A 3ORVD 3V4PA 3DXKC 4IT5A 3SUNA 4BH6A 3JAMg 2GC7A 2PBIB 4O45A 2YBAA 5M5TA 2EBSA 4FVMA 3SUOA 4JSPC 2G99A 2UZYB 3EI4A 4X60B 5TDHB 1C9LA 3MKQA 1PEVA 1Q47A 5FFOA 1SHYB 2P9SC 2MMBA 3HGLA 2P9LC 4D6VA 1VZ2A 3SUQA 1N1CA 4AKHA 3L0MA 1JJUB 2P1QB 3IJCA 1QFMA 4J77A 5HE2B 3CFPA 1FXXA 2OK6A 3RFHA 5GSAA 3EI3A 4HCBA 4CI8A 3RRMC 4M3UA 1Q9XA 2QZPA 1PI6A 3BG1A 1R5MA 4CZVA 3OF7A 5C92A 4FJKA 4ERYA 4CI2A 4GQBB 5I5IA 3MKSB 5GXIA 4QRJA 3IUMA 3NVNA 2HESX 2IUPA 1FZ8E 5CXBB 4E54A 4PBZA 1FZ3E 3E4WA 1GOHA 3DSMA 4A0BA 3WSOA 3UKRC 2WQ8A 2OVRB 4I6JB 2VIXA 3O4IA 3QI0A 3B7FA 2YMUA 3J2PA 4JS4A 3AL8B 2P1MB 4JS5A 3I8CA 1QFSA 4AOWA 5AJAA 1VYHC 2XL3A 2VDNA 4A0AA 4KI6A 4X63B 4OWRA 4O9DA 2VJ4A 3NGIA 4GGAA 4O3UB 4R7AB 3VA6A 2PM7B 5FKTA 1TYQC 4D0KA 2HU5A 3TL8B 4J0XA 2YNNA 5EALA 4LGNA 5HQGA 4ERZA 5EAPA 2G9AA 4DTRA 4GM9A 2H6KA 1OLZA 4PBYA 3ZDYA 4EWRA 3NHGA 2H9PA 1E8NA 3SVIA 3MUOA 2W18A 5HE3B 2FW3A 1N6DA 4N14A 4PSXB 3SLED 5IJ7E 2Z2NA 4FHLA 4I79A 4ZOYA 4JRPA 1IH7A 3C94A 2B8IA 3UIQA 3RMAA 4FK0A 4GM3A 4O02A 3FGBA 2H3XA 1GOTB 4ZOVA 3UO3A 3ZE1A 4GGDA 2LF6A 4FK2A 3EI4B 2VDQA 4IRZA 3UVMA 3QEXA 3O4JA 4A09A 1RI6A 2IURA 2MTAH 2QC5A 4LG9A 2XE4A 2IUQA 3NIGA 1E5TA 4BCCA 4M3ZA 4J2AA 3FCUA 4M3TA 1XMFE 2DEBA 4ZOXA 3V7DB 2CNXA 2H6NA 2HKMA 2HU7A 2Z2PA 3GFCA 5TEEA 4ESGA 4Z7OA 4FA5D 1IG9A 1B9XA 1XVCE 3EI3B 1A0RB 4L9OA 1XVGE 2JH8A 2PM6B 3C9CA 4KHNA 2DY4A 4J8GA 3QEPA 2CE8A 3K71A 3NVQA 4GZ8A 1H2YA 4GQ2P 3ZWLB 5IJ8E 5K19A 1SQJA 4QT8A 1N6EA 4O3TB 5E6UA 4M3YA 5CXCB 4E54B 3HP9A 3IUNA 5FXYA 4Z8LA 3OW8A 4AN1A 3N1BA 3ULEC 4A0BB 3O4GA 3V4VA 3UVLA 3RN1D 4RG8A
chains in the Genus database with same CATH topology
2HJ4A 4J87A 4DU4A 1XU5E 3PVUB 4QQEA 3C95A 2ATQA 3MXXA 4DTUA 4GMBA 3SVWD 1PBYB 3SUPA 3IKOA 2B5MA 2YB5A 2HKRA 2E32A 4L3HD 3C6NB 4M45A 2OZSA 3OL2A 2JHPA 1P22A 4DTSA 4CZYA 3SWSD 3P4FA 4KHUA 3RWUA 2P1PB 4DTPA 3HL8A 4KHSA 3SI6A 4J2DA 2B4EA 5AMSA 1WAFA 3I7HA 4QNCA 4TZ4A 3SCYA 4FAND 3I7KA 4PXWA 3SFZA 4K3ID 3V9FA 2HD0A 3SPYA 4I9QA 2OVPB 5IREA 4XYHA 2JHCA 1NR0A 2P9IC 3JROA 5FKQA 4FWWA 3UR4A 4A2MA 2J56H 4A09B 2IWFA 3CFSB 1JMZB 3KD5E 3K26A 2AH0A 3EU7A 4J81A 3SXTD 5C9ZB 3AL9A 3SJJA 4FB1D 3N0DA 4RNGA 2QXVA 4HDJA 5AFU3 2O9KA 3K2OA 2AGXA 3I89A 3KRXB 4PSWB 2AGWA 3SCXA 1FZ6E 2BBKH 4QL1A 2P9UC 1XKSA 1FZ0E 1XL3C 3UVOA 2P9KC 4J86A 2H47A 1JOFA 3SJLD 1QNIA 3L1NA 2TRCB 4JSXC 4JXMA 3E4YA 2BCJB 3I7NA 3SQ0A 5IGOA 4MK0B 4X61B 5GMKn 2P9PC 4KHWA 4ZOZA 3EI1A 2XU7A 3DWLC 3I7PA 3JZGA 4AKGA 1YFQA 3NAEA 2I0RA 2YNOA 3E0CA 3JZNA 2PM9A 4IMMA 1TBGA 4ADOA 3V5WB 2B5LA 2IUVA 5CYKA 4X3EA 2I3TA 3OL2B 1GP2B 3PSCB 4E3SA 4BL0A 2B5NA 2H13A 1N6FA 3HGKE 2JH9A 3TAEA 5IGQA 4H5IA 3QESA 3IIYA 2QXFA 3MMYA 1XVBE 3QNOA 3OKYA 5TEFA 4FJ5A 4FJ7A 5A2Qg 4GGCA 4EP9A 4FA4D 3KD1E 3ODTA 3JB9L 4DTXA 3A0FA 3EI2A 3QEIA 3AFCA 3JPXA 4J73A 3EMHA 2P5GA 5HE1B 3F3GA 4A08B 2AH1A 3K27A 1MHYG 5I5JA 4M3WA 3JZHA 3OGMB 4A11A 4FJLA 4GM8A 5FKSA 3LDSA 5HYNB 4EPHA 3SQ4A 2H14A 4DU1A 3I7OA 4CI3A 5EMJB 2IAAA 3I2NA 3PXSD 4FJHA 1FZ2E 4IA9A 3C6PB 3CFRA 4FJMA 4KHYA 1FZ4E 4JT5C 5IC7A 4CZXA 4FA9D 2OK4A 3NCIA 4QNDA 3EWEA 3SN6B 4J82A 3FRXA 2H6QA 5EMKB 3U4YA 4M41A 4PNKB 3EG6A 1K8KC 4DTMA 4A2LA 5EARA 3EI1B 4JD2C 5FQDA 4J79A 2B7MA 2P1OB 3L4MD 3SHFA 3C75H 3PE7A 1MG2A 4A0AB 2H68A 4J0WA 4K3JB 4J2BA 4FJJA 4DTNA 5TF2A 2B1EA 5H17A 1XVDE 4E4BA 2PM9B 4X5MA 3L4OD 2CE9A 4FAVD 3SMRA 3LDBA 1U4CA 5FA5B 5CYKB 1FZ9E 3I8EA 2AGLA 2E31A 5C2WB 4H5JA 5I5MA 1XVEE 3TAGA 2H9NA 3LD8A 4GQ1A 4NSXA 5EMLB 1XVFE 3OKYB 4OZUA 2DTUA 2OJYA 1XHMA 2P5OA 4KI4A 1JMXB 4YVDA 5K1CC 2JHAA 2OIZA 4KFMB 1MMOG 4X5NA 3MZLA 4CY2A 2OYQA 3GREA 3S9HA 5SXMA 3NDKA 4AI6A 5THAA 4CC9A 4ES0A 3CIKB 4LG8A 3CQ8A 2H9LA 4U1EI 3N0EA 1NEXB 3J27A 3JRPA 4FJIA 2JPNA 2IWKA 2PFVA 1OMWB 4A11B 3AH8B 4E5ZA 4ZN4A 3N1EA 4CY3A 1XMGE 4XEIC 3RMCA 3C6OB 3RMBA 4AKIA 2PFTA 2Q7QA 1FZIE 4FJXA 3SQ1A 3PSLA 4O1QD 4FJ9A 2AGZA 2I0TA 3UVNA 3OGKB 4M42A 3MZKA 4DTJA 3C99A 1XIPA 4I9LA 2I0SA 2P9NC 2AGYA 2J57G 2RCUA 1B9YA 3QERA 3NVXA 1SQ9A 2HJBA 2VJ5A 4DU3A 5CXCA 1ERJA 3QETA 1MTYG 2YNPA 3SBRA 4JSVC 5EM2A 4PC0A 2CN2A 2MZWB 2AQ5A 1MHZG 2CN3A 2UZXB 4A7JA 1XMHE 4Y5RD 1FZ1E 2FYOA 4B08A 2H9MA 5HE0B 2YB8B 4J2EA 4M3XA 3L8BA 2GNQA 3SQ2A 3W15A 1S4UX 2CO0A 3PVWB 4U7AA 3RMZD 1CLQA 1K32A 1FS1A 4DTOA 4G56B 3UKUC 1FZHE 3J81g 3CFVA 5H37A 2OZMA 5H1MA 3UVKA 5KDOB 1GXRA 3F3FA 3SNNA 2CO0C 3PXWD 5EMMB 3SPZA 5EAMA 3TJYA 4E5ZB 2XYIA 3IJ0A 4FJ8A 3IJ1A 4A08A 1FWXA 3HFQA 2XL2A 5B4WA 3IIWA 3RN0D 3LZJA 1PGUA 4CY1A 3TAFA 3QNNA 4JT6C 3L2OB 4GAMC 5IBKB 4L1QD 4EYWA 1Q9YA 2HYEA 5IT9g 2OVQB 3J80g 3PXTD 3CFOA 1XU3E 4ERQA 1LDKE 3NE6A 4Y7RA 3I7LA 4FK4A 3RLMD 3QEVA 2H4TA 5CXBA 3LZIA 5FKRA 3VH0A 1MG3A 4M3RA 4JRQA 4FA1D 2HXCA 4AEZA 3QEWA 4FJNA 5IZ7A 3VGZA 3F3PA 1FZ5E 4ADNA 2P1NB 4XYIA 5EM2B 3AL8A 3RSEC 5H14A 1WAJA 3BWSA 4FJGA 1FZ7E 4CY5A 5GXHA 1L0QA 5C2VB 4CI1A 4J84A 3RFGA 3DM0A 3TABA 3OKTA 3RMDA 4BUJC 1GG2B 3KRWB 2J55H 1MDAH 4UI9R 4JSNC 2Z2OA 4L3GD 4RL5A 5FLXg 3SBQA 3C5MA 3OKWA 2GC4A 1U2VC 3OGLB 3FM0A 4KHQA 4J78A 3EI2B 5JWZA 3DXMC 2I3SA 1FYZE 2LF3A 3OTTA 4J8BA 4HCCA 3BG0A 3ORVD 3DXKC 3SUNA 4BH6A 3JAMg 2GC7A 2PBIB 4O45A 2YBAA 2EBSA 4FVMA 3SUOA 4JSPC 2G99A 2UZYB 3EI4A 4X60B 5TDHB 3MKQA 1PEVA 1Q47A 1SHYB 2P9SC 2MMBA 3HGLA 2P9LC 4D6VA 3SUQA 4AKHA 3L0MA 1JJUB 2P1QB 3IJCA 4J77A 5HE2B 5GSAA 3CFPA 1FXXA 2OK6A 3RFHA 3EI3A 4HCBA 4CI8A 3RRMC 4M3UA 1Q9XA 1PI6A 3BG1A 1R5MA 4CZVA 4FJKA 4ERYA 4CI2A 4GQBB 5I5IA 3MKSB 5GXIA 4QRJA 3NVNA 2HESX 2IUPA 1FZ8E 5CXBB 4E54A 4PBZA 1FZ3E 3E4WA 3DSMA 4A0BA 3WSOA 3UKRC 2OVRB 4I6JB 2VIXA 3B7FA 2YMUA 3J2PA 4JS4A 3AL8B 2P1MB 4JS5A 3I8CA 4AOWA 5AJAA 1VYHC 2XL3A 4A0AA 4KI6A 4X63B 4OWRA 4O9DA 2VJ4A 3NGIA 4GGAA 4O3UB 4R7AB 3VA6A 2PM7B 5FKTA 1TYQC 4D0KA 3TL8B 4J0XA 2YNNA 5EALA 4LGNA 5HQGA 4ERZA 5EAPA 2G9AA 4DTRA 4GM9A 2H6KA 1OLZA 4PBYA 4EWRA 3NHGA 2H9PA 3SVIA 2W18A 5HE3B 2FW3A 1N6DA 4N14A 4PSXB 3SLED 5IJ7E 2Z2NA 4FHLA 4I79A 4ZOYA 4JRPA 1IH7A 3C94A 2B8IA 3UIQA 3RMAA 4FK0A 4GM3A 3FGBA 2H3XA 1GOTB 4ZOVA 4GGDA 2LF6A 4FK2A 3EI4B 3UVMA 3QEXA 4A09A 1RI6A 2IURA 2MTAH 2QC5A 4LG9A 2IUQA 4M3ZA 4J2AA 4M3TA 1XMFE 2DEBA 4ZOXA 3V7DB 2CNXA 2H6NA 2HKMA 4ESGA 2Z2PA 3GFCA 5TEEA 4FA5D 1IG9A 1B9XA 1XVCE 3EI3B 1A0RB 4L9OA 1XVGE 2JH8A 2PM6B 3C9CA 4KHNA 2DY4A 4J8GA 3QEPA 2CE8A 3NVQA 4GZ8A 3ZWLB 4GQ2P 5IJ8E 5K19A 1SQJA 4QT8A 1N6EA 4O3TB 4M3YA 5CXCB 4E54B 3HP9A 5FXYA 4Z8LA 3OW8A 3N1BA 3ULEC 4A0BB 3SBPA 3UVLA 3RN1D 4RG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ4 A;  4J87 A;  3PVU B;  4QQE A;  3MXX A;  4GMB A;  3SVW D;  1PBY B;  3IKO A;  2B5M A;  2HKR A;  2E32 A;  4L3H D;  3C6N B;  3OL2 A;  1P22 A;  4CZY A;  3SWS D;  3P4F A;  2P1P B;  2B4E A;  5AMS A;  4FAN D;  3I7H A;  4TZ4 A;  3SCY A;  3I7K A;  4PXW A;  3SFZ A;  4K3I D;  3V9F A;  2OVP B;  4XYH A;  1NR0 A;  2P9I C;  3JRO A;  5FKQ A;  4FWW A;  3UR4 A;  4A2M A;  2J56 H;  4A09 B;  2IWF A;  3CFS B;  1JMZ B;  3K26 A;  2AH0 A;  3EU7 A;  4J81 A;  3SXT D;  5C9Z B;  3AL9 A;  4FB1 D;  3N0D A;  2QXV A;  4HDJ A;  5AFU 3;  2O9K A;  2AGX A;  3I89 A;  3KRX B;  4PSW B;  2AGW A;  2BBK H;  4QL1 A;  2P9U C;  1XKS A;  3UVO A;  2P9K C;  4J86 A;  2H47 A;  1JOF A;  3SJL D;  1QNI A;  4JSX C;  2TRC B;  4JXM A;  2BCJ B;  3I7N A;  5IGO A;  4MK0 B;  4X61 B;  5GMK n;  2P9P C;  4ZOZ A;  3EI1 A;  2XU7 A;  3DWL C;  3I7P A;  3JZG A;  1YFQ A;  2I0R A;  2YNO A;  3E0C A;  3JZN A;  2PM9 A;  4IMM A;  1TBG A;  3V5W B;  2B5L A;  2IUV A;  5CYK A;  4X3E A;  2I3T A;  3OL2 B;  1GP2 B;  3PSC B;  4BL0 A;  2B5N A;  2H13 A;  1N6F A;  5IGQ A;  4H5I A;  3IIY A;  3MMY A;  3OKY A;  5TEF A;  5A2Q g;  4GGC A;  4FA4 D;  3ODT A;  3JB9 L;  3A0F A;  3EI2 A;  3AFC A;  3JPX A;  4J73 A;  3EMH A;  5HE1 B;  3F3G A;  2AH1 A;  3K27 A;  5I5J A;  3JZH A;  3OGM B;  4A11 A;  4GM8 A;  5FKS A;  5HYN B;  2H14 A;  3I7O A;  4CI3 A;  5EMJ B;  2IAA A;  3I2N A;  3PXS D;  4IA9 A;  3C6P B;  4JT5 C;  5IC7 A;  4CZX A;  4FA9 D;  2OK4 A;  3EWE A;  3SN6 B;  4J82 A;  2H6Q A;  5EMK B;  3U4Y A;  4PNK B;  3EG6 A;  1K8K C;  4A2L A;  5EAR A;  3EI1 B;  4JD2 C;  5FQD A;  4J79 A;  2P1O B;  3SHF A;  3L4M D;  3C75 H;  3PE7 A;  1MG2 A;  4A0A B;  2H68 A;  4J0W A;  4K3J B;  5TF2 A;  5H17 A;  2PM9 B;  3L4O D;  2CE9 A;  4FAV D;  3SMR A;  1U4C A;  5FA5 B;  5CYK B;  3I8E A;  2AGL A;  2E31 A;  5C2W B;  4H5J A;  5I5M A;  4GQ1 A;  2H9N A;  4NSX A;  5EML B;  3OKY B;  4OZU A;  2OJY A;  1XHM A;  5K1C C;  1JMX B;  4YVD A;  2OIZ A;  4KFM B;  3MZL A;  4CY2 A;  3GRE A;  5SXM A;  5THA A;  4CC9 A;  4ES0 A;  3CIK B;  4LG8 A;  2H9L A;  4U1E I;  3N0E A;  1NEX B;  3JRP A;  2IWK A;  1OMW B;  4A11 B;  3AH8 B;  4E5Z A;  4ZN4 A;  4CY3 A;  4XEI C;  3C6O B;  2Q7Q A;  3PSL A;  4O1Q D;  2AGZ A;  2I0T A;  3UVN A;  3OGK B;  3MZK A;  3C99 A;  1XIP A;  2I0S A;  2P9N C;  2AGY A;  2J57 G;  1B9Y A;  3NVX A;  1SQ9 A;  2HJB A;  5CXC A;  1ERJ A;  2YNP A;  3SBR A;  4JSV C;  5EM2 A;  4PC0 A;  2CN2 A;  2AQ5 A;  2CN3 A;  2UZX B;  4A7J A;  4Y5R D;  2H9M A;  5HE0 B;  2YB8 B;  2GNQ A;  3W15 A;  1S4U X;  2CO0 A;  3PVW B;  4U7A A;  3RMZ D;  1K32 A;  1FS1 A;  4G56 B;  3UKU C;  3J81 g;  3CFV A;  5H1M A;  3UVK A;  5KDO B;  1GXR A;  3F3F A;  2CO0 C;  3PXW D;  5EMM B;  5EAM A;  4E5Z B;  2XYI A;  3IJ0 A;  3IJ1 A;  4A08 A;  1FWX A;  3HFQ A;  2XL2 A;  5B4W A;  3IIW A;  3RN0 D;  1PGU A;  4CY1 A;  4JT6 C;  3L2O B;  4L1Q D;  5IBK B;  2HYE A;  5IT9 g;  2OVQ B;  3J80 g;  3PXT D;  4ERQ A;  1LDK E;  4Y7R A;  3I7L A;  3RLM D;  5CXB A;  5FKR A;  3VH0 A;  1MG3 A;  4FA1 D;  2HXC A;  4AEZ A;  3VGZ A;  3F3P A;  2P1N B;  4XYI A;  5EM2 B;  3AL8 A;  3RSE C;  5H14 A;  3BWS A;  4CY5 A;  5GXH A;  1L0Q A;  5C2V B;  4CI1 A;  4J84 A;  3RFG A;  3DM0 A;  3OKT A;  4BUJ C;  1GG2 B;  3KRW B;  2J55 H;  1MDA H;  4UI9 R;  4JSN C;  2Z2O A;  4L3G D;  5FLX g;  3SBQ A;  3C5M A;  3OKW A;  2GC4 A;  1U2V C;  3OGL B;  3FM0 A;  4J78 A;  3EI2 B;  5JWZ A;  3DXM C;  2I3S A;  3OTT A;  4J8B A;  3BG0 A;  3ORV D;  3DXK C;  4BH6 A;  3JAM g;  2PBI B;  2GC7 A;  4O45 A;  2YBA A;  2EBS A;  4JSP C;  2G99 A;  2UZY B;  3EI4 A;  4X60 B;  5TDH B;  3MKQ A;  1PEV A;  1Q47 A;  1SHY B;  2P9S C;  2P9L C;  4D6V A;  1JJU B;  2P1Q B;  3IJC A;  4J77 A;  5HE2 B;  5GSA A;  2OK6 A;  3RFH A;  4A08 B;  3EI3 A;  4CI8 A;  3RRM C;  1PI6 A;  3BG1 A;  1R5M A;  4CZV A;  4ERY A;  5I5I A;  4CI2 A;  4GQB B;  3MKS B;  5GXI A;  4QRJ A;  3NVN A;  2HES X;  2IUP A;  5CXB B;  4E54 A;  4PBZ A;  3DSM A;  4A0B A;  3WSO A;  3UKR C;  2OVR B;  4I6J B;  3B7F A;  2YMU A;  3AL8 B;  2P1M B;  3I8C A;  4AOW A;  5AJA A;  1VYH C;  2XL3 A;  4A0A A;  4X63 B;  4OWR A;  4O9D A;  4O3U B;  4GGA A;  4R7A B;  3VA6 A;  2PM7 B;  5FKT A;  1TYQ C;  4D0K A;  4J0X A;  2YNN A;  5EAL A;  4LGN A;  5HQG A;  4ERZ A;  5EAP A;  2G9A A;  4GM9 A;  2H6K A;  1OLZ A;  4PBY A;  4EWR A;  2H9P A;  2W18 A;  5HE3 B;  1N6D A;  4N14 A;  4PSX B;  3SLE D;  5IJ7 E;  2Z2N A;  4FHL A;  4I79 A;  4ZOY A;  4GM3 A;  3FGB A;  2H3X A;  1GOT B;  4ZOV A;  4GGD A;  3EI4 B;  3UVM A;  4A09 A;  1RI6 A;  2IUR A;  2MTA H;  2QC5 A;  4LG9 A;  2IUQ A;  4ZOX A;  3V7D B;  2CNX A;  2H6N A;  2HKM A;  4ESG A;  2Z2P A;  3GFC A;  5TEE A;  4FA5 D;  1B9X A;  3EI3 B;  1A0R B;  4L9O A;  2PM6 B;  3C9C A;  4J8G A;  2CE8 A;  3NVQ A;  4GZ8 A;  3ZWL B;  4GQ2 P;  5IJ8 E;  5K19 A;  1SQJ A;  4QT8 A;  1N6E A;  4O3T B;  5CXC B;  4E54 B;  5FXY A;  4Z8L A;  3OW8 A;  3ULE C;  4A0B B;  3SBP A;  3UVL A;  3RN1 D;  3FRX A; 
#chains in the Genus database with same CATH topology
 2HJ4 A;  4J87 A;  4DU4 A;  1XU5 E;  1JW2 A;  3PVU B;  4QQE A;  3C95 A;  2ATQ A;  3MXX A;  4DTU A;  4GMB A;  3SVW D;  1PBY B;  2K5S A;  5C86 A;  3SUP A;  3IKO A;  4AX4 A;  2B5M A;  2YB5 A;  2HKR A;  2E32 A;  4L3H D;  3C6N B;  4M45 A;  2OZS A;  3OL2 A;  2JHP A;  1P22 A;  4NAA A;  4DTS A;  4CZY A;  3SWS D;  3P4F A;  4KHU A;  3RWU A;  2P1P B;  4DTP A;  3HL8 A;  4KHS A;  3SI6 A;  4J2D A;  1UOQ A;  2B4E A;  5AMS A;  1WAF A;  3I7H A;  4QNC A;  4TZ4 A;  3SCY A;  4FAN D;  3I7K A;  4PXW A;  3SFZ A;  4K3I D;  3V9F A;  2JKX A;  2EIE A;  2HD0 A;  3SPY A;  4I9Q A;  3O4H A;  2OVP B;  5IRE A;  4XYH A;  2JHC A;  1NR0 A;  2P9I C;  3ZE0 A;  3JRO A;  5FKQ A;  4FWW A;  3UR4 A;  4A2M A;  2J56 H;  4A09 B;  1H2X A;  2EIC A;  2IWF A;  3CFS B;  1JMZ B;  3KD5 E;  3K26 A;  2AH0 A;  2VDP A;  3EU7 A;  4J81 A;  3SXT D;  5C9Z B;  4BCD A;  4NBM A;  3AL9 A;  3SJJ A;  4FB1 D;  3N0D A;  4RNG A;  2XDW A;  2QXV A;  4HDJ A;  5AFU 3;  2O9K A;  3K2O A;  1VE6 A;  2AGX A;  3I89 A;  3KRX B;  4PSW B;  2AGW A;  3SCX A;  1FZ6 E;  2BBK H;  4QL1 A;  2P9U C;  1JV2 A;  1XKS A;  2HU8 A;  1FZ0 E;  1XL3 C;  3UVO A;  2P9K C;  4J86 A;  2H47 A;  1JOF A;  3SJL D;  1BPO A;  1QNI A;  3L1N A;  2TRC B;  1JTD B;  4JSX C;  3E4Y A;  2BCJ B;  3I7N A;  4JXM A;  3ZDX A;  4DNV A;  3SQ0 A;  1O6G A;  5IGO A;  4MK0 B;  4X61 B;  5GMK n;  2P9P C;  4KHW A;  4RE6 A;  4ZOZ A;  3EI1 A;  2XU7 A;  3DWL C;  3GD1 I;  3I7P A;  3JZG A;  4AKG A;  4MMZ A;  1YFQ A;  3NAE A;  2I0R A;  2QR5 A;  2YNO A;  3E0C A;  3JZN A;  2PM9 A;  4JHP C;  4IMM A;  1UOP A;  1TBG A;  4ADO A;  3V5W B;  2B5L A;  2IUV A;  5CYK A;  4X3E A;  2I3T A;  3OL2 B;  1GP2 B;  3PSC B;  4E3S A;  3T3P A;  4BL0 A;  2B5N A;  2H13 A;  1N6F A;  3HGK E;  4JHN A;  2JH9 A;  3TAE A;  5IGQ A;  4H5I A;  3QES A;  3IIY A;  2QXF A;  3MMY A;  1XVB E;  3QNO A;  3OKY A;  5TEF A;  4FJ5 A;  4ICG C;  4FJ7 A;  5A2Q g;  4GGC A;  4BP8 A;  4EP9 A;  5HDB A;  4FA4 D;  3KD1 E;  3ODT A;  3JB9 L;  1YR2 A;  5M5V A;  4DTX A;  3A0F A;  3EI2 A;  3QEI A;  3IJE A;  3AFC A;  3JPX A;  1I2M B;  1UTC A;  4J73 A;  3EMH A;  2P5G A;  5HE1 B;  3F3G A;  4A08 B;  2AH1 A;  3K27 A;  1MHY G;  5I5J A;  2VDL A;  4M3W A;  3JZH A;  3OGM B;  4A11 A;  4FJL A;  4GM8 A;  3EQ7 A;  5FKS A;  3LDS A;  5HYN B;  4EPH A;  3SQ4 A;  2H14 A;  4DU1 A;  3I7O A;  4CI3 A;  3EQ8 A;  2IAA A;  5EMJ B;  3I2N A;  3PXS D;  3K72 A;  4FJH A;  1FZ2 E;  4RE5 A;  4IA9 A;  2VZ1 A;  3C6P B;  3FCS A;  4NC4 A;  3CFR A;  4FJM A;  4KHY A;  1FZ4 E;  4JT5 C;  5IC7 A;  4CZX A;  4FA9 D;  2OK4 A;  3NCI A;  4QND A;  3EWE A;  3SN6 B;  4J82 A;  3FRX A;  2EIB A;  2H6Q A;  2VC2 A;  5EMK B;  3U4Y A;  4M41 A;  4NEN A;  4PNK B;  3EG6 A;  1K8K C;  3VI4 A;  4DTM A;  4A2L A;  1A12 A;  5EAR A;  3EI1 B;  4JD2 C;  5FQD A;  4J79 A;  2B7M A;  2P1O B;  3L4M D;  3SHF A;  3EQ9 A;  3C75 H;  3PE7 A;  1MG2 A;  4A0A B;  2H68 A;  4J0W A;  4K3J B;  4J2B A;  4FJJ A;  4DTN A;  5E6S A;  2B1E A;  5TF2 A;  5H17 A;  1XVD E;  4E4B A;  3ZE2 A;  2PM9 B;  4X5M A;  3IUJ A;  4WJK A;  3L4O D;  4G1E A;  4MMY A;  2CE9 A;  4FAV D;  3SMR A;  3LDB A;  1U4C A;  5FA5 B;  5CYK B;  1FZ9 E;  3I8E A;  4BCB A;  3GC3 B;  2VZ3 A;  1K3I A;  3UO2 A;  4UM9 A;  1U8C A;  2AGL A;  3VI3 A;  3ZDZ A;  2E31 A;  5C2W B;  4H5J A;  5I5M A;  1XVE E;  3TAG A;  2H9N A;  3LD8 A;  4GQ1 A;  1C9I A;  4NSX A;  5EML B;  1XVF E;  3OKY B;  1O6F A;  4OZU A;  2DTU A;  2OJY A;  1XHM A;  2P5O A;  4KI4 A;  1JMX B;  4YVD A;  1VZ3 A;  2JHA A;  2OIZ A;  4KFM B;  1MMO G;  5K1C C;  4X5N A;  3MZL A;  4CY2 A;  2OYQ A;  3GRE A;  4G1M A;  3S9H A;  5SXM A;  2VDO A;  3NDK A;  4AI6 A;  5THA A;  4CC9 A;  4ES0 A;  3CIK B;  4LG8 A;  3CQ8 A;  2H9L A;  4U1E I;  5M5S A;  3N0E A;  1NEX B;  3J27 A;  3JRP A;  2MW2 A;  4FJI A;  4DNU A;  2JPN A;  2IWK A;  2PFV A;  1OMW B;  4A11 B;  3AH8 B;  4E5Z A;  1FPO A;  4QAM A;  4ZN4 A;  3N1E A;  1TYE A;  4CY3 A;  1XMG E;  4XEI C;  1UOO A;  3RMC A;  3C6O B;  3RMB A;  4AKI A;  4AN0 A;  2PFT A;  4O2W A;  2Q7Q A;  1FZI E;  4AMY A;  4FJX A;  3SQ1 A;  1E8M A;  3PSL A;  4O1Q D;  2XZG A;  4FJ9 A;  2AGZ A;  2I0T A;  1M1X A;  3UVN A;  3OGK B;  4M42 A;  3MZK A;  4DTJ A;  3C99 A;  1XIP A;  4I9L A;  2I0S A;  2P9N C;  2AGY A;  2J57 G;  2RCU A;  1B9Y A;  3QER A;  5M61 A;  3NVX A;  4Z7N A;  4BP9 A;  1SQ9 A;  2HJB A;  2VJ5 A;  4DU3 A;  5CXC A;  1ERJ A;  3QET A;  1MTY G;  2YNP A;  3SBR A;  4JSV C;  5EM2 A;  1H2Z A;  3QHY B;  2BKL A;  4PC0 A;  3MVD K;  3KCI A;  2CN2 A;  2MZW B;  2AQ5 A;  1MHZ G;  2CN3 A;  2UZX B;  4A7J A;  1XMH E;  4Y5R D;  4WK4 A;  1FZ1 E;  2FYO A;  3DDU A;  2VDR A;  3IUQ A;  4B08 A;  2H9M A;  2VDM A;  5HE0 B;  1GOG A;  2YB8 B;  4J2E A;  4M3X A;  3L8B A;  2GNQ A;  3SQ2 A;  3W15 A;  1S4U X;  2CO0 A;  3PVW B;  4U7A A;  3RMZ D;  1CLQ A;  1K32 A;  1FS1 A;  3NID A;  4DTO A;  4G56 B;  3UKU C;  1FZH E;  3J81 g;  1L5G A;  3CFV A;  3IUL A;  5H37 A;  2OZM A;  5H1M A;  3UVK A;  5KDO B;  1GXR A;  3F3F A;  3SNN A;  2CO0 C;  5E6R A;  3PXW D;  5EMM B;  3SPZ A;  1GOF A;  3TJY A;  5EAM A;  4E5Z B;  2XYI A;  3IJ0 A;  4FJ8 A;  3IJ1 A;  4A08 A;  1FWX A;  3HFQ A;  4G55 A;  2XL2 A;  5B4W A;  4WK0 A;  3IIW A;  3RN0 D;  3LZJ A;  1PGU A;  4CY1 A;  3TAF A;  3QNN A;  4JT6 C;  3L2O B;  4GAM C;  5IBK B;  4L1Q D;  4EYW A;  1Q9Y A;  3SBP A;  2HYE A;  2OVQ B;  5IT9 g;  3J80 g;  3PXT D;  3CFO A;  1XU3 E;  4ERQ A;  4DNW A;  1LDK E;  3NE6 A;  3IUR A;  5FFG A;  3NIF A;  4Y7R A;  3I7L A;  4FK4 A;  3MUN A;  3QEV A;  3RLM D;  2H4T A;  5CXB A;  3LZI A;  3BVO A;  5FKR A;  3VH0 A;  3IVM A;  1MG3 A;  4M3R A;  4JRQ A;  2RKH A;  2HXC A;  4MMX A;  4AEZ A;  1T2X A;  3QEW A;  4FA1 D;  5M5U A;  4FJN A;  5IZ7 A;  3VGZ A;  3F3P A;  2EID A;  1FZ5 E;  4ADN A;  2P1N B;  4XYI A;  5EM2 B;  3AL8 A;  3RSE C;  5H14 A;  1WAJ A;  5M5R A;  3BWS A;  4FJG A;  1FZ7 E;  4CY5 A;  1H2W A;  4AMZ A;  1L0Q A;  5C2V B;  4CI1 A;  4J84 A;  4UM8 A;  5GXH A;  3T3M A;  3RFG A;  4D9S A;  3DM0 A;  3TAB A;  3OKT A;  4L1M A;  4Z7Q A;  3RMD A;  4BUJ C;  1GG2 B;  4WK2 A;  3KRW B;  2J55 H;  1MDA H;  4UI9 R;  4JSN C;  2Z2O A;  4L3G D;  4RL5 A;  5FLX g;  3K6S A;  3SBQ A;  3C5M A;  3OKW A;  2JQT A;  2VDK A;  2GC4 A;  1U2V C;  3OGL B;  3FM0 A;  4KHQ A;  1VE7 A;  4J78 A;  3EI2 B;  5JWZ A;  3DXM C;  2I3S A;  1FYZ E;  2LF3 A;  3OTT A;  4J8B A;  4HCC A;  3BG0 A;  3ORV D;  3V4P A;  3DXK C;  4IT5 A;  3SUN A;  4BH6 A;  3JAM g;  2GC7 A;  2PBI B;  4O45 A;  2YBA A;  5M5T A;  2EBS A;  4FVM A;  3SUO A;  4JSP C;  2G99 A;  2UZY B;  3EI4 A;  4X60 B;  5TDH B;  1C9L A;  3MKQ A;  1PEV A;  1Q47 A;  5FFO A;  1SHY B;  2P9S C;  2MMB A;  3HGL A;  2P9L C;  4D6V A;  1VZ2 A;  3SUQ A;  1N1C A;  4AKH A;  3L0M A;  1JJU B;  2P1Q B;  3IJC A;  1QFM A;  4J77 A;  5HE2 B;  3CFP A;  1FXX A;  2OK6 A;  3RFH A;  5GSA A;  3EI3 A;  4HCB A;  4CI8 A;  3RRM C;  4M3U A;  1Q9X A;  2QZP A;  1PI6 A;  3BG1 A;  1R5M A;  4CZV A;  3OF7 A;  5C92 A;  4FJK A;  4ERY A;  4CI2 A;  4GQB B;  5I5I A;  3MKS B;  5GXI A;  4QRJ A;  3IUM A;  3NVN A;  2HES X;  2IUP A;  1FZ8 E;  5CXB B;  4E54 A;  4PBZ A;  1FZ3 E;  3E4W A;  1GOH A;  3DSM A;  4A0B A;  3WSO A;  3UKR C;  2WQ8 A;  2OVR B;  4I6J B;  2VIX A;  3O4I A;  3QI0 A;  3B7F A;  2YMU A;  3J2P A;  4JS4 A;  3AL8 B;  2P1M B;  4JS5 A;  3I8C A;  1QFS A;  4AOW A;  5AJA A;  1VYH C;  2XL3 A;  2VDN A;  4A0A A;  4KI6 A;  4X63 B;  4OWR A;  4O9D A;  2VJ4 A;  3NGI A;  4GGA A;  4O3U B;  4R7A B;  3VA6 A;  2PM7 B;  5FKT A;  1TYQ C;  4D0K A;  2HU5 A;  3TL8 B;  4J0X A;  2YNN A;  5EAL A;  4LGN A;  5HQG A;  4ERZ A;  5EAP A;  2G9A A;  4DTR A;  4GM9 A;  2H6K A;  1OLZ A;  4PBY A;  3ZDY A;  4EWR A;  3NHG A;  2H9P A;  1E8N A;  3SVI A;  3MUO A;  2W18 A;  5HE3 B;  2FW3 A;  1N6D A;  4N14 A;  4PSX B;  3SLE D;  5IJ7 E;  2Z2N A;  4FHL A;  4I79 A;  4ZOY A;  4JRP A;  1IH7 A;  3C94 A;  2B8I A;  3UIQ A;  3RMA A;  4FK0 A;  4GM3 A;  4O02 A;  3FGB A;  2H3X A;  1GOT B;  4ZOV A;  3UO3 A;  3ZE1 A;  4GGD A;  2LF6 A;  4FK2 A;  3EI4 B;  2VDQ A;  4IRZ A;  3UVM A;  3QEX A;  3O4J A;  4A09 A;  1RI6 A;  2IUR A;  2MTA H;  2QC5 A;  4LG9 A;  2XE4 A;  2IUQ A;  3NIG A;  1E5T A;  4BCC A;  4M3Z A;  4J2A A;  3FCU A;  4M3T A;  1XMF E;  2DEB A;  4ZOX A;  3V7D B;  2CNX A;  2H6N A;  2HKM A;  2HU7 A;  2Z2P A;  3GFC A;  5TEE A;  4ESG A;  4Z7O A;  4FA5 D;  1IG9 A;  1B9X A;  1XVC E;  3EI3 B;  1A0R B;  4L9O A;  1XVG E;  2JH8 A;  2PM6 B;  3C9C A;  4KHN A;  2DY4 A;  4J8G A;  3QEP A;  2CE8 A;  3K71 A;  3NVQ A;  4GZ8 A;  1H2Y A;  4GQ2 P;  3ZWL B;  5IJ8 E;  5K19 A;  1SQJ A;  4QT8 A;  1N6E A;  4O3T B;  5E6U A;  4M3Y A;  5CXC B;  4E54 B;  3HP9 A;  3IUN A;  5FXY A;  4Z8L A;  3OW8 A;  4AN1 A;  3N1B A;  3ULE C;  4A0B B;  3O4G A;  3V4V A;  3UVL A;  3RN1 D;  4RG8 A; 
#chains in the Genus database with same CATH homology
 2HJ4 A;  4J87 A;  4DU4 A;  1XU5 E;  3PVU B;  4QQE A;  3C95 A;  2ATQ A;  3MXX A;  4DTU A;  4GMB A;  3SVW D;  1PBY B;  3SUP A;  3IKO A;  2B5M A;  2YB5 A;  2HKR A;  2E32 A;  4L3H D;  3C6N B;  4M45 A;  2OZS A;  3OL2 A;  2JHP A;  1P22 A;  4DTS A;  4CZY A;  3SWS D;  3P4F A;  4KHU A;  3RWU A;  2P1P B;  4DTP A;  3HL8 A;  4KHS A;  3SI6 A;  4J2D A;  2B4E A;  5AMS A;  1WAF A;  3I7H A;  4QNC A;  4TZ4 A;  3SCY A;  4FAN D;  3I7K A;  4PXW A;  3SFZ A;  4K3I D;  3V9F A;  2HD0 A;  3SPY A;  4I9Q A;  2OVP B;  5IRE A;  4XYH A;  2JHC A;  1NR0 A;  2P9I C;  3JRO A;  5FKQ A;  4FWW A;  3UR4 A;  4A2M A;  2J56 H;  4A09 B;  2IWF A;  3CFS B;  1JMZ B;  3KD5 E;  3K26 A;  2AH0 A;  3EU7 A;  4J81 A;  3SXT D;  5C9Z B;  3AL9 A;  3SJJ A;  4FB1 D;  3N0D A;  4RNG A;  2QXV A;  4HDJ A;  5AFU 3;  2O9K A;  3K2O A;  2AGX A;  3I89 A;  3KRX B;  4PSW B;  2AGW A;  3SCX A;  1FZ6 E;  2BBK H;  4QL1 A;  2P9U C;  1XKS A;  1FZ0 E;  1XL3 C;  3UVO A;  2P9K C;  4J86 A;  2H47 A;  1JOF A;  3SJL D;  1QNI A;  3L1N A;  2TRC B;  4JSX C;  4JXM A;  3E4Y A;  2BCJ B;  3I7N A;  3SQ0 A;  5IGO A;  4MK0 B;  4X61 B;  5GMK n;  2P9P C;  4KHW A;  4ZOZ A;  3EI1 A;  2XU7 A;  3DWL C;  3I7P A;  3JZG A;  4AKG A;  1YFQ A;  3NAE A;  2I0R A;  2YNO A;  3E0C A;  3JZN A;  2PM9 A;  4IMM A;  1TBG A;  4ADO A;  3V5W B;  2B5L A;  2IUV A;  5CYK A;  4X3E A;  2I3T A;  3OL2 B;  1GP2 B;  3PSC B;  4E3S A;  4BL0 A;  2B5N A;  2H13 A;  1N6F A;  3HGK E;  2JH9 A;  3TAE A;  5IGQ A;  4H5I A;  3QES A;  3IIY A;  2QXF A;  3MMY A;  1XVB E;  3QNO A;  3OKY A;  5TEF A;  4FJ5 A;  4FJ7 A;  5A2Q g;  4GGC A;  4EP9 A;  4FA4 D;  3KD1 E;  3ODT A;  3JB9 L;  4DTX A;  3A0F A;  3EI2 A;  3QEI A;  3AFC A;  3JPX A;  4J73 A;  3EMH A;  2P5G A;  5HE1 B;  3F3G A;  4A08 B;  2AH1 A;  3K27 A;  1MHY G;  5I5J A;  4M3W A;  3JZH A;  3OGM B;  4A11 A;  4FJL A;  4GM8 A;  5FKS A;  3LDS A;  5HYN B;  4EPH A;  3SQ4 A;  2H14 A;  4DU1 A;  3I7O A;  4CI3 A;  5EMJ B;  2IAA A;  3I2N A;  3PXS D;  4FJH A;  1FZ2 E;  4IA9 A;  3C6P B;  3CFR A;  4FJM A;  4KHY A;  1FZ4 E;  4JT5 C;  5IC7 A;  4CZX A;  4FA9 D;  2OK4 A;  3NCI A;  4QND A;  3EWE A;  3SN6 B;  4J82 A;  3FRX A;  2H6Q A;  5EMK B;  3U4Y A;  4M41 A;  4PNK B;  3EG6 A;  1K8K C;  4DTM A;  4A2L A;  5EAR A;  3EI1 B;  4JD2 C;  5FQD A;  4J79 A;  2B7M A;  2P1O B;  3L4M D;  3SHF A;  3C75 H;  3PE7 A;  1MG2 A;  4A0A B;  2H68 A;  4J0W A;  4K3J B;  4J2B A;  4FJJ A;  4DTN A;  5TF2 A;  2B1E A;  5H17 A;  1XVD E;  4E4B A;  2PM9 B;  4X5M A;  3L4O D;  2CE9 A;  4FAV D;  3SMR A;  3LDB A;  1U4C A;  5FA5 B;  5CYK B;  1FZ9 E;  3I8E A;  2AGL A;  2E31 A;  5C2W B;  4H5J A;  5I5M A;  1XVE E;  3TAG A;  2H9N A;  3LD8 A;  4GQ1 A;  4NSX A;  5EML B;  1XVF E;  3OKY B;  4OZU A;  2DTU A;  2OJY A;  1XHM A;  2P5O A;  4KI4 A;  1JMX B;  4YVD A;  5K1C C;  2JHA A;  2OIZ A;  4KFM B;  1MMO G;  4X5N A;  3MZL A;  4CY2 A;  2OYQ A;  3GRE A;  3S9H A;  5SXM A;  3NDK A;  4AI6 A;  5THA A;  4CC9 A;  4ES0 A;  3CIK B;  4LG8 A;  3CQ8 A;  2H9L A;  4U1E I;  3N0E A;  1NEX B;  3J27 A;  3JRP A;  4FJI A;  2JPN A;  2IWK A;  2PFV A;  1OMW B;  4A11 B;  3AH8 B;  4E5Z A;  4ZN4 A;  3N1E A;  4CY3 A;  1XMG E;  4XEI C;  3RMC A;  3C6O B;  3RMB A;  4AKI A;  2PFT A;  2Q7Q A;  1FZI E;  4FJX A;  3SQ1 A;  3PSL A;  4O1Q D;  4FJ9 A;  2AGZ A;  2I0T A;  3UVN A;  3OGK B;  4M42 A;  3MZK A;  4DTJ A;  3C99 A;  1XIP A;  4I9L A;  2I0S A;  2P9N C;  2AGY A;  2J57 G;  2RCU A;  1B9Y A;  3QER A;  3NVX A;  1SQ9 A;  2HJB A;  2VJ5 A;  4DU3 A;  5CXC A;  1ERJ A;  3QET A;  1MTY G;  2YNP A;  3SBR A;  4JSV C;  5EM2 A;  4PC0 A;  2CN2 A;  2MZW B;  2AQ5 A;  1MHZ G;  2CN3 A;  2UZX B;  4A7J A;  1XMH E;  4Y5R D;  1FZ1 E;  2FYO A;  4B08 A;  2H9M A;  5HE0 B;  2YB8 B;  4J2E A;  4M3X A;  3L8B A;  2GNQ A;  3SQ2 A;  3W15 A;  1S4U X;  2CO0 A;  3PVW B;  4U7A A;  3RMZ D;  1CLQ A;  1K32 A;  1FS1 A;  4DTO A;  4G56 B;  3UKU C;  1FZH E;  3J81 g;  3CFV A;  5H37 A;  2OZM A;  5H1M A;  3UVK A;  5KDO B;  1GXR A;  3F3F A;  3SNN A;  2CO0 C;  3PXW D;  5EMM B;  3SPZ A;  5EAM A;  3TJY A;  4E5Z B;  2XYI A;  3IJ0 A;  4FJ8 A;  3IJ1 A;  4A08 A;  1FWX A;  3HFQ A;  2XL2 A;  5B4W A;  3IIW A;  3RN0 D;  3LZJ A;  1PGU A;  4CY1 A;  3TAF A;  3QNN A;  4JT6 C;  3L2O B;  4GAM C;  5IBK B;  4L1Q D;  4EYW A;  1Q9Y A;  2HYE A;  5IT9 g;  2OVQ B;  3J80 g;  3PXT D;  3CFO A;  1XU3 E;  4ERQ A;  1LDK E;  3NE6 A;  4Y7R A;  3I7L A;  4FK4 A;  3RLM D;  3QEV A;  2H4T A;  5CXB A;  3LZI A;  5FKR A;  3VH0 A;  1MG3 A;  4M3R A;  4JRQ A;  4FA1 D;  2HXC A;  4AEZ A;  3QEW A;  4FJN A;  5IZ7 A;  3VGZ A;  3F3P A;  1FZ5 E;  4ADN A;  2P1N B;  4XYI A;  5EM2 B;  3AL8 A;  3RSE C;  5H14 A;  1WAJ A;  3BWS A;  4FJG A;  1FZ7 E;  4CY5 A;  5GXH A;  1L0Q A;  5C2V B;  4CI1 A;  4J84 A;  3RFG A;  3DM0 A;  3TAB A;  3OKT A;  3RMD A;  4BUJ C;  1GG2 B;  3KRW B;  2J55 H;  1MDA H;  4UI9 R;  4JSN C;  2Z2O A;  4L3G D;  4RL5 A;  5FLX g;  3SBQ A;  3C5M A;  3OKW A;  2GC4 A;  1U2V C;  3OGL B;  3FM0 A;  4KHQ A;  4J78 A;  3EI2 B;  5JWZ A;  3DXM C;  2I3S A;  1FYZ E;  2LF3 A;  3OTT A;  4J8B A;  4HCC A;  3BG0 A;  3ORV D;  3DXK C;  3SUN A;  4BH6 A;  3JAM g;  2GC7 A;  2PBI B;  4O45 A;  2YBA A;  2EBS A;  4FVM A;  3SUO A;  4JSP C;  2G99 A;  2UZY B;  3EI4 A;  4X60 B;  5TDH B;  3MKQ A;  1PEV A;  1Q47 A;  1SHY B;  2P9S C;  2MMB A;  3HGL A;  2P9L C;  4D6V A;  3SUQ A;  4AKH A;  3L0M A;  1JJU B;  2P1Q B;  3IJC A;  4J77 A;  5HE2 B;  5GSA A;  3CFP A;  1FXX A;  2OK6 A;  3RFH A;  3EI3 A;  4HCB A;  4CI8 A;  3RRM C;  4M3U A;  1Q9X A;  1PI6 A;  3BG1 A;  1R5M A;  4CZV A;  4FJK A;  4ERY A;  4CI2 A;  4GQB B;  5I5I A;  3MKS B;  5GXI A;  4QRJ A;  3NVN A;  2HES X;  2IUP A;  1FZ8 E;  5CXB B;  4E54 A;  4PBZ A;  1FZ3 E;  3E4W A;  3DSM A;  4A0B A;  3WSO A;  3UKR C;  2OVR B;  4I6J B;  2VIX A;  3B7F A;  2YMU A;  3J2P A;  4JS4 A;  3AL8 B;  2P1M B;  4JS5 A;  3I8C A;  4AOW A;  5AJA A;  1VYH C;  2XL3 A;  4A0A A;  4KI6 A;  4X63 B;  4OWR A;  4O9D A;  2VJ4 A;  3NGI A;  4GGA A;  4O3U B;  4R7A B;  3VA6 A;  2PM7 B;  5FKT A;  1TYQ C;  4D0K A;  3TL8 B;  4J0X A;  2YNN A;  5EAL A;  4LGN A;  5HQG A;  4ERZ A;  5EAP A;  2G9A A;  4DTR A;  4GM9 A;  2H6K A;  1OLZ A;  4PBY A;  4EWR A;  3NHG A;  2H9P A;  3SVI A;  2W18 A;  5HE3 B;  2FW3 A;  1N6D A;  4N14 A;  4PSX B;  3SLE D;  5IJ7 E;  2Z2N A;  4FHL A;  4I79 A;  4ZOY A;  4JRP A;  1IH7 A;  3C94 A;  2B8I A;  3UIQ A;  3RMA A;  4FK0 A;  4GM3 A;  3FGB A;  2H3X A;  1GOT B;  4ZOV A;  4GGD A;  2LF6 A;  4FK2 A;  3EI4 B;  3UVM A;  3QEX A;  4A09 A;  1RI6 A;  2IUR A;  2MTA H;  2QC5 A;  4LG9 A;  2IUQ A;  4M3Z A;  4J2A A;  4M3T A;  1XMF E;  2DEB A;  4ZOX A;  3V7D B;  2CNX A;  2H6N A;  2HKM A;  4ESG A;  2Z2P A;  3GFC A;  5TEE A;  4FA5 D;  1IG9 A;  1B9X A;  1XVC E;  3EI3 B;  1A0R B;  4L9O A;  1XVG E;  2JH8 A;  2PM6 B;  3C9C A;  4KHN A;  2DY4 A;  4J8G A;  3QEP A;  2CE8 A;  3NVQ A;  4GZ8 A;  3ZWL B;  4GQ2 P;  5IJ8 E;  5K19 A;  1SQJ A;  4QT8 A;  1N6E A;  4O3T B;  4M3Y A;  5CXC B;  4E54 B;  3HP9 A;  5FXY A;  4Z8L A;  3OW8 A;  3N1B A;  3ULE C;  4A0B B;  3SBP A;  3UVL A;  3RN1 D;  4RG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...