4X5MA

Crystal structure of semisweet in the inward-open conformation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
86
structure length
86
Chain Sequence
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
molecule tags Transport protein
total genus 32
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5mA00
4QNDA 4X5NA 4X5MA 4RNGA 4QNCA
chains in the Genus database with same CATH superfamily
3L2OB 4FJHA 3K2OA 3C6PB 4FJ7A 3QEXA 4KHSA 1WAFA 4J2EA 3TAGA 3SQ0A 1IH7A 2DEBA 2OVRB 3LD8A 2RCUA 1FZIE 2RKHA 2PFVA 3E4YA 5IZ7A 4GAMC 4RL5A 3NHGA 3SJJA 3KD1E 4X5NA 3CFPA 4JRPA 4J2BA 2K5SA 2P1NB 1FZ3E 3SQ2A 2JH8A 2JHPA 4M45A 3QEIA 4FJMA 3LDBA 1XVCE 3QEWA 1FZ9E 3N1BA 5IREA 3QERA 5H37A 2MMBA 4QNCA 4DTMA 3QEPA 1FZ7E 3TJYA 4M3RA 3LZJA 4FJIA 3QETA 3OGKB 3UO2A 3NE6A 3MKSB 1XMFE 3V7DB 3J2PA 3HL8A 4ICGC 3NDKA 2JHCA 4B08A 4I9QA 1XVGE 1XMGE 4I6JB 1FXXA 4HCBA 2YB5A 4FJ8A 4JRQA 3OGLB 4ADOA 3CQ8A 1N1CA 2OVPB 1FPOA 3HGKE 4IT5A 3SI6A 4KHYA 4FJKA 4M3TA 1FZ1E 1XVFE 3C95A 4DTRA 4FK0A 4EYWA 1WAJA 4DU3A 2P1MB 3SUQA 3RWUA 3TABA 4FJXA 4KHUA 4ADNA 5IBKB 4E4BA 4FVMA 1MHZG 3SVIA 4JS5A 4FJ9A 2JQTA 3C6NB 4FK4A 4FK2A 3SUOA 1FYZE 2DTUA 4FJJA 1FZ4E 3TAFA 3SPZA 4DTXA 3L8BA 4EP9A 1MMOG 3SUPA 3RMDA 2MZWB 1FS1A 3SQ1A 4AKHA 3BVOA 2ATQA 4FJLA 4FJNA 4E3SA 1XVBE 4KHWA 3TAEA 3RMBA 4AKIA 4KHQA 1XU5E 1FZHE 2JPNA 2VJ5A 4DTUA 2P5GA 2PFTA 3NGIA 3LZIA 2HD0A 4FJ5A 3QNOA 1NEXB 2OYQA 2VJ4A 4I9LA 1IG9A 4DTSA 1MTYG 4EPHA 4J2AA 1Q9XA 1XVEE 4M3UA 1XL3C 3TL8B 2P1PB 3QEVA 2OVQB 2OZSA 1CLQA 3SQ4A 3HGLA 3S9HA 3L1NA 2B8IA 4DTJA 4M3XA 1XVDE 3SNNA 3NCIA 4M3WA 1XU3E 4DTPA 2OZMA 1FZ0E 1XMHE 4M42A 3UO3A 4M3ZA 1P22A 2VIXA 1FZ5E 1FZ2E 4JS4A 4M41A 4HCCA 1FZ8E 2QXFA 4RG8A 3KD5E 3QESA 2B1EA 2JHAA 3WSOA 1JW2A 4J2DA 3C6OB 3QNNA 1FZ6E 3J27A 4AKGA 3CFOA 3E4WA 4RNGA 3SPYA 1LDKE 2FYOA 3HP9A 4DU1A 2P1OB 4QNDA 4DTNA 1Q9YA 2JH9A 3NAEA 2MW2A 4M3YA 3N1EA 3SUNA 3LDSA 2B7MA 3C94A 2DY4A 3OGMB 2E31A 4X5MA 3CFRA 2E32A 3RMAA 4KHNA 3RMCA 2P5OA 2LF3A 4DU4A 4KI6A 3L0MA 3SCXA 4FJGA 4AI6A 2P1QB 2H4TA 4KI4A 2LF6A 1MHYG 3UIQA 2FW3A 4DTOA
chains in the Genus database with same CATH topology
3L2OB 4FJHA 3K2OA 3C6PB 4FJ7A 3QEXA 4KHSA 1WAFA 4J2EA 3TAGA 3SQ0A 1IH7A 2DEBA 2OVRB 3LD8A 2RCUA 1FZIE 2PFVA 3E4YA 5IZ7A 4GAMC 4RL5A 3NHGA 3SJJA 3KD1E 4X5NA 3CFPA 4JRPA 4J2BA 2P1NB 1FZ3E 3SQ2A 2JH8A 2JHPA 4M45A 3QEIA 4FJMA 3LDBA 1XVCE 3QEWA 1FZ9E 3N1BA 5IREA 3QERA 5H37A 2MMBA 4QNCA 4DTMA 3QEPA 1FZ7E 3TJYA 4M3RA 3LZJA 4FJIA 3QETA 3OGKB 3NE6A 3MKSB 1XMFE 3V7DB 3J2PA 3HL8A 3NDKA 2JHCA 4B08A 4I9QA 1XVGE 1XMGE 4I6JB 1FXXA 4HCBA 2YB5A 4FJ8A 4JRQA 3OGLB 4ADOA 3CQ8A 2OVPB 4KHYA 3HGKE 3SI6A 4FJKA 4M3TA 1FZ1E 1XVFE 3C95A 4DTRA 4FK0A 4EYWA 1WAJA 4DU3A 2P1MB 3SUQA 3RWUA 3TABA 4FJXA 4KHUA 4ADNA 5IBKB 4E4BA 4FVMA 1MHZG 3SVIA 4JS5A 4FJ9A 3C6NB 4FK4A 4FK2A 3SUOA 1FYZE 2DTUA 4FJJA 1FZ4E 3TAFA 3SPZA 4DTXA 3L8BA 4EP9A 1MMOG 3SUPA 3RMDA 2MZWB 1FS1A 3SQ1A 4AKHA 4FJNA 2ATQA 4FJLA 4E3SA 1XVBE 4KHWA 3TAEA 3RMBA 4AKIA 4KHQA 1XU5E 1FZHE 2JPNA 2VJ5A 4DTUA 2P5GA 2PFTA 3NGIA 3LZIA 2HD0A 4FJ5A 3QNOA 1NEXB 2OYQA 2VJ4A 4I9LA 1IG9A 4DTSA 1MTYG 4EPHA 4J2AA 1Q9XA 1XVEE 4M3UA 1XL3C 3TL8B 2P1PB 3QEVA 2OVQB 2OZSA 1CLQA 3SQ4A 3HGLA 3S9HA 3L1NA 2B8IA 4DTJA 4M3XA 1XVDE 3SNNA 3NCIA 4M3WA 1XU3E 4DTPA 2OZMA 1FZ0E 1XMHE 4M42A 4M3ZA 1P22A 2VIXA 1FZ5E 1FZ2E 4JS4A 4M41A 4HCCA 1FZ8E 2QXFA 4RG8A 3KD5E 3QESA 2B1EA 2JHAA 3WSOA 4J2DA 3C6OB 3QNNA 1FZ6E 3J27A 4AKGA 3CFOA 3E4WA 4RNGA 3SPYA 1LDKE 2FYOA 3HP9A 4DU1A 2P1OB 4QNDA 4DTNA 1Q9YA 2JH9A 3NAEA 4M3YA 3N1EA 3SUNA 3LDSA 2B7MA 3C94A 2DY4A 3OGMB 2E31A 4X5MA 3CFRA 2E32A 3RMAA 4KHNA 3RMCA 2P5OA 2LF3A 4DU4A 4KI6A 3L0MA 3SCXA 4FJGA 4AI6A 2P1QB 2H4TA 4KI4A 2LF6A 1MHYG 3UIQA 2FW3A 4DTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QND A;  4X5N A;  4X5M A;  4RNG A;  4QNC A; 
#chains in the Genus database with same CATH topology
 3L2O B;  4FJH A;  3K2O A;  3C6P B;  4FJ7 A;  3QEX A;  4KHS A;  1WAF A;  4J2E A;  3TAG A;  3SQ0 A;  1IH7 A;  2DEB A;  2OVR B;  3LD8 A;  2RCU A;  1FZI E;  2RKH A;  2PFV A;  3E4Y A;  5IZ7 A;  4GAM C;  4RL5 A;  3NHG A;  3SJJ A;  3KD1 E;  4X5N A;  3CFP A;  4JRP A;  4J2B A;  2K5S A;  2P1N B;  1FZ3 E;  3SQ2 A;  2JH8 A;  2JHP A;  4M45 A;  3QEI A;  4FJM A;  3LDB A;  1XVC E;  3QEW A;  1FZ9 E;  3N1B A;  5IRE A;  3QER A;  5H37 A;  2MMB A;  4QNC A;  4DTM A;  3QEP A;  1FZ7 E;  3TJY A;  4M3R A;  3LZJ A;  4FJI A;  3QET A;  3OGK B;  3UO2 A;  3NE6 A;  3MKS B;  1XMF E;  3V7D B;  3J2P A;  3HL8 A;  4ICG C;  3NDK A;  2JHC A;  4B08 A;  4I9Q A;  1XVG E;  1XMG E;  4I6J B;  1FXX A;  4HCB A;  2YB5 A;  4FJ8 A;  4JRQ A;  3OGL B;  4ADO A;  3CQ8 A;  1N1C A;  2OVP B;  1FPO A;  3HGK E;  4IT5 A;  3SI6 A;  4KHY A;  4FJK A;  4M3T A;  1FZ1 E;  1XVF E;  3C95 A;  4DTR A;  4FK0 A;  4EYW A;  1WAJ A;  4DU3 A;  2P1M B;  3SUQ A;  3RWU A;  3TAB A;  4FJX A;  4KHU A;  4ADN A;  5IBK B;  4E4B A;  4FVM A;  1MHZ G;  3SVI A;  4JS5 A;  4FJ9 A;  2JQT A;  3C6N B;  4FK4 A;  4FK2 A;  3SUO A;  1FYZ E;  2DTU A;  4FJJ A;  1FZ4 E;  3TAF A;  3SPZ A;  4DTX A;  3L8B A;  4EP9 A;  1MMO G;  3SUP A;  3RMD A;  2MZW B;  1FS1 A;  3SQ1 A;  4AKH A;  3BVO A;  2ATQ A;  4FJL A;  4FJN A;  4E3S A;  1XVB E;  4KHW A;  3TAE A;  3RMB A;  4AKI A;  4KHQ A;  1XU5 E;  1FZH E;  2JPN A;  2VJ5 A;  4DTU A;  2P5G A;  2PFT A;  3NGI A;  3LZI A;  2HD0 A;  4FJ5 A;  3QNO A;  1NEX B;  2OYQ A;  2VJ4 A;  4I9L A;  1IG9 A;  4DTS A;  1MTY G;  4EPH A;  4J2A A;  1Q9X A;  1XVE E;  4M3U A;  1XL3 C;  3TL8 B;  2P1P B;  3QEV A;  2OVQ B;  2OZS A;  1CLQ A;  3SQ4 A;  3HGL A;  3S9H A;  3L1N A;  2B8I A;  4DTJ A;  4M3X A;  1XVD E;  3SNN A;  3NCI A;  4M3W A;  1XU3 E;  4DTP A;  2OZM A;  1FZ0 E;  1XMH E;  4M42 A;  3UO3 A;  4M3Z A;  1P22 A;  2VIX A;  1FZ5 E;  1FZ2 E;  4JS4 A;  4M41 A;  4HCC A;  1FZ8 E;  2QXF A;  4RG8 A;  3KD5 E;  3QES A;  2B1E A;  2JHA A;  3WSO A;  1JW2 A;  4J2D A;  3C6O B;  3QNN A;  1FZ6 E;  3J27 A;  4AKG A;  3CFO A;  3E4W A;  4RNG A;  3SPY A;  1LDK E;  2FYO A;  3HP9 A;  4DU1 A;  2P1O B;  4QND A;  4DTN A;  1Q9Y A;  2JH9 A;  3NAE A;  2MW2 A;  4M3Y A;  3N1E A;  3SUN A;  3LDS A;  2B7M A;  3C94 A;  2DY4 A;  3OGM B;  2E31 A;  4X5M A;  3CFR A;  2E32 A;  3RMA A;  4KHN A;  3RMC A;  2P5O A;  2LF3 A;  4DU4 A;  4KI6 A;  3L0M A;  3SCX A;  4FJG A;  4AI6 A;  2P1Q B;  2H4T A;  4KI4 A;  2LF6 A;  1MHY G;  3UIQ A;  2FW3 A;  4DTO A; 
#chains in the Genus database with same CATH homology
 3L2O B;  4FJH A;  3K2O A;  3C6P B;  4FJ7 A;  3QEX A;  4KHS A;  1WAF A;  4J2E A;  3TAG A;  3SQ0 A;  1IH7 A;  2DEB A;  2OVR B;  3LD8 A;  2RCU A;  1FZI E;  2PFV A;  3E4Y A;  5IZ7 A;  4GAM C;  4RL5 A;  3NHG A;  3SJJ A;  3KD1 E;  4X5N A;  3CFP A;  4JRP A;  4J2B A;  2P1N B;  1FZ3 E;  3SQ2 A;  2JH8 A;  2JHP A;  4M45 A;  3QEI A;  4FJM A;  3LDB A;  1XVC E;  3QEW A;  1FZ9 E;  3N1B A;  5IRE A;  3QER A;  5H37 A;  2MMB A;  4QNC A;  4DTM A;  3QEP A;  1FZ7 E;  3TJY A;  4M3R A;  3LZJ A;  4FJI A;  3QET A;  3OGK B;  3NE6 A;  3MKS B;  1XMF E;  3V7D B;  3J2P A;  3HL8 A;  3NDK A;  2JHC A;  4B08 A;  4I9Q A;  1XVG E;  1XMG E;  4I6J B;  1FXX A;  4HCB A;  2YB5 A;  4FJ8 A;  4JRQ A;  3OGL B;  4ADO A;  3CQ8 A;  2OVP B;  4KHY A;  3HGK E;  3SI6 A;  4FJK A;  4M3T A;  1FZ1 E;  1XVF E;  3C95 A;  4DTR A;  4FK0 A;  4EYW A;  1WAJ A;  4DU3 A;  2P1M B;  3SUQ A;  3RWU A;  3TAB A;  4FJX A;  4KHU A;  4ADN A;  5IBK B;  4E4B A;  4FVM A;  1MHZ G;  3SVI A;  4JS5 A;  4FJ9 A;  3C6N B;  4FK4 A;  4FK2 A;  3SUO A;  1FYZ E;  2DTU A;  4FJJ A;  1FZ4 E;  3TAF A;  3SPZ A;  4DTX A;  3L8B A;  4EP9 A;  1MMO G;  3SUP A;  3RMD A;  2MZW B;  1FS1 A;  3SQ1 A;  4AKH A;  4FJN A;  2ATQ A;  4FJL A;  4E3S A;  1XVB E;  4KHW A;  3TAE A;  3RMB A;  4AKI A;  4KHQ A;  1XU5 E;  1FZH E;  2JPN A;  2VJ5 A;  4DTU A;  2P5G A;  2PFT A;  3NGI A;  3LZI A;  2HD0 A;  4FJ5 A;  3QNO A;  1NEX B;  2OYQ A;  2VJ4 A;  4I9L A;  1IG9 A;  4DTS A;  1MTY G;  4EPH A;  4J2A A;  1Q9X A;  1XVE E;  4M3U A;  1XL3 C;  3TL8 B;  2P1P B;  3QEV A;  2OVQ B;  2OZS A;  1CLQ A;  3SQ4 A;  3HGL A;  3S9H A;  3L1N A;  2B8I A;  4DTJ A;  4M3X A;  1XVD E;  3SNN A;  3NCI A;  4M3W A;  1XU3 E;  4DTP A;  2OZM A;  1FZ0 E;  1XMH E;  4M42 A;  4M3Z A;  1P22 A;  2VIX A;  1FZ5 E;  1FZ2 E;  4JS4 A;  4M41 A;  4HCC A;  1FZ8 E;  2QXF A;  4RG8 A;  3KD5 E;  3QES A;  2B1E A;  2JHA A;  3WSO A;  4J2D A;  3C6O B;  3QNN A;  1FZ6 E;  3J27 A;  4AKG A;  3CFO A;  3E4W A;  4RNG A;  3SPY A;  1LDK E;  2FYO A;  3HP9 A;  4DU1 A;  2P1O B;  4QND A;  4DTN A;  1Q9Y A;  2JH9 A;  3NAE A;  4M3Y A;  3N1E A;  3SUN A;  3LDS A;  2B7M A;  3C94 A;  2DY4 A;  3OGM B;  2E31 A;  4X5M A;  3CFR A;  2E32 A;  3RMA A;  4KHN A;  3RMC A;  2P5O A;  2LF3 A;  4DU4 A;  4KI6 A;  3L0M A;  3SCX A;  4FJG A;  4AI6 A;  2P1Q B;  2H4T A;  4KI4 A;  2LF6 A;  1MHY G;  3UIQ A;  2FW3 A;  4DTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...