4X5MA

Crystal structure of semisweet in the inward-open conformation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
86
structure length
86
Chain Sequence
b'DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
molecule tags Transport protein
total genus 32
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5mA00
4QNDA 4RNGA 4QNCA 4X5NA 4X5MA
chains in the Genus database with same CATH superfamily
3NCIA 2VJ5A 1XL3C 3MKSB 1MMOG 4J2EA 2QXFA 1NEXB 4FJGA 3QETA 2ATQA 2RKHA 4JRQA 3SUPA 3KD1E 3L8BA 1FZIE 3L1NA 3TJYA 4FJ9A 2E32A 2VIXA 3SQ2A 2JH9A 2FW3A 2DTUA 2OYQA 2H4TA 2FYOA 4DU3A 3SJJA 4M3YA 3NGIA 4JS4A 1XU5E 4FJ8A 3WSOA 1XU3E 3RMBA 4KI6A 2DY4A 3BVOA 1JW2A 4M3ZA 2JQTA 4M45A 4FJHA 4I6JB 2P1PB 4DTRA 3RWUA 3HGKE 1XMFE 3C6NB 4HCCA 1MHYG 4M3RA 1XVFE 2DEBA 2OVPB 2RCUA 4KHQA 3TAEA 5IREA 4HCBA 1FZ8E 4AKIA 3SPZA 1Q9YA 1FZ6E 1FXXA 2PFVA 4RNGA 3SQ1A 3HL8A 2OVQB 4RG8A 4M3UA 4M3XA 3UO3A 3C6OB 4FJ5A 4DTSA 1FZ9E 1XVDE 3C95A 3LD8A 3LDSA 4EPHA 1MTYG 3QEPA 1FZHE 4EP9A 2P5OA 4FJ7A 4KHSA 3N1EA 3NE6A 4J2AA 4FJKA 4X5MA 3K2OA 4KHNA 2K5SA 3L0MA 3QNOA 4FJMA 2VJ4A 4DTXA 3UO2A 3UIQA 4DTMA 3QNNA 3SI6A 4AI6A 3HP9A 1FZ2E 3RMDA 3RMAA 3RMCA 3CQ8A 4FK0A 4M42A 2P1OB 2YB5A 3N1BA 1WAFA 3OGMB 3QEWA 1XVEE 4M3WA 5IBKB 4DTNA 2P1MB 2JPNA 2MZWB 4I9LA 1FYZE 3TAFA 1FZ7E 1P22A 3NHGA 4AKHA 4IT5A 3QEVA 1FPOA 4M3TA 4JS5A 4RL5A 2OVRB 3TAGA 4FJIA 2MMBA 1WAJA 3CFOA 3SQ0A 4I9QA 4DTUA 2P1QB 3J27A 2P5GA 4DTJA 4FJNA 3NDKA 3S9HA 4JRPA 3SCXA 2LF3A 4FJJA 2E31A 3V7DB 3TABA 4DU4A 2LF6A 1IG9A 4FJXA 4FJLA 3L2OB 4X5NA 4B08A 3C94A 1CLQA 1FZ5E 3E4YA 3SQ4A 4DTPA 2JH8A 3SUNA 1IH7A 2P1NB 1MHZG 4KHWA 4J2BA 3QEIA 4AKGA 4J2DA 3LDBA 4E4BA 4DU1A 3QEXA 1XMGE 1XVBE 4ICGC 3E4WA 3SUQA 3TL8B 1XVCE 3CFRA 2B8IA 3CFPA 1FZ3E 1FZ0E 1FS1A 2HD0A 3SUOA 2PFTA 3C6PB 4ADOA 3J2PA 3LZIA 3SNNA 1XVGE 4QNDA 4EYWA 4QNCA 4E3SA 4GAMC 2JHCA 4FVMA 5H37A 2JHAA 1Q9XA 1FZ1E 3SVIA 4FK2A 2B1EA 4KI4A 3QESA 3OGKB 3KD5E 5IZ7A 4KHUA 4M41A 1LDKE 4DTOA 4ADNA 3HGLA 3OGLB 3NAEA 2JHPA 2OZSA 1N1CA 2B7MA 3LZJA 3QERA 1XMHE 2OZMA 4KHYA 3SPYA 4FK4A 1FZ4E 2MW2A
chains in the Genus database with same CATH topology
3NCIA 2VJ5A 1XL3C 3MKSB 1MMOG 4J2EA 2QXFA 1NEXB 4FJGA 3QETA 2ATQA 4JRQA 3SUPA 3KD1E 3L8BA 1FZIE 3L1NA 3TJYA 4FJ9A 2E32A 2VIXA 3SQ2A 2JH9A 2FW3A 2DTUA 2OYQA 2H4TA 2FYOA 4DU3A 3SJJA 4M3YA 3NGIA 4JS4A 1XU5E 4FJ8A 3WSOA 1XU3E 3RMBA 4KI6A 2DY4A 4M3ZA 4M45A 4FJHA 4I6JB 2P1PB 4DTRA 3RWUA 3HGKE 1XMFE 3C6NB 4HCCA 1MHYG 4M3RA 1XVFE 2DEBA 2OVPB 2RCUA 4KHQA 3TAEA 5IREA 4HCBA 1FZ8E 4AKIA 3SPZA 1Q9YA 1FZ6E 1FXXA 2PFVA 4RNGA 3SQ1A 3HL8A 2OVQB 4RG8A 4M3UA 4M3XA 3C6OB 4FJ5A 4DTSA 1FZ9E 1XVDE 3C95A 3LD8A 3LDSA 4EPHA 1MTYG 3QEPA 1FZHE 4EP9A 2P5OA 4FJ7A 4KHSA 3N1EA 3NE6A 4J2AA 4FJKA 4X5MA 3K2OA 4KHNA 3L0MA 3QNOA 4FJMA 2VJ4A 4DTXA 3UIQA 4DTMA 3QNNA 3SI6A 4AI6A 3HP9A 1FZ2E 3RMDA 3RMAA 3RMCA 3CQ8A 4FK0A 4M42A 2P1OB 2YB5A 3N1BA 1WAFA 3OGMB 3QEWA 1XVEE 4M3WA 5IBKB 4DTNA 2P1MB 2JPNA 2MZWB 4I9LA 1FYZE 3TAFA 1FZ7E 1P22A 3NHGA 4AKHA 3QEVA 4M3TA 4JS5A 4RL5A 2OVRB 3TAGA 4FJIA 2MMBA 1WAJA 3CFOA 3SQ0A 4I9QA 4DTUA 2P1QB 3J27A 2P5GA 4DTJA 4FJNA 3NDKA 3S9HA 4JRPA 3SCXA 2LF3A 4FJJA 2E31A 3V7DB 3TABA 4DU4A 2LF6A 1IG9A 4FJXA 4FJLA 3L2OB 4X5NA 4B08A 3C94A 1CLQA 1FZ5E 3E4YA 3SQ4A 4DTPA 2JH8A 3SUNA 1IH7A 2P1NB 1MHZG 4KHWA 4J2BA 3QEIA 4AKGA 4J2DA 3LDBA 4E4BA 4DU1A 3QEXA 1XMGE 1XVBE 3E4WA 3SUQA 3TL8B 1XVCE 3CFRA 2B8IA 3CFPA 1FZ3E 1FZ0E 1FS1A 2HD0A 3SUOA 2PFTA 3C6PB 4ADOA 3J2PA 3LZIA 3SNNA 1XVGE 4QNDA 4EYWA 4QNCA 4E3SA 4GAMC 2JHCA 4FVMA 5H37A 2JHAA 1Q9XA 1FZ1E 3SVIA 4FK2A 2B1EA 4KI4A 3QESA 3OGKB 3KD5E 5IZ7A 4KHUA 4M41A 1LDKE 4DTOA 4ADNA 3HGLA 3OGLB 3NAEA 2JHPA 2OZSA 2B7MA 3LZJA 3QERA 1XMHE 2OZMA 4KHYA 3SPYA 4FK4A 1FZ4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QND A;  4RNG A;  4QNC A;  4X5N A;  4X5M A; 
#chains in the Genus database with same CATH topology
 3NCI A;  2VJ5 A;  1XL3 C;  3MKS B;  1MMO G;  4J2E A;  2QXF A;  1NEX B;  4FJG A;  3QET A;  2ATQ A;  2RKH A;  4JRQ A;  3SUP A;  3KD1 E;  3L8B A;  1FZI E;  3L1N A;  3TJY A;  4FJ9 A;  2E32 A;  2VIX A;  3SQ2 A;  2JH9 A;  2FW3 A;  2DTU A;  2OYQ A;  2H4T A;  2FYO A;  4DU3 A;  3SJJ A;  4M3Y A;  3NGI A;  4JS4 A;  1XU5 E;  4FJ8 A;  3WSO A;  1XU3 E;  3RMB A;  4KI6 A;  2DY4 A;  3BVO A;  1JW2 A;  4M3Z A;  2JQT A;  4M45 A;  4FJH A;  4I6J B;  2P1P B;  4DTR A;  3RWU A;  3HGK E;  1XMF E;  3C6N B;  4HCC A;  1MHY G;  4M3R A;  1XVF E;  2DEB A;  2OVP B;  2RCU A;  4KHQ A;  3TAE A;  5IRE A;  4HCB A;  1FZ8 E;  4AKI A;  3SPZ A;  1Q9Y A;  1FZ6 E;  1FXX A;  2PFV A;  4RNG A;  3SQ1 A;  3HL8 A;  2OVQ B;  4RG8 A;  4M3U A;  4M3X A;  3UO3 A;  3C6O B;  4FJ5 A;  4DTS A;  1FZ9 E;  1XVD E;  3C95 A;  3LD8 A;  3LDS A;  4EPH A;  1MTY G;  3QEP A;  1FZH E;  4EP9 A;  2P5O A;  4FJ7 A;  4KHS A;  3N1E A;  3NE6 A;  4J2A A;  4FJK A;  4X5M A;  3K2O A;  4KHN A;  2K5S A;  3L0M A;  3QNO A;  4FJM A;  2VJ4 A;  4DTX A;  3UO2 A;  3UIQ A;  4DTM A;  3QNN A;  3SI6 A;  4AI6 A;  3HP9 A;  1FZ2 E;  3RMD A;  3RMA A;  3RMC A;  3CQ8 A;  4FK0 A;  4M42 A;  2P1O B;  2YB5 A;  3N1B A;  1WAF A;  3OGM B;  3QEW A;  1XVE E;  4M3W A;  5IBK B;  4DTN A;  2P1M B;  2JPN A;  2MZW B;  4I9L A;  1FYZ E;  3TAF A;  1FZ7 E;  1P22 A;  3NHG A;  4AKH A;  4IT5 A;  3QEV A;  1FPO A;  4M3T A;  4JS5 A;  4RL5 A;  2OVR B;  3TAG A;  4FJI A;  2MMB A;  1WAJ A;  3CFO A;  3SQ0 A;  4I9Q A;  4DTU A;  2P1Q B;  3J27 A;  2P5G A;  4DTJ A;  4FJN A;  3NDK A;  3S9H A;  4JRP A;  3SCX A;  2LF3 A;  4FJJ A;  2E31 A;  3V7D B;  3TAB A;  4DU4 A;  2LF6 A;  1IG9 A;  4FJX A;  4FJL A;  3L2O B;  4X5N A;  4B08 A;  3C94 A;  1CLQ A;  1FZ5 E;  3E4Y A;  3SQ4 A;  4DTP A;  2JH8 A;  3SUN A;  1IH7 A;  2P1N B;  1MHZ G;  4KHW A;  4J2B A;  3QEI A;  4AKG A;  4J2D A;  3LDB A;  4E4B A;  4DU1 A;  3QEX A;  1XMG E;  1XVB E;  4ICG C;  3E4W A;  3SUQ A;  3TL8 B;  1XVC E;  3CFR A;  2B8I A;  3CFP A;  1FZ3 E;  1FZ0 E;  1FS1 A;  2HD0 A;  3SUO A;  2PFT A;  3C6P B;  4ADO A;  3J2P A;  3LZI A;  3SNN A;  1XVG E;  4QND A;  4EYW A;  4QNC A;  4E3S A;  4GAM C;  2JHC A;  4FVM A;  5H37 A;  2JHA A;  1Q9X A;  1FZ1 E;  3SVI A;  4FK2 A;  2B1E A;  4KI4 A;  3QES A;  3OGK B;  3KD5 E;  5IZ7 A;  4KHU A;  4M41 A;  1LDK E;  4DTO A;  4ADN A;  3HGL A;  3OGL B;  3NAE A;  2JHP A;  2OZS A;  1N1C A;  2B7M A;  3LZJ A;  3QER A;  1XMH E;  2OZM A;  4KHY A;  3SPY A;  4FK4 A;  1FZ4 E;  2MW2 A; 
#chains in the Genus database with same CATH homology
 3NCI A;  2VJ5 A;  1XL3 C;  3MKS B;  1MMO G;  4J2E A;  2QXF A;  1NEX B;  4FJG A;  3QET A;  2ATQ A;  4JRQ A;  3SUP A;  3KD1 E;  3L8B A;  1FZI E;  3L1N A;  3TJY A;  4FJ9 A;  2E32 A;  2VIX A;  3SQ2 A;  2JH9 A;  2FW3 A;  2DTU A;  2OYQ A;  2H4T A;  2FYO A;  4DU3 A;  3SJJ A;  4M3Y A;  3NGI A;  4JS4 A;  1XU5 E;  4FJ8 A;  3WSO A;  1XU3 E;  3RMB A;  4KI6 A;  2DY4 A;  4M3Z A;  4M45 A;  4FJH A;  4I6J B;  2P1P B;  4DTR A;  3RWU A;  3HGK E;  1XMF E;  3C6N B;  4HCC A;  1MHY G;  4M3R A;  1XVF E;  2DEB A;  2OVP B;  2RCU A;  4KHQ A;  3TAE A;  5IRE A;  4HCB A;  1FZ8 E;  4AKI A;  3SPZ A;  1Q9Y A;  1FZ6 E;  1FXX A;  2PFV A;  4RNG A;  3SQ1 A;  3HL8 A;  2OVQ B;  4RG8 A;  4M3U A;  4M3X A;  3C6O B;  4FJ5 A;  4DTS A;  1FZ9 E;  1XVD E;  3C95 A;  3LD8 A;  3LDS A;  4EPH A;  1MTY G;  3QEP A;  1FZH E;  4EP9 A;  2P5O A;  4FJ7 A;  4KHS A;  3N1E A;  3NE6 A;  4J2A A;  4FJK A;  4X5M A;  3K2O A;  4KHN A;  3L0M A;  3QNO A;  4FJM A;  2VJ4 A;  4DTX A;  3UIQ A;  4DTM A;  3QNN A;  3SI6 A;  4AI6 A;  3HP9 A;  1FZ2 E;  3RMD A;  3RMA A;  3RMC A;  3CQ8 A;  4FK0 A;  4M42 A;  2P1O B;  2YB5 A;  3N1B A;  1WAF A;  3OGM B;  3QEW A;  1XVE E;  4M3W A;  5IBK B;  4DTN A;  2P1M B;  2JPN A;  2MZW B;  4I9L A;  1FYZ E;  3TAF A;  1FZ7 E;  1P22 A;  3NHG A;  4AKH A;  3QEV A;  4M3T A;  4JS5 A;  4RL5 A;  2OVR B;  3TAG A;  4FJI A;  2MMB A;  1WAJ A;  3CFO A;  3SQ0 A;  4I9Q A;  4DTU A;  2P1Q B;  3J27 A;  2P5G A;  4DTJ A;  4FJN A;  3NDK A;  3S9H A;  4JRP A;  3SCX A;  2LF3 A;  4FJJ A;  2E31 A;  3V7D B;  3TAB A;  4DU4 A;  2LF6 A;  1IG9 A;  4FJX A;  4FJL A;  3L2O B;  4X5N A;  4B08 A;  3C94 A;  1CLQ A;  1FZ5 E;  3E4Y A;  3SQ4 A;  4DTP A;  2JH8 A;  3SUN A;  1IH7 A;  2P1N B;  1MHZ G;  4KHW A;  4J2B A;  3QEI A;  4AKG A;  4J2D A;  3LDB A;  4E4B A;  4DU1 A;  3QEX A;  1XMG E;  1XVB E;  3E4W A;  3SUQ A;  3TL8 B;  1XVC E;  3CFR A;  2B8I A;  3CFP A;  1FZ3 E;  1FZ0 E;  1FS1 A;  2HD0 A;  3SUO A;  2PFT A;  3C6P B;  4ADO A;  3J2P A;  3LZI A;  3SNN A;  1XVG E;  4QND A;  4EYW A;  4QNC A;  4E3S A;  4GAM C;  2JHC A;  4FVM A;  5H37 A;  2JHA A;  1Q9X A;  1FZ1 E;  3SVI A;  4FK2 A;  2B1E A;  4KI4 A;  3QES A;  3OGK B;  3KD5 E;  5IZ7 A;  4KHU A;  4M41 A;  1LDK E;  4DTO A;  4ADN A;  3HGL A;  3OGL B;  3NAE A;  2JHP A;  2OZS A;  2B7M A;  3LZJ A;  3QER A;  1XMH E;  2OZM A;  4KHY A;  3SPY A;  4FK4 A;  1FZ4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...