4X5MA

Crystal structure of semisweet in the inward-open conformation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
86
structure length
86
Chain Sequence
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
molecule tags Transport protein
total genus 32
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5mA00
4X5MA 4X5NA 4QNCA 4QNDA 4RNGA
chains in the Genus database with same CATH superfamily
4M3RA 3V7DB 1XMFE 3QERA 2VJ5A 4FJLA 2JPNA 4KHWA 1MMOG 2LF6A 3HP9A 1XVFE 2K5SA 3SJJA 4FJJA 1FZ1E 2OZSA 2RCUA 1FZ9E 1NEXB 4FJGA 4FVMA 3SUOA 1XMHE 3OGKB 4DTNA 4RG8A 3UO3A 3QEWA 4FK4A 3J2PA 4M42A 4I6JB 4EPHA 1LDKE 3OGLB 3L2OB 3TJYA 3CQ8A 4IT5A 3NCIA 3SPYA 1XVGE 3HGKE 2B8IA 4X5MA 3J27A 5IZ7A 4FJIA 4B08A 4EP9A 2JH9A 4QNDA 2RKHA 3HGLA 1FZ0E 2JQTA 3SQ2A 4DTRA 4M3XA 3NAEA 4FJMA 5IBKB 3C6OB 4E4BA 3SQ1A 1P22A 3RMCA 4KHSA 4ICGC 1JW2A 4JRQA 1WAJA 3TAEA 3QEPA 3QETA 3L8BA 4M45A 3L0MA 3SI6A 4DTOA 3UO2A 1XVCE 4E3SA 4AKIA 4HCCA 3RMBA 1FZ2E 3RWUA 2E32A 4M3UA 3QEIA 2OVRB 3CFOA 3QEVA 4FK2A 3CFPA 4KHNA 2P5GA 1FYZE 1IH7A 2VJ4A 2QXFA 4FJKA 4AI6A 3SQ4A 4DU4A 1Q9YA 1IG9A 4M3WA 4KI4A 2OZMA 2H4TA 4AKHA 2JHCA 4M3ZA 3RMAA 2B7MA 3CFRA 2P1NB 2MW2A 4QNCA 1FXXA 3UIQA 4FJ5A 3NE6A 1CLQA 4DTPA 3MKSB 4KHUA 4FJXA 2DEBA 3TAFA 4J2BA 4FJNA 4J2AA 3SUPA 4FJ7A 3LDSA 4KHYA 1FZ3E 2HD0A 2P1MB 3SUQA 3BVOA 2FYOA 1XU3E 3L1NA 3NGIA 4DTMA 2OYQA 1MTYG 4GAMC 1XU5E 3QEXA 4I9QA 3C94A 2B1EA 4JS5A 4FJHA 3HL8A 2YB5A 1N1CA 3N1EA 3SPZA 1FZIE 2VIXA 4X5NA 5H37A 4DTSA 2LF3A 4DTUA 4RL5A 2JHPA 2PFTA 5IREA 2ATQA 3QNNA 2MMBA 3TAGA 3E4YA 1XL3C 1XVEE 3LZJA 3QESA 3C6PB 2MZWB 2P1OB 4DTXA 2P1PB 3SQ0A 2P5OA 3C6NB 1FS1A 1FZ5E 4HCBA 4DTJA 2E31A 4M41A 3LD8A 4J2EA 1MHYG 2JHAA 3TL8B 4J2DA 4I9LA 2DY4A 4AKGA 1XMGE 4JS4A 2P1QB 3KD1E 4KHQA 4FJ9A 4FJ8A 4FK0A 3SVIA 2JH8A 2PFVA 2DTUA 3S9HA 1FZHE 1FZ4E 4DU3A 3LZIA 3KD5E 4RNGA 4M3YA 4JRPA 3SUNA 3NDKA 1FZ8E 3QNOA 1XVBE 4DU1A 4ADOA 3RMDA 1FPOA 3K2OA 3WSOA 3N1BA 3LDBA 3SNNA 3E4WA 3OGMB 3SCXA 4KI6A 4M3TA 3TABA 1XVDE 1Q9XA 2OVPB 1WAFA 4ADNA 4EYWA 1FZ7E 3NHGA 1MHZG 2FW3A 3C95A 1FZ6E 2OVQB
chains in the Genus database with same CATH topology
4M3RA 3V7DB 1XMFE 3QERA 2VJ5A 4FJLA 2JPNA 4KHWA 1MMOG 2LF6A 3HP9A 1XVFE 3SJJA 4FJJA 1FZ1E 2OZSA 2RCUA 1FZ9E 1NEXB 4FJGA 4FVMA 3SUOA 1XMHE 3OGKB 4DTNA 4RG8A 3QEWA 4FK4A 3J2PA 4M42A 4I6JB 4EPHA 1LDKE 3OGLB 3L2OB 3TJYA 3CQ8A 3SPYA 3NCIA 4FJXA 1XVGE 3HGKE 2B8IA 4X5MA 3J27A 5IZ7A 4FJIA 4B08A 4EP9A 2JH9A 4QNDA 3HGLA 1FZ0E 3SQ2A 4DTRA 4M3XA 3NAEA 4FJMA 5IBKB 3C6OB 4E4BA 3SQ1A 1P22A 3RMCA 4KHSA 4JRQA 1WAJA 3TAEA 3QEPA 3QETA 3L8BA 4M45A 3L0MA 3SI6A 4DTOA 1XVCE 4E3SA 4AKIA 4HCCA 3RMBA 1FZ2E 3RWUA 2E32A 4M3UA 3QEIA 2OVRB 3CFOA 3QEVA 4FK2A 3CFPA 4KHNA 2P5GA 1FYZE 1IH7A 2VJ4A 2QXFA 4FJKA 4AI6A 3SQ4A 4DU4A 1Q9YA 1IG9A 4M3WA 4KI4A 2OZMA 2H4TA 4AKHA 2JHCA 4M3ZA 3RMAA 2B7MA 3CFRA 2P1NB 4QNCA 1FXXA 3UIQA 4FJ5A 3NE6A 1CLQA 4DTPA 3MKSB 4KHUA 2DEBA 3TAFA 4J2BA 4FJNA 4J2AA 3SUPA 4FJ7A 3LDSA 4KHYA 1FZ3E 2HD0A 2P1MB 3SUQA 3L1NA 2FYOA 1XU3E 3NGIA 2OYQA 4DTMA 1MTYG 4GAMC 1XU5E 3QEXA 4I9QA 3C94A 2B1EA 4JS5A 4FJHA 3HL8A 2YB5A 3N1EA 3SPZA 1FZIE 2VIXA 4X5NA 5H37A 4DTSA 2LF3A 4DTUA 4RL5A 2JHPA 2PFTA 5IREA 2ATQA 3QNNA 2MMBA 3TAGA 3E4YA 1XL3C 1XVEE 3LZJA 3QESA 3C6PB 2MZWB 2P1OB 4DTXA 2P1PB 3SQ0A 2P5OA 3C6NB 1FS1A 1FZ5E 4HCBA 4DTJA 2E31A 4M41A 3LD8A 4J2EA 1MHYG 2JHAA 3TL8B 4J2DA 4I9LA 2DY4A 4AKGA 1XMGE 4JS4A 2P1QB 3KD1E 4KHQA 4FJ9A 4FJ8A 4FK0A 3SVIA 2JH8A 2PFVA 2DTUA 3S9HA 1FZHE 1FZ4E 4DU3A 3LZIA 3KD5E 4RNGA 4M3YA 4JRPA 3SUNA 3NDKA 1FZ8E 3QNOA 1XVBE 4DU1A 4ADOA 3RMDA 3K2OA 3WSOA 3N1BA 3LDBA 3SNNA 3E4WA 3OGMB 3SCXA 4KI6A 4M3TA 3TABA 1XVDE 1Q9XA 2OVPB 1WAFA 4ADNA 4EYWA 1FZ7E 3NHGA 1MHZG 2FW3A 3C95A 1FZ6E 2OVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5M A;  4X5N A;  4QNC A;  4QND A;  4RNG A; 
#chains in the Genus database with same CATH topology
 4M3R A;  3V7D B;  1XMF E;  3QER A;  2VJ5 A;  4FJL A;  2JPN A;  4KHW A;  1MMO G;  2LF6 A;  3HP9 A;  1XVF E;  2K5S A;  3SJJ A;  4FJJ A;  1FZ1 E;  2OZS A;  2RCU A;  1FZ9 E;  1NEX B;  4FJG A;  4FVM A;  3SUO A;  1XMH E;  3OGK B;  4DTN A;  4RG8 A;  3UO3 A;  3QEW A;  4FK4 A;  3J2P A;  4M42 A;  4I6J B;  4EPH A;  1LDK E;  3OGL B;  3L2O B;  3TJY A;  3CQ8 A;  4IT5 A;  3NCI A;  3SPY A;  1XVG E;  3HGK E;  2B8I A;  4X5M A;  3J27 A;  5IZ7 A;  4FJI A;  4B08 A;  4EP9 A;  2JH9 A;  4QND A;  2RKH A;  3HGL A;  1FZ0 E;  2JQT A;  3SQ2 A;  4DTR A;  4M3X A;  3NAE A;  4FJM A;  5IBK B;  3C6O B;  4E4B A;  3SQ1 A;  1P22 A;  3RMC A;  4KHS A;  4ICG C;  1JW2 A;  4JRQ A;  1WAJ A;  3TAE A;  3QEP A;  3QET A;  3L8B A;  4M45 A;  3L0M A;  3SI6 A;  4DTO A;  3UO2 A;  1XVC E;  4E3S A;  4AKI A;  4HCC A;  3RMB A;  1FZ2 E;  3RWU A;  2E32 A;  4M3U A;  3QEI A;  2OVR B;  3CFO A;  3QEV A;  4FK2 A;  3CFP A;  4KHN A;  2P5G A;  1FYZ E;  1IH7 A;  2VJ4 A;  2QXF A;  4FJK A;  4AI6 A;  3SQ4 A;  4DU4 A;  1Q9Y A;  1IG9 A;  4M3W A;  4KI4 A;  2OZM A;  2H4T A;  4AKH A;  2JHC A;  4M3Z A;  3RMA A;  2B7M A;  3CFR A;  2P1N B;  2MW2 A;  4QNC A;  1FXX A;  3UIQ A;  4FJ5 A;  3NE6 A;  1CLQ A;  4DTP A;  3MKS B;  4KHU A;  4FJX A;  2DEB A;  3TAF A;  4J2B A;  4FJN A;  4J2A A;  3SUP A;  4FJ7 A;  3LDS A;  4KHY A;  1FZ3 E;  2HD0 A;  2P1M B;  3SUQ A;  3BVO A;  2FYO A;  1XU3 E;  3L1N A;  3NGI A;  4DTM A;  2OYQ A;  1MTY G;  4GAM C;  1XU5 E;  3QEX A;  4I9Q A;  3C94 A;  2B1E A;  4JS5 A;  4FJH A;  3HL8 A;  2YB5 A;  1N1C A;  3N1E A;  3SPZ A;  1FZI E;  2VIX A;  4X5N A;  5H37 A;  4DTS A;  2LF3 A;  4DTU A;  4RL5 A;  2JHP A;  2PFT A;  5IRE A;  2ATQ A;  3QNN A;  2MMB A;  3TAG A;  3E4Y A;  1XL3 C;  1XVE E;  3LZJ A;  3QES A;  3C6P B;  2MZW B;  2P1O B;  4DTX A;  2P1P B;  3SQ0 A;  2P5O A;  3C6N B;  1FS1 A;  1FZ5 E;  4HCB A;  4DTJ A;  2E31 A;  4M41 A;  3LD8 A;  4J2E A;  1MHY G;  2JHA A;  3TL8 B;  4J2D A;  4I9L A;  2DY4 A;  4AKG A;  1XMG E;  4JS4 A;  2P1Q B;  3KD1 E;  4KHQ A;  4FJ9 A;  4FJ8 A;  4FK0 A;  3SVI A;  2JH8 A;  2PFV A;  2DTU A;  3S9H A;  1FZH E;  1FZ4 E;  4DU3 A;  3LZI A;  3KD5 E;  4RNG A;  4M3Y A;  4JRP A;  3SUN A;  3NDK A;  1FZ8 E;  3QNO A;  1XVB E;  4DU1 A;  4ADO A;  3RMD A;  1FPO A;  3K2O A;  3WSO A;  3N1B A;  3LDB A;  3SNN A;  3E4W A;  3OGM B;  3SCX A;  4KI6 A;  4M3T A;  3TAB A;  1XVD E;  1Q9X A;  2OVP B;  1WAF A;  4ADN A;  4EYW A;  1FZ7 E;  3NHG A;  1MHZ G;  2FW3 A;  3C95 A;  1FZ6 E;  2OVQ B; 
#chains in the Genus database with same CATH homology
 4M3R A;  3V7D B;  1XMF E;  3QER A;  2VJ5 A;  4FJL A;  2JPN A;  4KHW A;  1MMO G;  2LF6 A;  3HP9 A;  1XVF E;  3SJJ A;  4FJJ A;  1FZ1 E;  2OZS A;  2RCU A;  1FZ9 E;  1NEX B;  4FJG A;  4FVM A;  3SUO A;  1XMH E;  3OGK B;  4DTN A;  4RG8 A;  3QEW A;  4FK4 A;  3J2P A;  4M42 A;  4I6J B;  4EPH A;  1LDK E;  3OGL B;  3L2O B;  3TJY A;  3CQ8 A;  3SPY A;  3NCI A;  4FJX A;  1XVG E;  3HGK E;  2B8I A;  4X5M A;  3J27 A;  5IZ7 A;  4FJI A;  4B08 A;  4EP9 A;  2JH9 A;  4QND A;  3HGL A;  1FZ0 E;  3SQ2 A;  4DTR A;  4M3X A;  3NAE A;  4FJM A;  5IBK B;  3C6O B;  4E4B A;  3SQ1 A;  1P22 A;  3RMC A;  4KHS A;  4JRQ A;  1WAJ A;  3TAE A;  3QEP A;  3QET A;  3L8B A;  4M45 A;  3L0M A;  3SI6 A;  4DTO A;  1XVC E;  4E3S A;  4AKI A;  4HCC A;  3RMB A;  1FZ2 E;  3RWU A;  2E32 A;  4M3U A;  3QEI A;  2OVR B;  3CFO A;  3QEV A;  4FK2 A;  3CFP A;  4KHN A;  2P5G A;  1FYZ E;  1IH7 A;  2VJ4 A;  2QXF A;  4FJK A;  4AI6 A;  3SQ4 A;  4DU4 A;  1Q9Y A;  1IG9 A;  4M3W A;  4KI4 A;  2OZM A;  2H4T A;  4AKH A;  2JHC A;  4M3Z A;  3RMA A;  2B7M A;  3CFR A;  2P1N B;  4QNC A;  1FXX A;  3UIQ A;  4FJ5 A;  3NE6 A;  1CLQ A;  4DTP A;  3MKS B;  4KHU A;  2DEB A;  3TAF A;  4J2B A;  4FJN A;  4J2A A;  3SUP A;  4FJ7 A;  3LDS A;  4KHY A;  1FZ3 E;  2HD0 A;  2P1M B;  3SUQ A;  3L1N A;  2FYO A;  1XU3 E;  3NGI A;  2OYQ A;  4DTM A;  1MTY G;  4GAM C;  1XU5 E;  3QEX A;  4I9Q A;  3C94 A;  2B1E A;  4JS5 A;  4FJH A;  3HL8 A;  2YB5 A;  3N1E A;  3SPZ A;  1FZI E;  2VIX A;  4X5N A;  5H37 A;  4DTS A;  2LF3 A;  4DTU A;  4RL5 A;  2JHP A;  2PFT A;  5IRE A;  2ATQ A;  3QNN A;  2MMB A;  3TAG A;  3E4Y A;  1XL3 C;  1XVE E;  3LZJ A;  3QES A;  3C6P B;  2MZW B;  2P1O B;  4DTX A;  2P1P B;  3SQ0 A;  2P5O A;  3C6N B;  1FS1 A;  1FZ5 E;  4HCB A;  4DTJ A;  2E31 A;  4M41 A;  3LD8 A;  4J2E A;  1MHY G;  2JHA A;  3TL8 B;  4J2D A;  4I9L A;  2DY4 A;  4AKG A;  1XMG E;  4JS4 A;  2P1Q B;  3KD1 E;  4KHQ A;  4FJ9 A;  4FJ8 A;  4FK0 A;  3SVI A;  2JH8 A;  2PFV A;  2DTU A;  3S9H A;  1FZH E;  1FZ4 E;  4DU3 A;  3LZI A;  3KD5 E;  4RNG A;  4M3Y A;  4JRP A;  3SUN A;  3NDK A;  1FZ8 E;  3QNO A;  1XVB E;  4DU1 A;  4ADO A;  3RMD A;  3K2O A;  3WSO A;  3N1B A;  3LDB A;  3SNN A;  3E4W A;  3OGM B;  3SCX A;  4KI6 A;  4M3T A;  3TAB A;  1XVD E;  1Q9X A;  2OVP B;  1WAF A;  4ADN A;  4EYW A;  1FZ7 E;  3NHG A;  1MHZ G;  2FW3 A;  3C95 A;  1FZ6 E;  2OVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...