2OVPB

Structure of the skp1-fbw7 complex
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
444
structure length
441
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
total genus 122
structure length 441
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovpB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovpB02
3I7NA 4L9OA 3EI2A 1S4UX 2Q7QA 2UZYB 4PSWB 5HE2B 4LG8A 1TYQC 2AQ5A 3AL8B 4LGNA 3NVXA 3JZGA 4L1QD 2AGXA 3SMRA 3EI2B 2HKRA 5I5IA 2O9KA 5CYKB 5TEFA 2GC4A 4BH6A 1K32A 4IA9A 4CZYA 1ERJA 4A2MA 3PSLA 2IURA 4O3UB 4A09B 3EWEA 4KFMB 4O45A 1GP2B 5EMMB 2P9NC 5HE0B 5TDHB 3F3FA 2H9NA 4ZOXA 4FA4D 2CE8A 4ERZA 4H5JA 4O9DA 4PBZA 4X3EA 3PE7A 3ULEC 3SCYA 5EMLB 5IBKB 3K26A 2AGYA 3VGZA 1NEXB 4GGCA 4J8BA 3RRMC 3OKYB 4O1QD 1SQJA 4XYHA 4TZ4A 3EI4B 2E31A 4A11A 3I7HA 2G99A 2YB8B 2H3XA 3RSEC 2B5LA 4XEIC 3OL2A 4A0AB 1RI6A 3DXMC 5GXIA 5AMSA 3NVQA 4CI8A 1MDAH 2P9LC 2AH0A 4I6JB 3NVNA 1YFQA 2P9KC 3MKQA 3P4FA 2OK4A 2AGLA 4GM8A 4JSPC 2HYEA 2H13A 3V7DB 5AJAA 5IJ7E 4A08B 4A0AA 3HFQA 4GZ8A 4J81A 2XL2A 4UI9R 4ZN4A 3WSOA 3EI4A 1U4CA 3UVNA 4CZVA 3EI3A 4ES0A 4FWWA 5C2VB 2GNQA 5TEEA 2HKMA 4E54B 3OKWA 3V5WB 3I2NA 5FKSA 2EBSA 5CXBA 5EARA 1TBGA 2IWFA 4N14A 1JJUB 2CN3A 3C5MA 3SHFA 3OTTA 5FXYA 5EMJB 3CIKB 4J77A 1XKSA 4GGDA 5AFU3 1PEVA 2MTAH 2YMUA 4EWRA 3I8CA 3UKRC 4E5ZA 3PXSD 2CO0C 5K19A 2IUPA 2W18A 3AL8A 4ERQA 4X63B 5IJ8E 4JD2C 5EAMA 5FKQA 3JRPA 4H5IA 4JT6C 4CY5A 3IIWA 4O3TB 2HXCA 2AH1A 5CXCB 2H68A 4ZOVA 5KDOB 3SXTD 5CXBB 4AEZA 4JSNC 5EAPA 2J57G 4E54A 4ERYA 2UZXB 4D0KA 3L4OD 4J79A 5FKRA 3F3GA 1GG2B 3F3PA 3MKSB 2XL3A 2OIZA 2AGZA 2P1PB 4PSXB 2H9LA 4NSXA 3DWLC 3KRXB 2P9IC 3MXXA 3RLMD 3SN6B 5EM2B 5I5JA 5FKTA 2I0SA 2Z2OA 3AH8B 3VH0A 5H14A 4A7JA 5EM2A 4FA9D 3OW8A 4CY1A 4JSXC 2Z2PA 3PXTD 4CI1A 4IMMA 3JZNA 3BWSA 4U1EI 4GQ1A 1PI6A 3ODTA 4CC9A 3N0EA 2IUVA 3UVKA 4QRJA 4Y7RA 3OGMB 3JROA 2IUQA 4A2LA 5H17A 4CZXA 1N6FA 4AOWA 2AGWA 4GQ2P 1SHYB 2IWKA 4J0XA 4ZOYA 4QT8A 5IC7A 2BCJB 4R7AB 2H14A 2HJ4A 5CXCA 2P1MB 4PNKB 5SXMA 3IKOA 3SBQA 3VA6A 3OL2B 1QNIA 2QC5A 1SQ9A 2PM9A 3BG1A 4I79A 5IGQA 2H6KA 2PM6B 2P1NB 4J87A 4ESGA 2YNPA 3C6PB 2B5NA 4GM3A 1PBYB 4J82A 1OMWB 3I7PA 3I89A 3SVWD 3ZWLB 5EMKB 1P22A 2CE9A 3PSCB 4LG9A 3SWSD 3A0FA 5GXHA 4J73A 3EI1A 3OKYA 2PBIB 4FAND 4CY3A 3I7LA 3C75H 3W15A 4X60B 2E32A 2Z2NA 4CY2A 2H6QA 2CNXA 3C99A 4BUJC 3PVUB 2G9AA 3SBRA 5CYKA 2XU7A 1L0QA 3JZHA 3UKUC 5FQDA 2YBAA 3I7KA 4FA5D 4MK0B 5TF2A 3ORVD 2P9UC 3IIYA 1Q47A 4CI2A 2OVPB 3JAMg 4OWRA 4JSVC 4L3GD 3OGKB 4L3HD 4E5ZB 2J56H 5EALA 4J78A 4J86A 2B5MA 1XHMA 1N6DA 1JOFA 2XYIA 3CFVA 2IAAA 4Z8LA 4A0BB 4BL0A 4J84A 4GGAA 2HJBA 4QL1A 1FWXA 3KRWB 3I8EA 4JXMA 5A2Qg 1NR0A 2YNNA 3SFZA 4J0WA 2CN2A 1U2VC 4G56B 4J8GA 3DXKC 3L4MD 3EU7A 2H9PA 3E0CA 2P9PC 5B4WA 2P9SC 5HQGA 3UR4A 3UVOA 2J55H 3I7OA 2I3TA 5C2WB 4FA1D 2QXVA 3RN1D 4FB1D 3OGLB 4A0BA 4YVDA 3C6OB 2HESX 4X61B 3IJ1A 4OZUA 3SLED 3UVMA 5H1MA 3N0DA 3DM0A 3JPXA 5HE3B 1PGUA 2P1QB 3K27A 1R5MA 3JB9L 3EG6A 1B9YA 2H9MA 2I0RA 1A0RB 2YNOA 4HDJA 5FLXg 2PM9B 2B4EA 5K1CC 4K3JB 5I5MA 4A11B 3CFSB 3OKTA 3PVWB 4PBYA 5THAA 4FAVD 2TRCB 4U7AA 3L2OB 4PC0A 3FM0A 2P1OB 3PXWD 4ZOZA 3RFHA 3RN0D 5FA5B 3AL9A 4A08A 3SJLD 4FHLA 3C9CA 4A09A 3EMHA 5C9ZB 1K8KC 5GMKn 1MG3A 2H47A 4GM9A 5HYNB 5IGOA 3MMYA 1MG2A 3V9FA 5GSAA 3AFCA 2OVRB 4K3ID 4QQEA 2I3SA 1B9XA 1JMXB 4GQBB 1XIPA 4Y5RD 1OLZA 5HE1B 3J81g 4CI3A 4XYIA 3J80g 3C6NB 1FS1A 4JT5C 3RMZD 3GFCA 3B7FA 4GMBA 3MZKA 3FGBA 3UVLA 2I0TA 5JWZA 2H6NA 2PM7B 3DSMA 3SBPA 1JMZB 3BG0A 2GC7A 3EI1B 4D6VA 1GOTB 3EI3B 4PXWA 2CO0A 2OK6A 5IT9g 1VYHC 3U4YA 2OJYA 1GXRA 2OVQB 2BBKH 3GREA 3IJCA 3IJ0A 3RFGA 1LDKE 1N6EA 3FRXA 3MZLA
chains in the Genus database with same CATH superfamily
3I7NA 3HL8A 3SUNA 1JTDB 4AKIA 4L9OA 3EI2A 1QFMA 1S4UX 5HDBA 3LDSA 2Q7QA 2UZYB 5M5RA 3SUPA 4PSWB 3KD5E 5HE2B 1UOPA 1TYQC 3SNNA 2AQ5A 3AL8B 3GD1I 3NVXA 3O4JA 4LG8A 3JZGA 4L1QD 4LGNA 3QNOA 2AGXA 3SMRA 3EI2B 2HKRA 3NCIA 3TABA 2VC2A 5I5IA 2O9KA 5CYKB 5TEFA 2GC4A 1UOQA 4BH6A 1K32A 4KHWA 4IA9A 4FJGA 4CZYA 1ERJA 4A2MA 2VDLA 3PSLA 3SQ0A 2IURA 5E6RA 4O3UB 4A09B 4AN0A 3EWEA 3SUQA 4KFMB 4O45A 4FJXA 4FK2A 4DNWA 1GP2B 5EMMB 2P9NC 5HE0B 5TDHB 3F3FA 2H9NA 4ZOXA 4M3WA 4FA4D 2CE8A 4ERZA 4H5JA 4O9DA 4WK4A 4PBZA 4X3EA 3PE7A 3ULEC 3SCYA 2MZWB 5EMLB 5IBKB 3V4PA 4DTJA 2AGYA 3K26A 4MMZA 3VGZA 1NEXB 4EPHA 4GGCA 1Q9XA 4J8BA 3RRMC 3EQ9A 3OKYB 4O1QD 4KHSA 1SQJA 4XYHA 4TZ4A 3EI4B 2E31A 1Q9YA 4RNGA 4A11A 1U8CA 2G99A 2JHPA 3I7HA 2YB8B 2H3XA 4X5MA 3RSEC 4DTXA 2B5LA 4XEIC 4GAMC 3OL2A 4A0AB 2XDWA 4DTUA 1RI6A 3DXMC 5GXIA 4DNVA 5AMSA 3NVQA 4CI8A 1MDAH 2P9LC 1FPOA 5C86A 2AH0A 4I6JB 3NVNA 1YFQA 4FVMA 2P9KC 3MKQA 3P4FA 2OK4A 3NIFA 4DTRA 2AGLA 4GM8A 4JSPC 2HYEA 3NE6A 2H13A 3V7DB 1UTCA 5AJAA 5IJ7E 4A08B 4A0AA 3HFQA 4GZ8A 4J81A 2XL2A 3VI4A 4WK0A 4UI9R 4ZN4A 3WSOA 3EI4A 2B7MA 1U4CA 3UVNA 3IVMA 4CZVA 1XVDE 3EI3A 4FWWA 4ES0A 5C2VB 2GNQA 5TEEA 1MTYG 1JV2A 1IH7A 2HKMA 4E54B 3OKWA 3BVOA 3V5WB 3T3MA 3I2NA 5FKSA 2HD0A 2EBSA 2P5OA 4FJKA 5CXBA 5EARA 1TBGA 4FJ8A 5H37A 2IWFA 4N14A 1JJUB 4M42A 2CN3A 4BP8A 4X5NA 2JH8A 4JHPC 1XVCE 3K6SA 1MHYG 3C5MA 3SHFA 3OTTA 5FXYA 5EMJB 3CIKB 1XVFE 1O6GA 4J77A 3J2PA 1XKSA 1FYZE 3K71A 4GGDA 2XZGA 4KHQA 5AFU3 2ATQA 2VJ5A 4BCBA 3UO2A 1PEVA 2HU8A 2MTAH 3SQ2A 3N1BA 2YMUA 3I8CA 4EWRA 1XMHE 2JHAA 3UKRC 4E5ZA 4J2BA 3PXSD 3UIQA 2RKHA 2CO0C 5K19A 3KD1E 2OZMA 2IUPA 2W18A 3AL8A 1T2XA 2JKXA 3QNNA 4ERQA 4X63B 4UM9A 5IJ8E 4JD2C 5EAMA 5FKQA 4O02A 3UO3A 3JRPA 4H5IA 4JT6C 4CY5A 1H2WA 3IIWA 4O3TB 4E3SA 2AH1A 3SI6A 3QERA 2H68A 2HXCA 5CXCB 4ZOVA 5KDOB 3SXTD 3HP9A 1M1XA 2PFVA 5CXBB 4AEZA 4JSNC 3E4YA 2J57G 5EAPA 4E54A 1A12A 4AMZA 4ERYA 3QEWA 2UZXB 4D0KA 3L4OD 4J79A 5FFOA 3ZDYA 5FKRA 3TAGA 4D9SA 2DTUA 3F3GA 1GG2B 3F3PA 4IRZA 2YB5A 4BP9A 5M5SA 2B8IA 3MKSB 3SQ4A 2XL3A 2OIZA 4I9LA 2AGZA 2P1PB 1FZHE 4PSXB 2H9LA 2VDNA 3IJEA 2DEBA 3ZE0A 3L1NA 4NSXA 2JHCA 1FXXA 3DWLC 1XVEE 4NC4A 1C9IA 3KRXB 3EQ7A 2P9IC 3K2OA 3MXXA 3RLMD 3SN6B 4BCDA 3QHYB 5EM2B 5I5JA 5FKTA 2I0SA 2Z2OA 3AH8B 3VH0A 5H14A 4A7JA 5EM2A 4BCCA 4RL5A 2WQ8A 3OW8A 4FA9D 4CY1A 4JSXC 2VJ4A 2Z2PA 3PXTD 4UM8A 4CI1A 4IMMA 4DTPA 4J86A 1IG9A 3BWSA 3JZNA 4U1EI 4GQ1A 4HCCA 3QESA 1PI6A 2OZSA 3ODTA 4CC9A 3N0EA 2IUVA 3UVKA 4AX4A 2LF3A 4IT5A 3RMBA 4M3YA 4QRJA 4Y7RA 4MMXA 3OGMB 4JRQA 2RCUA 3RMAA 1XVBE 3JROA 3SVIA 3ZDZA 4KHNA 2VZ3A 2IUQA 1FZ5E 1GOHA 4A2LA 5H17A 4CZXA 1N6FA 4AOWA 2AGWA 4GQ2P 3MUOA 3SPZA 4FJLA 1SHYB 1VE6A 1YR2A 2IWKA 4M3ZA 3NIGA 4J0XA 4ZOYA 3QEXA 1E8MA 4QT8A 3NAEA 5IC7A 2BCJB 4R7AB 2H14A 2HJ4A 1GOFA 4QAMA 3QETA 4J2DA 5CXCA 4KHYA 4EP9A 1FZ0E 2P1MB 4PNKB 5SXMA 5E6UA 3IKOA 3SBQA 3VA6A 3ZE1A 2QZPA 4AKGA 4DU4A 3OL2B 1QNIA 3RMCA 2QC5A 1SQ9A 3V4VA 3L0MA 2PM9A 4Z7OA 5FLXg 3BG1A 1E5TA 3NDKA 4I79A 2H6KA 5IGQA 1VE7A 1H2YA 2PM6B 2P1NB 4J87A 4ESGA 2YNPA 3C6PB 2B5NA 1FZ7E 2B1EA 3IULA 3E4WA 4GM3A 1PBYB 3ZDXA 4J82A 1OMWB 4AMYA 3I7PA 2EICA 3I89A 3QI0A 3CFOA 3SVWD 3ZWLB 4ICGC 4J2AA 1H2XA 5EMKB 1P22A 2JPNA 4E4BA 2CE9A 3PSCB 4LG9A 3SWSD 3SCXA 3IUMA 1N1CA 1XMGE 5C92A 2VDQA 3A0FA 5GXHA 1XMFE 4J73A 3EI1A 2P5GA 3OKYA 2PBIB 4FAND 4DNUA 4HCBA 4CY3A 3I7LA 3SJJA 3J27A 3DDUA 3ZE2A 3C75H 3W15A 3NGIA 4M3XA 3C94A 4X60B 2E32A 2Z2NA 2VIXA 4DU1A 4CY2A 4FJIA 2H6QA 1FZ1E 2CNXA 3C99A 4WK2A 4JHNA 4FJHA 4DTSA 4BUJC 4O2WA 2VDRA 2OYQA 3PVUB 2G9AA 3SBRA 5CYKA 2MW2A 2XU7A 1L0QA 1C9LA 4ADNA 4FJMA 3JZHA 3UKUC 5FQDA 4WJKA 2YBAA 3I7KA 4FA5D 3LZIA 4MK0B 5TF2A 4NAAA 4M41A 3ORVD 2P9UC 3FCSA 3GC3B 3IIYA 4CI2A 3CFRA 3VI3A 2OVPB 4DTNA 4FJNA 4OWRA 3JAMg 4Z7NA 4JSVC 4Z7QA 3OGKB 4L3HD 4L3GD 4E5ZB 3SQ1A 2JH9A 2J56H 4FK4A 2QR5A 5EALA 1VZ3A 4RG8A 1XU5E 4J78A 3NIDA 2B5MA 3QEIA 4AKHA 3O4IA 1XHMA 1FZ6E 1JOFA 1N6DA 2XYIA 3CFVA 3K72A 3EQ8A 2IAAA 4Z8LA 2QXFA 4G55A 4A0BB 4M3UA 4BL0A 2EIEA 1XVGE 4DTMA 4GGAA 4J84A 2HJBA 1FZ2E 4QL1A 2VDMA 1FWXA 3KRWB 1BPOA 3I8EA 4JXMA 2MMBA 1NR0A 2YNNA 5A2Qg 3SFZA 1CLQA 4J0WA 4KI6A 4FJ5A 2CN2A 1U2VC 5E6SA 4G56B 4J8GA 1FZ9E 3DXKC 3N1EA 3L4MD 3EU7A 2H9PA 2JQTA 2XE4A 3E0CA 2VZ1A 2P9PC 5B4WA 4JS5A 3CQ8A 3SPYA 2P9SC 1K3IA 4FJ7A 5HQGA 3UR4A 1FZ4E 3UVOA 2J55H 3I7OA 2I3TA 5C2WB 4FA1D 2QXVA 4JS4A 3RN1D 4FB1D 4RE5A 3NHGA 3KCIA 3OGLB 4A0BA 3OF7A 4YVDA 3T3PA 3C6OB 2HESX 4X61B 5M5VA 3IJ1A 2VDPA 4OZUA 3SLED 3HGLA 5H1MA 3UVMA 3SUOA 3DM0A 3N0DA 4M3RA 3L8BA 3JPXA 1FZ8E 5HE3B 4FJJA 1PGUA 2VDOA 2P1QB 3K27A 3RMDA 1R5MA 3JB9L 3EG6A 2BKLA 2H4TA 1B9YA 2H9MA 2I0RA 1A0RB 2YNOA 4HDJA 5M5TA 4B08A 2PM9B 4DTOA 3TJYA 2B4EA 5K1CC 4K3JB 5I5MA 4G1EA 3MVDK 4A11B 3CFSB 4G1MA 3OKTA 3PVWB 5IREA 4PBYA 5THAA 4FAVD 1QFSA 2TRCB 1WAFA 4U7AA 1FZIE 3L2OB 4ADOA 1H2ZA 3FCUA 3IUJA 3IUQA 4FK0A 4PC0A 3QEPA 3FM0A 2P1OB 3PXWD 1I2MB 4KHUA 4M45A 4ZOZA 3QEVA 3RFHA 3RN0D 1XL3C 5FA5B 3AL9A 4JRPA 4M3TA 3SJLD 4A08A 2VDKA 4FHLA 4FJ9A 3C9CA 4J2EA 4A09A 1GOGA 3EMHA 2K5SA 5FFGA 2FYOA 4NBMA 5C9ZB 1K8KC 5GMKn 3IUNA 2EIDA 1XU3E 1MG3A 2H47A 4GM9A 3C95A 5HYNB 5IGOA 3TL8B 4RE6A 3CFPA 3MMYA 1MG2A 4AN1A 3LDBA 3V9FA 1FZ3E 5GSAA 4I9QA 1TYEA 3IURA 3AFCA 2OVRB 4K3ID 5M61A 2I3SA 2DY4A 3O4GA 1B9XA 1E8NA 4QQEA 1O6FA 1JMXB 4GQBB 1XIPA 4Y5RD 1OLZA 5HE1B 1L5GA 3J81g 4CI3A 2LF6A 3TAEA 1WAJA 1MMOG 4XYIA 3J80g 3RWUA 4AI6A 2FW3A 4KI4A 4L1MA 3LD8A 3C6NB 1UOOA 1FS1A 4JT5C 3RMZD 3GFCA 3B7FA 4GMBA 3MZKA 4EYWA 3FGBA 3UVLA 2I0TA 1JW2A 2PFTA 5JWZA 2H6NA 1LDKE 4QNCA 4QNDA 4NENA 2HU7A 2PM7B 3DSMA 3MUNA 3SBPA 1JMZB 3BG0A 5IZ7A 2GC7A 2EIBA 3EI1B 4D6VA 1GOTB 3EI3B 4PXWA 4MMYA 3TAFA 2CO0A 2OK6A 3LZJA 3S9HA 5IT9g 1VYHC 3U4YA 2HU5A 1MHZG 1VZ2A 2OJYA 1GXRA 3HGKE 3O4HA 2OVQB 2BBKH 3GREA 3IJCA 3IJ0A 3RFGA 4DU3A 5M5UA 1Q47A 1N6EA 3FRXA 3MZLA
chains in the Genus database with same CATH topology
3I7NA 3HL8A 3SUNA 4L9OA 4AKIA 3EI2A 1S4UX 3LDSA 2Q7QA 2UZYB 3SUPA 4PSWB 3KD5E 5HE2B 4LG8A 1TYQC 3SNNA 2AQ5A 3AL8B 3NVXA 4LGNA 3JZGA 4L1QD 3QNOA 2AGXA 3SMRA 3EI2B 2HKRA 3NCIA 3TABA 5I5IA 2O9KA 5CYKB 5TEFA 2GC4A 4BH6A 1K32A 4KHWA 4IA9A 4FJGA 4CZYA 1ERJA 4A2MA 3PSLA 3SQ0A 2IURA 4O3UB 4A09B 3EWEA 3SUQA 4KFMB 4O45A 4FJXA 4FK2A 1GP2B 5EMMB 2P9NC 5HE0B 5TDHB 3F3FA 2H9NA 4ZOXA 4M3WA 4FA4D 2CE8A 4ERZA 4H5JA 4O9DA 4PBZA 4X3EA 3PE7A 3ULEC 3SCYA 2MZWB 5EMLB 5IBKB 4DTJA 2AGYA 3K26A 3VGZA 1NEXB 4EPHA 4GGCA 1Q9XA 4J8BA 3RRMC 3OKYB 4O1QD 4KHSA 1SQJA 4XYHA 4TZ4A 3EI4B 2E31A 1Q9YA 4RNGA 4A11A 3I7HA 2G99A 2JHPA 2YB8B 2H3XA 4X5MA 3RSEC 4DTXA 2B5LA 4XEIC 4GAMC 3OL2A 4A0AB 4DTUA 1RI6A 3DXMC 5GXIA 5AMSA 3NVQA 4CI8A 1MDAH 2P9LC 2AH0A 4I6JB 3NVNA 1YFQA 4FVMA 2P9KC 3MKQA 3P4FA 2OK4A 4DTRA 2AGLA 4GM8A 4JSPC 2HYEA 3NE6A 2H13A 3V7DB 5AJAA 5IJ7E 4A08B 4A0AA 3HFQA 4GZ8A 4J81A 2XL2A 4UI9R 4ZN4A 3WSOA 3EI4A 2B7MA 1U4CA 3UVNA 4CZVA 1XVDE 3EI3A 4FWWA 4ES0A 5C2VB 2GNQA 5TEEA 1MTYG 1IH7A 2HKMA 4E54B 3OKWA 3V5WB 3I2NA 5FKSA 2HD0A 2EBSA 2P5OA 4FJKA 5CXBA 5EARA 1TBGA 4FJ8A 5H37A 2IWFA 4N14A 1JJUB 4M42A 2CN3A 4X5NA 2JH8A 1XVCE 1MHYG 3C5MA 3SHFA 3OTTA 5FXYA 5EMJB 3CIKB 1XVFE 4J77A 3J2PA 1XKSA 1FYZE 4GGDA 4KHQA 5AFU3 2ATQA 2VJ5A 1PEVA 2MTAH 2YMUA 4EWRA 3SQ2A 3N1BA 3I8CA 1XMHE 2JHAA 3UKRC 4E5ZA 4J2BA 3PXSD 3UIQA 2CO0C 5K19A 3KD1E 2OZMA 2IUPA 2W18A 3AL8A 3QNNA 4ERQA 4X63B 5IJ8E 4JD2C 5EAMA 5FKQA 3JRPA 4H5IA 4JT6C 4CY5A 3IIWA 4O3TB 4E3SA 2AH1A 3SI6A 3QERA 2H68A 2HXCA 5CXCB 4ZOVA 5KDOB 3SXTD 3HP9A 2PFVA 5CXBB 4AEZA 4JSNC 3E4YA 2J57G 5EAPA 4E54A 4ERYA 3QEWA 2UZXB 4D0KA 3L4OD 4J79A 5FKRA 3TAGA 2DTUA 3F3GA 1GG2B 3F3PA 2YB5A 2B8IA 3MKSB 3SQ4A 2XL3A 2OIZA 4I9LA 2AGZA 2P1PB 1FZHE 4PSXB 2H9LA 2DEBA 3L1NA 4NSXA 2JHCA 1FXXA 3DWLC 1XVEE 3KRXB 2P9IC 3K2OA 3MXXA 3RLMD 3SN6B 5EM2B 5I5JA 5FKTA 2I0SA 2Z2OA 3AH8B 3VH0A 5H14A 4A7JA 5EM2A 4RL5A 3OW8A 4FA9D 4CY1A 4JSXC 2VJ4A 2Z2PA 3PXTD 4CI1A 4IMMA 4DTPA 1IG9A 3BWSA 3JZNA 4U1EI 4GQ1A 4HCCA 3QESA 1PI6A 2OZSA 3ODTA 4CC9A 3N0EA 2IUVA 3UVKA 2LF3A 3RMBA 4M3YA 4QRJA 4Y7RA 3OGMB 4JRQA 2RCUA 3RMAA 1XVBE 3JROA 3SVIA 4KHNA 2IUQA 1FZ5E 4A2LA 5H17A 4CZXA 1N6FA 4AOWA 2AGWA 4GQ2P 3SPZA 4FJLA 1SHYB 2IWKA 4M3ZA 4J0XA 4ZOYA 3QEXA 4QT8A 5IC7A 3NAEA 2BCJB 4R7AB 2H14A 2HJ4A 3QETA 4J2DA 5CXCA 4KHYA 4EP9A 1FZ0E 2P1MB 4PNKB 5SXMA 3IKOA 3SBQA 3VA6A 4AKGA 4DU4A 3OL2B 1QNIA 3RMCA 2QC5A 1SQ9A 3L0MA 2PM9A 3BG1A 3NDKA 4I79A 2H6KA 5IGQA 2PM6B 2P1NB 4J87A 4ESGA 2YNPA 3C6PB 2B5NA 1FZ7E 2B1EA 3E4WA 4GM3A 1PBYB 4J82A 1OMWB 3I7PA 3I89A 3CFOA 3SVWD 3ZWLB 4J2AA 5EMKB 1P22A 2JPNA 4E4BA 2CE9A 3PSCB 4LG9A 3SWSD 3SCXA 1XMGE 3A0FA 5GXHA 1XMFE 4J73A 3EI1A 2P5GA 3OKYA 2PBIB 4FAND 4HCBA 4CY3A 3I7LA 3SJJA 3J27A 3C75H 3W15A 3NGIA 4M3XA 3C94A 4X60B 2E32A 2Z2NA 2VIXA 4DU1A 4CY2A 4FJIA 2H6QA 1FZ1E 2CNXA 3C99A 4FJHA 4DTSA 4BUJC 2OYQA 3PVUB 2G9AA 3SBRA 5CYKA 2XU7A 1L0QA 3JZHA 4ADNA 4FJMA 3UKUC 5FQDA 2YBAA 3I7KA 4FA5D 3LZIA 4MK0B 5TF2A 4M41A 3ORVD 2P9UC 3IIYA 4CI2A 3CFRA 2OVPB 4DTNA 4FJNA 4OWRA 3JAMg 4JSVC 3OGKB 4L3HD 4L3GD 4E5ZB 3SQ1A 2JH9A 2J56H 4FK4A 5EALA 4RG8A 1XU5E 4J78A 4J86A 2B5MA 3QEIA 4AKHA 1XHMA 1FZ6E 1JOFA 1N6DA 2XYIA 3CFVA 2IAAA 4Z8LA 2QXFA 4A0BB 4M3UA 4BL0A 4J84A 1XVGE 4DTMA 4GGAA 2HJBA 1FZ2E 4QL1A 1FWXA 3KRWB 3I8EA 4JXMA 2MMBA 1NR0A 2YNNA 5A2Qg 3SFZA 1CLQA 4J0WA 4KI6A 4FJ5A 2CN2A 1U2VC 4G56B 4J8GA 1FZ9E 3DXKC 3N1EA 3L4MD 3EU7A 2H9PA 3E0CA 2P9PC 5B4WA 4JS5A 3CQ8A 3SPYA 2P9SC 4FJ7A 5HQGA 3UR4A 1FZ4E 3UVOA 2J55H 3I7OA 2I3TA 5C2WB 4FA1D 2QXVA 4JS4A 3RN1D 4FB1D 3NHGA 3OGLB 4A0BA 4YVDA 3C6OB 2HESX 4X61B 3IJ1A 4OZUA 3SLED 3HGLA 5H1MA 3UVMA 3SUOA 3DM0A 3N0DA 4M3RA 3L8BA 3JPXA 1FZ8E 5HE3B 4FJJA 1PGUA 2P1QB 3K27A 3RMDA 1R5MA 3JB9L 3EG6A 2H4TA 1B9YA 2H9MA 2I0RA 1A0RB 2YNOA 4HDJA 5FLXg 4B08A 2PM9B 4DTOA 3TJYA 2B4EA 5K1CC 4K3JB 5I5MA 4A11B 3CFSB 3OKTA 3PVWB 5IREA 4PBYA 5THAA 4FAVD 2TRCB 1WAFA 4U7AA 1FZIE 3L2OB 4ADOA 4PC0A 4FK0A 3QEPA 3FM0A 2P1OB 3PXWD 4KHUA 4ZOZA 4M45A 3RFHA 3QEVA 3RN0D 1XL3C 5FA5B 3AL9A 4JRPA 4M3TA 3SJLD 4A08A 4FHLA 4FJ9A 3C9CA 4J2EA 4A09A 3EMHA 5C9ZB 2FYOA 1K8KC 5GMKn 1XU3E 1MG3A 2H47A 4GM9A 3C95A 5HYNB 5IGOA 3TL8B 3CFPA 3MMYA 1MG2A 3LDBA 3V9FA 1FZ3E 5GSAA 4I9QA 3AFCA 2OVRB 4K3ID 2I3SA 2DY4A 4QQEA 1B9XA 1JMXB 4GQBB 1XIPA 4Y5RD 1OLZA 5HE1B 3J81g 4CI3A 2LF6A 3TAEA 1WAJA 1MMOG 4XYIA 3J80g 3RWUA 4AI6A 2FW3A 4KI4A 3LD8A 3C6NB 1FS1A 4JT5C 3RMZD 3GFCA 3B7FA 4GMBA 3MZKA 4EYWA 3FGBA 3UVLA 2I0TA 2PFTA 5JWZA 2H6NA 1LDKE 4QNCA 4QNDA 2PM7B 3DSMA 3SBPA 1JMZB 3BG0A 5IZ7A 2GC7A 3EI1B 4D6VA 1GOTB 3EI3B 4PXWA 3TAFA 2CO0A 2OK6A 3LZJA 3S9HA 5IT9g 1VYHC 3U4YA 1MHZG 2OJYA 1GXRA 3HGKE 2OVQB 2BBKH 3GREA 3IJCA 3IJ0A 3RFGA 4DU3A 1Q47A 1N6EA 3FRXA 3MZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7N A;  4L9O A;  3EI2 A;  1S4U X;  2Q7Q A;  2UZY B;  4PSW B;  5HE2 B;  4LG8 A;  1TYQ C;  2AQ5 A;  3AL8 B;  4LGN A;  3NVX A;  3JZG A;  4L1Q D;  2AGX A;  3SMR A;  3EI2 B;  2HKR A;  5I5I A;  2O9K A;  5CYK B;  5TEF A;  2GC4 A;  4BH6 A;  1K32 A;  4IA9 A;  4CZY A;  1ERJ A;  4A2M A;  3PSL A;  2IUR A;  4O3U B;  4A09 B;  3EWE A;  4KFM B;  4O45 A;  1GP2 B;  5EMM B;  2P9N C;  5HE0 B;  5TDH B;  3F3F A;  2H9N A;  4ZOX A;  4FA4 D;  2CE8 A;  4ERZ A;  4H5J A;  4O9D A;  4PBZ A;  4X3E A;  3PE7 A;  3ULE C;  3SCY A;  5EML B;  5IBK B;  3K26 A;  2AGY A;  3VGZ A;  1NEX B;  4GGC A;  4J8B A;  3RRM C;  3OKY B;  4O1Q D;  1SQJ A;  4XYH A;  4TZ4 A;  3EI4 B;  2E31 A;  4A11 A;  3I7H A;  2G99 A;  2YB8 B;  2H3X A;  3RSE C;  2B5L A;  4XEI C;  3OL2 A;  4A0A B;  1RI6 A;  3DXM C;  5GXI A;  5AMS A;  3NVQ A;  4CI8 A;  1MDA H;  2P9L C;  2AH0 A;  4I6J B;  3NVN A;  1YFQ A;  2P9K C;  3MKQ A;  3P4F A;  2OK4 A;  2AGL A;  4GM8 A;  4JSP C;  2HYE A;  2H13 A;  3V7D B;  5AJA A;  5IJ7 E;  4A08 B;  4A0A A;  3HFQ A;  4GZ8 A;  4J81 A;  2XL2 A;  4UI9 R;  4ZN4 A;  3WSO A;  3EI4 A;  1U4C A;  3UVN A;  4CZV A;  3EI3 A;  4ES0 A;  4FWW A;  5C2V B;  2GNQ A;  5TEE A;  2HKM A;  4E54 B;  3OKW A;  3V5W B;  3I2N A;  5FKS A;  2EBS A;  5CXB A;  5EAR A;  1TBG A;  2IWF A;  4N14 A;  1JJU B;  2CN3 A;  3C5M A;  3SHF A;  3OTT A;  5FXY A;  5EMJ B;  3CIK B;  4J77 A;  1XKS A;  4GGD A;  5AFU 3;  1PEV A;  2MTA H;  2YMU A;  4EWR A;  3I8C A;  3UKR C;  4E5Z A;  3PXS D;  2CO0 C;  5K19 A;  2IUP A;  2W18 A;  3AL8 A;  4ERQ A;  4X63 B;  5IJ8 E;  4JD2 C;  5EAM A;  5FKQ A;  3JRP A;  4H5I A;  4JT6 C;  4CY5 A;  3IIW A;  4O3T B;  2HXC A;  2AH1 A;  5CXC B;  2H68 A;  4ZOV A;  5KDO B;  3SXT D;  5CXB B;  4AEZ A;  4JSN C;  5EAP A;  2J57 G;  4E54 A;  4ERY A;  2UZX B;  4D0K A;  3L4O D;  4J79 A;  5FKR A;  3F3G A;  1GG2 B;  3F3P A;  3MKS B;  2XL3 A;  2OIZ A;  2AGZ A;  2P1P B;  4PSX B;  2H9L A;  4NSX A;  3DWL C;  3KRX B;  2P9I C;  3MXX A;  3RLM D;  3SN6 B;  5EM2 B;  5I5J A;  5FKT A;  2I0S A;  2Z2O A;  3AH8 B;  3VH0 A;  5H14 A;  4A7J A;  5EM2 A;  4FA9 D;  3OW8 A;  4CY1 A;  4JSX C;  2Z2P A;  3PXT D;  4CI1 A;  4IMM A;  3JZN A;  3BWS A;  4U1E I;  4GQ1 A;  1PI6 A;  3ODT A;  4CC9 A;  3N0E A;  2IUV A;  3UVK A;  4QRJ A;  4Y7R A;  3OGM B;  3JRO A;  2IUQ A;  4A2L A;  5H17 A;  4CZX A;  1N6F A;  4AOW A;  2AGW A;  4GQ2 P;  1SHY B;  2IWK A;  4J0X A;  4ZOY A;  4QT8 A;  5IC7 A;  2BCJ B;  4R7A B;  2H14 A;  2HJ4 A;  5CXC A;  2P1M B;  4PNK B;  5SXM A;  3IKO A;  3SBQ A;  3VA6 A;  3OL2 B;  1QNI A;  2QC5 A;  1SQ9 A;  2PM9 A;  3BG1 A;  4I79 A;  5IGQ A;  2H6K A;  2PM6 B;  2P1N B;  4J87 A;  4ESG A;  2YNP A;  3C6P B;  2B5N A;  4GM3 A;  1PBY B;  4J82 A;  1OMW B;  3I7P A;  3I89 A;  3SVW D;  3ZWL B;  5EMK B;  1P22 A;  2CE9 A;  3PSC B;  4LG9 A;  3SWS D;  3A0F A;  5GXH A;  4J73 A;  3EI1 A;  3OKY A;  2PBI B;  4FAN D;  4CY3 A;  3I7L A;  3C75 H;  3W15 A;  4X60 B;  2E32 A;  2Z2N A;  4CY2 A;  2H6Q A;  2CNX A;  3C99 A;  4BUJ C;  3PVU B;  2G9A A;  3SBR A;  5CYK A;  2XU7 A;  1L0Q A;  3JZH A;  3UKU C;  5FQD A;  2YBA A;  3I7K A;  4FA5 D;  4MK0 B;  5TF2 A;  3ORV D;  2P9U C;  3IIY A;  1Q47 A;  4CI2 A;  2OVP B;  3JAM g;  4OWR A;  4JSV C;  4L3G D;  3OGK B;  4L3H D;  4E5Z B;  2J56 H;  5EAL A;  4J78 A;  4J86 A;  2B5M A;  1XHM A;  1N6D A;  1JOF A;  2XYI A;  3CFV A;  2IAA A;  4Z8L A;  4A0B B;  4BL0 A;  4J84 A;  4GGA A;  2HJB A;  4QL1 A;  1FWX A;  3KRW B;  3I8E A;  4JXM A;  5A2Q g;  1NR0 A;  2YNN A;  3SFZ A;  4J0W A;  2CN2 A;  1U2V C;  4G56 B;  4J8G A;  3DXK C;  3L4M D;  3EU7 A;  2H9P A;  3E0C A;  2P9P C;  5B4W A;  2P9S C;  5HQG A;  3UR4 A;  3UVO A;  2J55 H;  3I7O A;  2I3T A;  5C2W B;  4FA1 D;  2QXV A;  3RN1 D;  4FB1 D;  3OGL B;  4A0B A;  4YVD A;  3C6O B;  2HES X;  4X61 B;  3IJ1 A;  4OZU A;  3SLE D;  3UVM A;  5H1M A;  3N0D A;  3DM0 A;  3JPX A;  5HE3 B;  1PGU A;  2P1Q B;  3K27 A;  1R5M A;  3JB9 L;  3EG6 A;  1B9Y A;  2H9M A;  2I0R A;  1A0R B;  2YNO A;  4HDJ A;  5FLX g;  2PM9 B;  2B4E A;  5K1C C;  4K3J B;  5I5M A;  4A11 B;  3CFS B;  3OKT A;  3PVW B;  4PBY A;  5THA A;  4FAV D;  2TRC B;  4U7A A;  3L2O B;  4PC0 A;  3FM0 A;  2P1O B;  3PXW D;  4ZOZ A;  3RFH A;  3RN0 D;  5FA5 B;  3AL9 A;  4A08 A;  3SJL D;  4FHL A;  3C9C A;  4A09 A;  3EMH A;  5C9Z B;  1K8K C;  5GMK n;  1MG3 A;  2H47 A;  4GM9 A;  5HYN B;  5IGO A;  3MMY A;  1MG2 A;  3V9F A;  5GSA A;  3AFC A;  2OVR B;  4K3I D;  4QQE A;  2I3S A;  1B9X A;  1JMX B;  4GQB B;  1XIP A;  4Y5R D;  1OLZ A;  5HE1 B;  3J81 g;  4CI3 A;  4XYI A;  3J80 g;  3C6N B;  1FS1 A;  4JT5 C;  3RMZ D;  3GFC A;  3B7F A;  4GMB A;  3MZK A;  3FGB A;  3UVL A;  2I0T A;  5JWZ A;  2H6N A;  2PM7 B;  3DSM A;  3SBP A;  1JMZ B;  3BG0 A;  2GC7 A;  3EI1 B;  4D6V A;  1GOT B;  3EI3 B;  4PXW A;  2CO0 A;  2OK6 A;  5IT9 g;  1VYH C;  3U4Y A;  2OJY A;  1GXR A;  2OVQ B;  2BBK H;  3GRE A;  3IJC A;  3IJ0 A;  3RFG A;  1LDK E;  1N6E A;  3FRX A;  3MZL A; 
#chains in the Genus database with same CATH topology
 3I7N A;  3HL8 A;  3SUN A;  1JTD B;  4AKI A;  4L9O A;  3EI2 A;  1QFM A;  1S4U X;  5HDB A;  3LDS A;  2Q7Q A;  2UZY B;  5M5R A;  3SUP A;  4PSW B;  3KD5 E;  5HE2 B;  1UOP A;  1TYQ C;  3SNN A;  2AQ5 A;  3AL8 B;  3GD1 I;  3NVX A;  3O4J A;  4LG8 A;  3JZG A;  4L1Q D;  4LGN A;  3QNO A;  2AGX A;  3SMR A;  3EI2 B;  2HKR A;  3NCI A;  3TAB A;  2VC2 A;  5I5I A;  2O9K A;  5CYK B;  5TEF A;  2GC4 A;  1UOQ A;  4BH6 A;  1K32 A;  4KHW A;  4IA9 A;  4FJG A;  4CZY A;  1ERJ A;  4A2M A;  2VDL A;  3PSL A;  3SQ0 A;  2IUR A;  5E6R A;  4O3U B;  4A09 B;  4AN0 A;  3EWE A;  3SUQ A;  4KFM B;  4O45 A;  4FJX A;  4FK2 A;  4DNW A;  1GP2 B;  5EMM B;  2P9N C;  5HE0 B;  5TDH B;  3F3F A;  2H9N A;  4ZOX A;  4M3W A;  4FA4 D;  2CE8 A;  4ERZ A;  4H5J A;  4O9D A;  4WK4 A;  4PBZ A;  4X3E A;  3PE7 A;  3ULE C;  3SCY A;  2MZW B;  5EML B;  5IBK B;  3V4P A;  4DTJ A;  2AGY A;  3K26 A;  4MMZ A;  3VGZ A;  1NEX B;  4EPH A;  4GGC A;  1Q9X A;  4J8B A;  3RRM C;  3EQ9 A;  3OKY B;  4O1Q D;  4KHS A;  1SQJ A;  4XYH A;  4TZ4 A;  3EI4 B;  2E31 A;  1Q9Y A;  4RNG A;  4A11 A;  1U8C A;  2G99 A;  2JHP A;  3I7H A;  2YB8 B;  2H3X A;  4X5M A;  3RSE C;  4DTX A;  2B5L A;  4XEI C;  4GAM C;  3OL2 A;  4A0A B;  2XDW A;  4DTU A;  1RI6 A;  3DXM C;  5GXI A;  4DNV A;  5AMS A;  3NVQ A;  4CI8 A;  1MDA H;  2P9L C;  1FPO A;  5C86 A;  2AH0 A;  4I6J B;  3NVN A;  1YFQ A;  4FVM A;  2P9K C;  3MKQ A;  3P4F A;  2OK4 A;  3NIF A;  4DTR A;  2AGL A;  4GM8 A;  4JSP C;  2HYE A;  3NE6 A;  2H13 A;  3V7D B;  1UTC A;  5AJA A;  5IJ7 E;  4A08 B;  4A0A A;  3HFQ A;  4GZ8 A;  4J81 A;  2XL2 A;  3VI4 A;  4WK0 A;  4UI9 R;  4ZN4 A;  3WSO A;  3EI4 A;  2B7M A;  1U4C A;  3UVN A;  3IVM A;  4CZV A;  1XVD E;  3EI3 A;  4FWW A;  4ES0 A;  5C2V B;  2GNQ A;  5TEE A;  1MTY G;  1JV2 A;  1IH7 A;  2HKM A;  4E54 B;  3OKW A;  3BVO A;  3V5W B;  3T3M A;  3I2N A;  5FKS A;  2HD0 A;  2EBS A;  2P5O A;  4FJK A;  5CXB A;  5EAR A;  1TBG A;  4FJ8 A;  5H37 A;  2IWF A;  4N14 A;  1JJU B;  4M42 A;  2CN3 A;  4BP8 A;  4X5N A;  2JH8 A;  4JHP C;  1XVC E;  3K6S A;  1MHY G;  3C5M A;  3SHF A;  3OTT A;  5FXY A;  5EMJ B;  3CIK B;  1XVF E;  1O6G A;  4J77 A;  3J2P A;  1XKS A;  1FYZ E;  3K71 A;  4GGD A;  2XZG A;  4KHQ A;  5AFU 3;  2ATQ A;  2VJ5 A;  4BCB A;  3UO2 A;  1PEV A;  2HU8 A;  2MTA H;  3SQ2 A;  3N1B A;  2YMU A;  3I8C A;  4EWR A;  1XMH E;  2JHA A;  3UKR C;  4E5Z A;  4J2B A;  3PXS D;  3UIQ A;  2RKH A;  2CO0 C;  5K19 A;  3KD1 E;  2OZM A;  2IUP A;  2W18 A;  3AL8 A;  1T2X A;  2JKX A;  3QNN A;  4ERQ A;  4X63 B;  4UM9 A;  5IJ8 E;  4JD2 C;  5EAM A;  5FKQ A;  4O02 A;  3UO3 A;  3JRP A;  4H5I A;  4JT6 C;  4CY5 A;  1H2W A;  3IIW A;  4O3T B;  4E3S A;  2AH1 A;  3SI6 A;  3QER A;  2H68 A;  2HXC A;  5CXC B;  4ZOV A;  5KDO B;  3SXT D;  3HP9 A;  1M1X A;  2PFV A;  5CXB B;  4AEZ A;  4JSN C;  3E4Y A;  2J57 G;  5EAP A;  4E54 A;  1A12 A;  4AMZ A;  4ERY A;  3QEW A;  2UZX B;  4D0K A;  3L4O D;  4J79 A;  5FFO A;  3ZDY A;  5FKR A;  3TAG A;  4D9S A;  2DTU A;  3F3G A;  1GG2 B;  3F3P A;  4IRZ A;  2YB5 A;  4BP9 A;  5M5S A;  2B8I A;  3MKS B;  3SQ4 A;  2XL3 A;  2OIZ A;  4I9L A;  2AGZ A;  2P1P B;  1FZH E;  4PSX B;  2H9L A;  2VDN A;  3IJE A;  2DEB A;  3ZE0 A;  3L1N A;  4NSX A;  2JHC A;  1FXX A;  3DWL C;  1XVE E;  4NC4 A;  1C9I A;  3KRX B;  3EQ7 A;  2P9I C;  3K2O A;  3MXX A;  3RLM D;  3SN6 B;  4BCD A;  3QHY B;  5EM2 B;  5I5J A;  5FKT A;  2I0S A;  2Z2O A;  3AH8 B;  3VH0 A;  5H14 A;  4A7J A;  5EM2 A;  4BCC A;  4RL5 A;  2WQ8 A;  3OW8 A;  4FA9 D;  4CY1 A;  4JSX C;  2VJ4 A;  2Z2P A;  3PXT D;  4UM8 A;  4CI1 A;  4IMM A;  4DTP A;  4J86 A;  1IG9 A;  3BWS A;  3JZN A;  4U1E I;  4GQ1 A;  4HCC A;  3QES A;  1PI6 A;  2OZS A;  3ODT A;  4CC9 A;  3N0E A;  2IUV A;  3UVK A;  4AX4 A;  2LF3 A;  4IT5 A;  3RMB A;  4M3Y A;  4QRJ A;  4Y7R A;  4MMX A;  3OGM B;  4JRQ A;  2RCU A;  3RMA A;  1XVB E;  3JRO A;  3SVI A;  3ZDZ A;  4KHN A;  2VZ3 A;  2IUQ A;  1FZ5 E;  1GOH A;  4A2L A;  5H17 A;  4CZX A;  1N6F A;  4AOW A;  2AGW A;  4GQ2 P;  3MUO A;  3SPZ A;  4FJL A;  1SHY B;  1VE6 A;  1YR2 A;  2IWK A;  4M3Z A;  3NIG A;  4J0X A;  4ZOY A;  3QEX A;  1E8M A;  4QT8 A;  3NAE A;  5IC7 A;  2BCJ B;  4R7A B;  2H14 A;  2HJ4 A;  1GOF A;  4QAM A;  3QET A;  4J2D A;  5CXC A;  4KHY A;  4EP9 A;  1FZ0 E;  2P1M B;  4PNK B;  5SXM A;  5E6U A;  3IKO A;  3SBQ A;  3VA6 A;  3ZE1 A;  2QZP A;  4AKG A;  4DU4 A;  3OL2 B;  1QNI A;  3RMC A;  2QC5 A;  1SQ9 A;  3V4V A;  3L0M A;  2PM9 A;  4Z7O A;  5FLX g;  3BG1 A;  1E5T A;  3NDK A;  4I79 A;  2H6K A;  5IGQ A;  1VE7 A;  1H2Y A;  2PM6 B;  2P1N B;  4J87 A;  4ESG A;  2YNP A;  3C6P B;  2B5N A;  1FZ7 E;  2B1E A;  3IUL A;  3E4W A;  4GM3 A;  1PBY B;  3ZDX A;  4J82 A;  1OMW B;  4AMY A;  3I7P A;  2EIC A;  3I89 A;  3QI0 A;  3CFO A;  3SVW D;  3ZWL B;  4ICG C;  4J2A A;  1H2X A;  5EMK B;  1P22 A;  2JPN A;  4E4B A;  2CE9 A;  3PSC B;  4LG9 A;  3SWS D;  3SCX A;  3IUM A;  1N1C A;  1XMG E;  5C92 A;  2VDQ A;  3A0F A;  5GXH A;  1XMF E;  4J73 A;  3EI1 A;  2P5G A;  3OKY A;  2PBI B;  4FAN D;  4DNU A;  4HCB A;  4CY3 A;  3I7L A;  3SJJ A;  3J27 A;  3DDU A;  3ZE2 A;  3C75 H;  3W15 A;  3NGI A;  4M3X A;  3C94 A;  4X60 B;  2E32 A;  2Z2N A;  2VIX A;  4DU1 A;  4CY2 A;  4FJI A;  2H6Q A;  1FZ1 E;  2CNX A;  3C99 A;  4WK2 A;  4JHN A;  4FJH A;  4DTS A;  4BUJ C;  4O2W A;  2VDR A;  2OYQ A;  3PVU B;  2G9A A;  3SBR A;  5CYK A;  2MW2 A;  2XU7 A;  1L0Q A;  1C9L A;  4ADN A;  4FJM A;  3JZH A;  3UKU C;  5FQD A;  4WJK A;  2YBA A;  3I7K A;  4FA5 D;  3LZI A;  4MK0 B;  5TF2 A;  4NAA A;  4M41 A;  3ORV D;  2P9U C;  3FCS A;  3GC3 B;  3IIY A;  4CI2 A;  3CFR A;  3VI3 A;  2OVP B;  4DTN A;  4FJN A;  4OWR A;  3JAM g;  4Z7N A;  4JSV C;  4Z7Q A;  3OGK B;  4L3H D;  4L3G D;  4E5Z B;  3SQ1 A;  2JH9 A;  2J56 H;  4FK4 A;  2QR5 A;  5EAL A;  1VZ3 A;  4RG8 A;  1XU5 E;  4J78 A;  3NID A;  2B5M A;  3QEI A;  4AKH A;  3O4I A;  1XHM A;  1FZ6 E;  1JOF A;  1N6D A;  2XYI A;  3CFV A;  3K72 A;  3EQ8 A;  2IAA A;  4Z8L A;  2QXF A;  4G55 A;  4A0B B;  4M3U A;  4BL0 A;  2EIE A;  1XVG E;  4DTM A;  4GGA A;  4J84 A;  2HJB A;  1FZ2 E;  4QL1 A;  2VDM A;  1FWX A;  3KRW B;  1BPO A;  3I8E A;  4JXM A;  2MMB A;  1NR0 A;  2YNN A;  5A2Q g;  3SFZ A;  1CLQ A;  4J0W A;  4KI6 A;  4FJ5 A;  2CN2 A;  1U2V C;  5E6S A;  4G56 B;  4J8G A;  1FZ9 E;  3DXK C;  3N1E A;  3L4M D;  3EU7 A;  2H9P A;  2JQT A;  2XE4 A;  3E0C A;  2VZ1 A;  2P9P C;  5B4W A;  4JS5 A;  3CQ8 A;  3SPY A;  2P9S C;  1K3I A;  4FJ7 A;  5HQG A;  3UR4 A;  1FZ4 E;  3UVO A;  2J55 H;  3I7O A;  2I3T A;  5C2W B;  4FA1 D;  2QXV A;  4JS4 A;  3RN1 D;  4FB1 D;  4RE5 A;  3NHG A;  3KCI A;  3OGL B;  4A0B A;  3OF7 A;  4YVD A;  3T3P A;  3C6O B;  2HES X;  4X61 B;  5M5V A;  3IJ1 A;  2VDP A;  4OZU A;  3SLE D;  3HGL A;  5H1M A;  3UVM A;  3SUO A;  3DM0 A;  3N0D A;  4M3R A;  3L8B A;  3JPX A;  1FZ8 E;  5HE3 B;  4FJJ A;  1PGU A;  2VDO A;  2P1Q B;  3K27 A;  3RMD A;  1R5M A;  3JB9 L;  3EG6 A;  2BKL A;  2H4T A;  1B9Y A;  2H9M A;  2I0R A;  1A0R B;  2YNO A;  4HDJ A;  5M5T A;  4B08 A;  2PM9 B;  4DTO A;  3TJY A;  2B4E A;  5K1C C;  4K3J B;  5I5M A;  4G1E A;  3MVD K;  4A11 B;  3CFS B;  4G1M A;  3OKT A;  3PVW B;  5IRE A;  4PBY A;  5THA A;  4FAV D;  1QFS A;  2TRC B;  1WAF A;  4U7A A;  1FZI E;  3L2O B;  4ADO A;  1H2Z A;  3FCU A;  3IUJ A;  3IUQ A;  4FK0 A;  4PC0 A;  3QEP A;  3FM0 A;  2P1O B;  3PXW D;  1I2M B;  4KHU A;  4M45 A;  4ZOZ A;  3QEV A;  3RFH A;  3RN0 D;  1XL3 C;  5FA5 B;  3AL9 A;  4JRP A;  4M3T A;  3SJL D;  4A08 A;  2VDK A;  4FHL A;  4FJ9 A;  3C9C A;  4J2E A;  4A09 A;  1GOG A;  3EMH A;  2K5S A;  5FFG A;  2FYO A;  4NBM A;  5C9Z B;  1K8K C;  5GMK n;  3IUN A;  2EID A;  1XU3 E;  1MG3 A;  2H47 A;  4GM9 A;  3C95 A;  5HYN B;  5IGO A;  3TL8 B;  4RE6 A;  3CFP A;  3MMY A;  1MG2 A;  4AN1 A;  3LDB A;  3V9F A;  1FZ3 E;  5GSA A;  4I9Q A;  1TYE A;  3IUR A;  3AFC A;  2OVR B;  4K3I D;  5M61 A;  2I3S A;  2DY4 A;  3O4G A;  1B9X A;  1E8N A;  4QQE A;  1O6F A;  1JMX B;  4GQB B;  1XIP A;  4Y5R D;  1OLZ A;  5HE1 B;  1L5G A;  3J81 g;  4CI3 A;  2LF6 A;  3TAE A;  1WAJ A;  1MMO G;  4XYI A;  3J80 g;  3RWU A;  4AI6 A;  2FW3 A;  4KI4 A;  4L1M A;  3LD8 A;  3C6N B;  1UOO A;  1FS1 A;  4JT5 C;  3RMZ D;  3GFC A;  3B7F A;  4GMB A;  3MZK A;  4EYW A;  3FGB A;  3UVL A;  2I0T A;  1JW2 A;  2PFT A;  5JWZ A;  2H6N A;  1LDK E;  4QNC A;  4QND A;  4NEN A;  2HU7 A;  2PM7 B;  3DSM A;  3MUN A;  3SBP A;  1JMZ B;  3BG0 A;  5IZ7 A;  2GC7 A;  2EIB A;  3EI1 B;  4D6V A;  1GOT B;  3EI3 B;  4PXW A;  4MMY A;  3TAF A;  2CO0 A;  2OK6 A;  3LZJ A;  3S9H A;  5IT9 g;  1VYH C;  3U4Y A;  2HU5 A;  1MHZ G;  1VZ2 A;  2OJY A;  1GXR A;  3HGK E;  3O4H A;  2OVQ B;  2BBK H;  3GRE A;  3IJC A;  3IJ0 A;  3RFG A;  4DU3 A;  5M5U A;  1Q47 A;  1N6E A;  3FRX A;  3MZL A; 
#chains in the Genus database with same CATH homology
 3I7N A;  3HL8 A;  3SUN A;  4L9O A;  4AKI A;  3EI2 A;  1S4U X;  3LDS A;  2Q7Q A;  2UZY B;  3SUP A;  4PSW B;  3KD5 E;  5HE2 B;  4LG8 A;  1TYQ C;  3SNN A;  2AQ5 A;  3AL8 B;  3NVX A;  4LGN A;  3JZG A;  4L1Q D;  3QNO A;  2AGX A;  3SMR A;  3EI2 B;  2HKR A;  3NCI A;  3TAB A;  5I5I A;  2O9K A;  5CYK B;  5TEF A;  2GC4 A;  4BH6 A;  1K32 A;  4KHW A;  4IA9 A;  4FJG A;  4CZY A;  1ERJ A;  4A2M A;  3PSL A;  3SQ0 A;  2IUR A;  4O3U B;  4A09 B;  3EWE A;  3SUQ A;  4KFM B;  4O45 A;  4FJX A;  4FK2 A;  1GP2 B;  5EMM B;  2P9N C;  5HE0 B;  5TDH B;  3F3F A;  2H9N A;  4ZOX A;  4M3W A;  4FA4 D;  2CE8 A;  4ERZ A;  4H5J A;  4O9D A;  4PBZ A;  4X3E A;  3PE7 A;  3ULE C;  3SCY A;  2MZW B;  5EML B;  5IBK B;  4DTJ A;  2AGY A;  3K26 A;  3VGZ A;  1NEX B;  4EPH A;  4GGC A;  1Q9X A;  4J8B A;  3RRM C;  3OKY B;  4O1Q D;  4KHS A;  1SQJ A;  4XYH A;  4TZ4 A;  3EI4 B;  2E31 A;  1Q9Y A;  4RNG A;  4A11 A;  3I7H A;  2G99 A;  2JHP A;  2YB8 B;  2H3X A;  4X5M A;  3RSE C;  4DTX A;  2B5L A;  4XEI C;  4GAM C;  3OL2 A;  4A0A B;  4DTU A;  1RI6 A;  3DXM C;  5GXI A;  5AMS A;  3NVQ A;  4CI8 A;  1MDA H;  2P9L C;  2AH0 A;  4I6J B;  3NVN A;  1YFQ A;  4FVM A;  2P9K C;  3MKQ A;  3P4F A;  2OK4 A;  4DTR A;  2AGL A;  4GM8 A;  4JSP C;  2HYE A;  3NE6 A;  2H13 A;  3V7D B;  5AJA A;  5IJ7 E;  4A08 B;  4A0A A;  3HFQ A;  4GZ8 A;  4J81 A;  2XL2 A;  4UI9 R;  4ZN4 A;  3WSO A;  3EI4 A;  2B7M A;  1U4C A;  3UVN A;  4CZV A;  1XVD E;  3EI3 A;  4FWW A;  4ES0 A;  5C2V B;  2GNQ A;  5TEE A;  1MTY G;  1IH7 A;  2HKM A;  4E54 B;  3OKW A;  3V5W B;  3I2N A;  5FKS A;  2HD0 A;  2EBS A;  2P5O A;  4FJK A;  5CXB A;  5EAR A;  1TBG A;  4FJ8 A;  5H37 A;  2IWF A;  4N14 A;  1JJU B;  4M42 A;  2CN3 A;  4X5N A;  2JH8 A;  1XVC E;  1MHY G;  3C5M A;  3SHF A;  3OTT A;  5FXY A;  5EMJ B;  3CIK B;  1XVF E;  4J77 A;  3J2P A;  1XKS A;  1FYZ E;  4GGD A;  4KHQ A;  5AFU 3;  2ATQ A;  2VJ5 A;  1PEV A;  2MTA H;  2YMU A;  4EWR A;  3SQ2 A;  3N1B A;  3I8C A;  1XMH E;  2JHA A;  3UKR C;  4E5Z A;  4J2B A;  3PXS D;  3UIQ A;  2CO0 C;  5K19 A;  3KD1 E;  2OZM A;  2IUP A;  2W18 A;  3AL8 A;  3QNN A;  4ERQ A;  4X63 B;  5IJ8 E;  4JD2 C;  5EAM A;  5FKQ A;  3JRP A;  4H5I A;  4JT6 C;  4CY5 A;  3IIW A;  4O3T B;  4E3S A;  2AH1 A;  3SI6 A;  3QER A;  2H68 A;  2HXC A;  5CXC B;  4ZOV A;  5KDO B;  3SXT D;  3HP9 A;  2PFV A;  5CXB B;  4AEZ A;  4JSN C;  3E4Y A;  2J57 G;  5EAP A;  4E54 A;  4ERY A;  3QEW A;  2UZX B;  4D0K A;  3L4O D;  4J79 A;  5FKR A;  3TAG A;  2DTU A;  3F3G A;  1GG2 B;  3F3P A;  2YB5 A;  2B8I A;  3MKS B;  3SQ4 A;  2XL3 A;  2OIZ A;  4I9L A;  2AGZ A;  2P1P B;  1FZH E;  4PSX B;  2H9L A;  2DEB A;  3L1N A;  4NSX A;  2JHC A;  1FXX A;  3DWL C;  1XVE E;  3KRX B;  2P9I C;  3K2O A;  3MXX A;  3RLM D;  3SN6 B;  5EM2 B;  5I5J A;  5FKT A;  2I0S A;  2Z2O A;  3AH8 B;  3VH0 A;  5H14 A;  4A7J A;  5EM2 A;  4RL5 A;  3OW8 A;  4FA9 D;  4CY1 A;  4JSX C;  2VJ4 A;  2Z2P A;  3PXT D;  4CI1 A;  4IMM A;  4DTP A;  1IG9 A;  3BWS A;  3JZN A;  4U1E I;  4GQ1 A;  4HCC A;  3QES A;  1PI6 A;  2OZS A;  3ODT A;  4CC9 A;  3N0E A;  2IUV A;  3UVK A;  2LF3 A;  3RMB A;  4M3Y A;  4QRJ A;  4Y7R A;  3OGM B;  4JRQ A;  2RCU A;  3RMA A;  1XVB E;  3JRO A;  3SVI A;  4KHN A;  2IUQ A;  1FZ5 E;  4A2L A;  5H17 A;  4CZX A;  1N6F A;  4AOW A;  2AGW A;  4GQ2 P;  3SPZ A;  4FJL A;  1SHY B;  2IWK A;  4M3Z A;  4J0X A;  4ZOY A;  3QEX A;  4QT8 A;  5IC7 A;  3NAE A;  2BCJ B;  4R7A B;  2H14 A;  2HJ4 A;  3QET A;  4J2D A;  5CXC A;  4KHY A;  4EP9 A;  1FZ0 E;  2P1M B;  4PNK B;  5SXM A;  3IKO A;  3SBQ A;  3VA6 A;  4AKG A;  4DU4 A;  3OL2 B;  1QNI A;  3RMC A;  2QC5 A;  1SQ9 A;  3L0M A;  2PM9 A;  3BG1 A;  3NDK A;  4I79 A;  2H6K A;  5IGQ A;  2PM6 B;  2P1N B;  4J87 A;  4ESG A;  2YNP A;  3C6P B;  2B5N A;  1FZ7 E;  2B1E A;  3E4W A;  4GM3 A;  1PBY B;  4J82 A;  1OMW B;  3I7P A;  3I89 A;  3CFO A;  3SVW D;  3ZWL B;  4J2A A;  5EMK B;  1P22 A;  2JPN A;  4E4B A;  2CE9 A;  3PSC B;  4LG9 A;  3SWS D;  3SCX A;  1XMG E;  3A0F A;  5GXH A;  1XMF E;  4J73 A;  3EI1 A;  2P5G A;  3OKY A;  2PBI B;  4FAN D;  4HCB A;  4CY3 A;  3I7L A;  3SJJ A;  3J27 A;  3C75 H;  3W15 A;  3NGI A;  4M3X A;  3C94 A;  4X60 B;  2E32 A;  2Z2N A;  2VIX A;  4DU1 A;  4CY2 A;  4FJI A;  2H6Q A;  1FZ1 E;  2CNX A;  3C99 A;  4FJH A;  4DTS A;  4BUJ C;  2OYQ A;  3PVU B;  2G9A A;  3SBR A;  5CYK A;  2XU7 A;  1L0Q A;  3JZH A;  4ADN A;  4FJM A;  3UKU C;  5FQD A;  2YBA A;  3I7K A;  4FA5 D;  3LZI A;  4MK0 B;  5TF2 A;  4M41 A;  3ORV D;  2P9U C;  3IIY A;  4CI2 A;  3CFR A;  2OVP B;  4DTN A;  4FJN A;  4OWR A;  3JAM g;  4JSV C;  3OGK B;  4L3H D;  4L3G D;  4E5Z B;  3SQ1 A;  2JH9 A;  2J56 H;  4FK4 A;  5EAL A;  4RG8 A;  1XU5 E;  4J78 A;  4J86 A;  2B5M A;  3QEI A;  4AKH A;  1XHM A;  1FZ6 E;  1JOF A;  1N6D A;  2XYI A;  3CFV A;  2IAA A;  4Z8L A;  2QXF A;  4A0B B;  4M3U A;  4BL0 A;  4J84 A;  1XVG E;  4DTM A;  4GGA A;  2HJB A;  1FZ2 E;  4QL1 A;  1FWX A;  3KRW B;  3I8E A;  4JXM A;  2MMB A;  1NR0 A;  2YNN A;  5A2Q g;  3SFZ A;  1CLQ A;  4J0W A;  4KI6 A;  4FJ5 A;  2CN2 A;  1U2V C;  4G56 B;  4J8G A;  1FZ9 E;  3DXK C;  3N1E A;  3L4M D;  3EU7 A;  2H9P A;  3E0C A;  2P9P C;  5B4W A;  4JS5 A;  3CQ8 A;  3SPY A;  2P9S C;  4FJ7 A;  5HQG A;  3UR4 A;  1FZ4 E;  3UVO A;  2J55 H;  3I7O A;  2I3T A;  5C2W B;  4FA1 D;  2QXV A;  4JS4 A;  3RN1 D;  4FB1 D;  3NHG A;  3OGL B;  4A0B A;  4YVD A;  3C6O B;  2HES X;  4X61 B;  3IJ1 A;  4OZU A;  3SLE D;  3HGL A;  5H1M A;  3UVM A;  3SUO A;  3DM0 A;  3N0D A;  4M3R A;  3L8B A;  3JPX A;  1FZ8 E;  5HE3 B;  4FJJ A;  1PGU A;  2P1Q B;  3K27 A;  3RMD A;  1R5M A;  3JB9 L;  3EG6 A;  2H4T A;  1B9Y A;  2H9M A;  2I0R A;  1A0R B;  2YNO A;  4HDJ A;  5FLX g;  4B08 A;  2PM9 B;  4DTO A;  3TJY A;  2B4E A;  5K1C C;  4K3J B;  5I5M A;  4A11 B;  3CFS B;  3OKT A;  3PVW B;  5IRE A;  4PBY A;  5THA A;  4FAV D;  2TRC B;  1WAF A;  4U7A A;  1FZI E;  3L2O B;  4ADO A;  4PC0 A;  4FK0 A;  3QEP A;  3FM0 A;  2P1O B;  3PXW D;  4KHU A;  4ZOZ A;  4M45 A;  3RFH A;  3QEV A;  3RN0 D;  1XL3 C;  5FA5 B;  3AL9 A;  4JRP A;  4M3T A;  3SJL D;  4A08 A;  4FHL A;  4FJ9 A;  3C9C A;  4J2E A;  4A09 A;  3EMH A;  5C9Z B;  2FYO A;  1K8K C;  5GMK n;  1XU3 E;  1MG3 A;  2H47 A;  4GM9 A;  3C95 A;  5HYN B;  5IGO A;  3TL8 B;  3CFP A;  3MMY A;  1MG2 A;  3LDB A;  3V9F A;  1FZ3 E;  5GSA A;  4I9Q A;  3AFC A;  2OVR B;  4K3I D;  2I3S A;  2DY4 A;  4QQE A;  1B9X A;  1JMX B;  4GQB B;  1XIP A;  4Y5R D;  1OLZ A;  5HE1 B;  3J81 g;  4CI3 A;  2LF6 A;  3TAE A;  1WAJ A;  1MMO G;  4XYI A;  3J80 g;  3RWU A;  4AI6 A;  2FW3 A;  4KI4 A;  3LD8 A;  3C6N B;  1FS1 A;  4JT5 C;  3RMZ D;  3GFC A;  3B7F A;  4GMB A;  3MZK A;  4EYW A;  3FGB A;  3UVL A;  2I0T A;  2PFT A;  5JWZ A;  2H6N A;  1LDK E;  4QNC A;  4QND A;  2PM7 B;  3DSM A;  3SBP A;  1JMZ B;  3BG0 A;  5IZ7 A;  2GC7 A;  3EI1 B;  4D6V A;  1GOT B;  3EI3 B;  4PXW A;  3TAF A;  2CO0 A;  2OK6 A;  3LZJ A;  3S9H A;  5IT9 g;  1VYH C;  3U4Y A;  1MHZ G;  2OJY A;  1GXR A;  3HGK E;  2OVQ B;  2BBK H;  3GRE A;  3IJC A;  3IJ0 A;  3RFG A;  4DU3 A;  1Q47 A;  1N6E A;  3FRX A;  3MZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...