4X5MA

Crystal structure of semisweet in the inward-open conformation
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
86
structure length
86
Chain Sequence
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFAVLIANIVTLFLAAPVLVITLINRRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Uncharacterized protein
publication title Structural basis for the facilitative diffusion mechanism by SemiSWEET transporter
pubmed doi rcsb
source organism Escherichia coli umea 3162-1
total genus 32
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4x5mA00
4X5MA 4QNCA 4QNDA 4X5NA 4RNGA
chains in the Genus database with same CATH superfamily
2FW3A 3C95A 4JRQA 3SUPA 4FK0A 4I9QA 4AI6A 1XU5E 3TAEA 2QXFA 2P1PB 4KHWA 4M3UA 3CQ8A 5IREA 3QEXA 2P1MB 3C94A 4E3SA 1FYZE 4ICGC 3SVIA 3SQ1A 2MMBA 3QEVA 1CLQA 3C6NB 3BVOA 1FZ9E 3C6OB 2B7MA 4M3XA 2OVRB 4RNGA 3N1BA 1FZIE 4DTXA 2OZMA 3CFOA 4FJXA 4FJMA 4QNDA 1MTYG 4J2EA 2HD0A 1XL3C 4ADOA 4E4BA 3HGLA 3SUQA 2MZWB 4KI6A 3SUOA 1FZHE 2K5SA 2RCUA 1XMGE 3J2PA 4FJKA 2P5GA 4EPHA 2B8IA 3LZJA 3UIQA 4FK2A 3SQ4A 1MMOG 4AKGA 1FZ4E 4ADNA 1FZ1E 3J27A 3SQ2A 1XVCE 3LZIA 3L8BA 4FJIA 1Q9YA 2ATQA 4KHNA 4AKIA 3SNNA 4KHYA 4M3RA 4FJ7A 3RWUA 3NAEA 1XMHE 3L2OB 4J2BA 4M3TA 4AKHA 4DTOA 2P1NB 2OYQA 4FJ8A 3QEPA 2JQTA 1LDKE 1FXXA 4DTRA 4FJHA 4M42A 3QNOA 1XVGE 2LF6A 4FJLA 4DU3A 2VJ4A 1IH7A 2JH8A 3RMCA 4I9LA 2P5OA 4FJJA 1FPOA 2B1EA 4JRPA 4JS5A 2VJ5A 4FK4A 2H4TA 2RKHA 3OGMB 2E31A 4DU4A 3SUNA 3E4YA 3QETA 3HL8A 3K2OA 3NCIA 1FZ7E 5IBKB 3L0MA 4KHSA 4KI4A 2MW2A 4M41A 2DY4A 4RL5A 2E32A 4J2DA 1FZ3E 1FZ6E 1JW2A 3NDKA 1MHZG 2PFVA 5H37A 3NHGA 4FJGA 3OGKB 4DTMA 3SPZA 1FZ2E 4FVMA 4QNCA 1WAFA 4DTSA 3QERA 2LF3A 3TAFA 2JPNA 3KD1E 3UO2A 3QESA 3QEIA 4GAMC 1NEXB 3QEWA 4DTJA 3TAGA 3HP9A 4EP9A 3SPYA 2JH9A 2JHAA 4M45A 1XVEE 1XU3E 3E4WA 4M3WA 1IG9A 3KD5E 2DTUA 1FZ0E 3SJJA 4FJNA 1XVDE 1FS1A 3LD8A 3S9HA 2FYOA 4JS4A 3N1EA 1FZ5E 1MHYG 3RMBA 3V7DB 3SCXA 3WSOA 3CFPA 4FJ9A 4B08A 4KHQA 3CFRA 2PFTA 2DEBA 3LDBA 4IT5A 4RG8A 2OVPB 4I6JB 4M3YA 3L1NA 3SI6A 3LDSA 2OVQB 3TABA 2OZSA 3HGKE 2P1QB 4EYWA 3MKSB 3NE6A 3QNNA 4DTPA 3RMDA 3OGLB 3TJYA 3UO3A 1FZ8E 3C6PB 4DTUA 1XVBE 2P1OB 4KHUA 1WAJA 2JHCA 3NGIA 2JHPA 3RMAA 4M3ZA 3TL8B 4DTNA 2YB5A 4X5MA 1XVFE 4FJ5A 4HCBA 4X5NA 3SQ0A 5IZ7A 1P22A 4DU1A 2VIXA 1Q9XA 4J2AA 1XMFE 1N1CA 4HCCA
chains in the Genus database with same CATH topology
2FW3A 3C95A 4JRQA 3SUPA 4FK0A 4I9QA 4AI6A 1XU5E 3TAEA 2QXFA 2P1PB 4KHWA 4M3UA 3CQ8A 5IREA 3QEXA 2P1MB 3C94A 4E3SA 1FYZE 3SVIA 3SQ1A 2MMBA 3QEVA 1CLQA 3C6NB 1FZ9E 3C6OB 2B7MA 4M3XA 2OVRB 4RNGA 3N1BA 1FZIE 4DTXA 2OZMA 3CFOA 4FJXA 4FJMA 4QNDA 1MTYG 4J2EA 2HD0A 1XL3C 4ADOA 4E4BA 3HGLA 3SUQA 2MZWB 4KI6A 3SUOA 1FZHE 2RCUA 1XMGE 3J2PA 4FJKA 2P5GA 4EPHA 2B8IA 3LZJA 3UIQA 4FK2A 3SQ4A 1MMOG 4AKGA 1FZ4E 4ADNA 1FZ1E 3J27A 3SQ2A 1XVCE 3LZIA 3L8BA 4FJIA 1Q9YA 2ATQA 4KHNA 4AKIA 3SNNA 4KHYA 4M3RA 4FJ7A 3RWUA 3NAEA 1XMHE 3L2OB 4J2BA 4M3TA 4AKHA 4DTOA 2P1NB 2OYQA 4FJ8A 3QEPA 4DTRA 1LDKE 1FXXA 4FJHA 4M42A 3QNOA 1XVGE 2LF6A 4FJLA 4DU3A 2VJ4A 1IH7A 2JH8A 3RMCA 4I9LA 2P5OA 4FJJA 2B1EA 4JRPA 4JS5A 2VJ5A 4FK4A 2H4TA 3OGMB 2E31A 4DU4A 3SUNA 3E4YA 3QETA 3HL8A 3K2OA 3NCIA 1FZ7E 5IBKB 3L0MA 4KHSA 4KI4A 4M41A 2DY4A 4RL5A 2E32A 4J2DA 1FZ3E 1FZ6E 3NDKA 1MHZG 2PFVA 5H37A 3NHGA 4FJGA 3OGKB 4DTMA 3SPZA 1FZ2E 4FVMA 4QNCA 1WAFA 4DTSA 3QERA 2LF3A 3TAFA 2JPNA 3KD1E 3QESA 3QEIA 4GAMC 1NEXB 3QEWA 4DTJA 3TAGA 3HP9A 4EP9A 3SPYA 2JH9A 2JHAA 4M45A 1XVEE 1XU3E 3E4WA 4M3WA 1IG9A 3KD5E 2DTUA 1FZ0E 3SJJA 4FJNA 1XVDE 1FS1A 3LD8A 3S9HA 2FYOA 4JS4A 3N1EA 1FZ5E 1MHYG 3RMBA 3V7DB 3SCXA 3WSOA 3CFPA 4FJ9A 4B08A 4KHQA 3CFRA 2PFTA 2DEBA 3LDBA 4RG8A 2OVPB 4I6JB 4M3YA 3L1NA 3SI6A 3LDSA 2OVQB 3TABA 2OZSA 3HGKE 2P1QB 4EYWA 3MKSB 3NE6A 3QNNA 4DTPA 3RMDA 3TJYA 1FZ8E 3C6PB 4DTUA 1XVBE 2P1OB 4KHUA 1WAJA 2JHCA 3NGIA 2JHPA 3RMAA 4M3ZA 3TL8B 4DTNA 2YB5A 4X5MA 1XVFE 4FJ5A 4HCBA 4X5NA 3SQ0A 5IZ7A 1P22A 4DU1A 2VIXA 1Q9XA 4J2AA 1XMFE 3OGLB 4HCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5M A;  4QNC A;  4QND A;  4X5N A;  4RNG A; 
#chains in the Genus database with same CATH topology
 2FW3 A;  3C95 A;  4JRQ A;  3SUP A;  4FK0 A;  4I9Q A;  4AI6 A;  1XU5 E;  3TAE A;  2QXF A;  2P1P B;  4KHW A;  4M3U A;  3CQ8 A;  5IRE A;  3QEX A;  2P1M B;  3C94 A;  4E3S A;  1FYZ E;  4ICG C;  3SVI A;  3SQ1 A;  2MMB A;  3QEV A;  1CLQ A;  3C6N B;  3BVO A;  1FZ9 E;  3C6O B;  2B7M A;  4M3X A;  2OVR B;  4RNG A;  3N1B A;  1FZI E;  4DTX A;  2OZM A;  3CFO A;  4FJX A;  4FJM A;  4QND A;  1MTY G;  4J2E A;  2HD0 A;  1XL3 C;  4ADO A;  4E4B A;  3HGL A;  3SUQ A;  2MZW B;  4KI6 A;  3SUO A;  1FZH E;  2K5S A;  2RCU A;  1XMG E;  3J2P A;  4FJK A;  2P5G A;  4EPH A;  2B8I A;  3LZJ A;  3UIQ A;  4FK2 A;  3SQ4 A;  1MMO G;  4AKG A;  1FZ4 E;  4ADN A;  1FZ1 E;  3J27 A;  3SQ2 A;  1XVC E;  3LZI A;  3L8B A;  4FJI A;  1Q9Y A;  2ATQ A;  4KHN A;  4AKI A;  3SNN A;  4KHY A;  4M3R A;  4FJ7 A;  3RWU A;  3NAE A;  1XMH E;  3L2O B;  4J2B A;  4M3T A;  4AKH A;  4DTO A;  2P1N B;  2OYQ A;  4FJ8 A;  3QEP A;  2JQT A;  1LDK E;  1FXX A;  4DTR A;  4FJH A;  4M42 A;  3QNO A;  1XVG E;  2LF6 A;  4FJL A;  4DU3 A;  2VJ4 A;  1IH7 A;  2JH8 A;  3RMC A;  4I9L A;  2P5O A;  4FJJ A;  1FPO A;  2B1E A;  4JRP A;  4JS5 A;  2VJ5 A;  4FK4 A;  2H4T A;  2RKH A;  3OGM B;  2E31 A;  4DU4 A;  3SUN A;  3E4Y A;  3QET A;  3HL8 A;  3K2O A;  3NCI A;  1FZ7 E;  5IBK B;  3L0M A;  4KHS A;  4KI4 A;  2MW2 A;  4M41 A;  2DY4 A;  4RL5 A;  2E32 A;  4J2D A;  1FZ3 E;  1FZ6 E;  1JW2 A;  3NDK A;  1MHZ G;  2PFV A;  5H37 A;  3NHG A;  4FJG A;  3OGK B;  4DTM A;  3SPZ A;  1FZ2 E;  4FVM A;  4QNC A;  1WAF A;  4DTS A;  3QER A;  2LF3 A;  3TAF A;  2JPN A;  3KD1 E;  3UO2 A;  3QES A;  3QEI A;  4GAM C;  1NEX B;  3QEW A;  4DTJ A;  3TAG A;  3HP9 A;  4EP9 A;  3SPY A;  2JH9 A;  2JHA A;  4M45 A;  1XVE E;  1XU3 E;  3E4W A;  4M3W A;  1IG9 A;  3KD5 E;  2DTU A;  1FZ0 E;  3SJJ A;  4FJN A;  1XVD E;  1FS1 A;  3LD8 A;  3S9H A;  2FYO A;  4JS4 A;  3N1E A;  1FZ5 E;  1MHY G;  3RMB A;  3V7D B;  3SCX A;  3WSO A;  3CFP A;  4FJ9 A;  4B08 A;  4KHQ A;  3CFR A;  2PFT A;  2DEB A;  3LDB A;  4IT5 A;  4RG8 A;  2OVP B;  4I6J B;  4M3Y A;  3L1N A;  3SI6 A;  3LDS A;  2OVQ B;  3TAB A;  2OZS A;  3HGK E;  2P1Q B;  4EYW A;  3MKS B;  3NE6 A;  3QNN A;  4DTP A;  3RMD A;  3OGL B;  3TJY A;  3UO3 A;  1FZ8 E;  3C6P B;  4DTU A;  1XVB E;  2P1O B;  4KHU A;  1WAJ A;  2JHC A;  3NGI A;  2JHP A;  3RMA A;  4M3Z A;  3TL8 B;  4DTN A;  2YB5 A;  4X5M A;  1XVF E;  4FJ5 A;  4HCB A;  4X5N A;  3SQ0 A;  5IZ7 A;  1P22 A;  4DU1 A;  2VIX A;  1Q9X A;  4J2A A;  1XMF E;  1N1C A;  4HCC A; 
#chains in the Genus database with same CATH homology
 2FW3 A;  3C95 A;  4JRQ A;  3SUP A;  4FK0 A;  4I9Q A;  4AI6 A;  1XU5 E;  3TAE A;  2QXF A;  2P1P B;  4KHW A;  4M3U A;  3CQ8 A;  5IRE A;  3QEX A;  2P1M B;  3C94 A;  4E3S A;  1FYZ E;  3SVI A;  3SQ1 A;  2MMB A;  3QEV A;  1CLQ A;  3C6N B;  1FZ9 E;  3C6O B;  2B7M A;  4M3X A;  2OVR B;  4RNG A;  3N1B A;  1FZI E;  4DTX A;  2OZM A;  3CFO A;  4FJX A;  4FJM A;  4QND A;  1MTY G;  4J2E A;  2HD0 A;  1XL3 C;  4ADO A;  4E4B A;  3HGL A;  3SUQ A;  2MZW B;  4KI6 A;  3SUO A;  1FZH E;  2RCU A;  1XMG E;  3J2P A;  4FJK A;  2P5G A;  4EPH A;  2B8I A;  3LZJ A;  3UIQ A;  4FK2 A;  3SQ4 A;  1MMO G;  4AKG A;  1FZ4 E;  4ADN A;  1FZ1 E;  3J27 A;  3SQ2 A;  1XVC E;  3LZI A;  3L8B A;  4FJI A;  1Q9Y A;  2ATQ A;  4KHN A;  4AKI A;  3SNN A;  4KHY A;  4M3R A;  4FJ7 A;  3RWU A;  3NAE A;  1XMH E;  3L2O B;  4J2B A;  4M3T A;  4AKH A;  4DTO A;  2P1N B;  2OYQ A;  4FJ8 A;  3QEP A;  4DTR A;  1LDK E;  1FXX A;  4FJH A;  4M42 A;  3QNO A;  1XVG E;  2LF6 A;  4FJL A;  4DU3 A;  2VJ4 A;  1IH7 A;  2JH8 A;  3RMC A;  4I9L A;  2P5O A;  4FJJ A;  2B1E A;  4JRP A;  4JS5 A;  2VJ5 A;  4FK4 A;  2H4T A;  3OGM B;  2E31 A;  4DU4 A;  3SUN A;  3E4Y A;  3QET A;  3HL8 A;  3K2O A;  3NCI A;  1FZ7 E;  5IBK B;  3L0M A;  4KHS A;  4KI4 A;  4M41 A;  2DY4 A;  4RL5 A;  2E32 A;  4J2D A;  1FZ3 E;  1FZ6 E;  3NDK A;  1MHZ G;  2PFV A;  5H37 A;  3NHG A;  4FJG A;  3OGK B;  4DTM A;  3SPZ A;  1FZ2 E;  4FVM A;  4QNC A;  1WAF A;  4DTS A;  3QER A;  2LF3 A;  3TAF A;  2JPN A;  3KD1 E;  3QES A;  3QEI A;  4GAM C;  1NEX B;  3QEW A;  4DTJ A;  3TAG A;  3HP9 A;  4EP9 A;  3SPY A;  2JH9 A;  2JHA A;  4M45 A;  1XVE E;  1XU3 E;  3E4W A;  4M3W A;  1IG9 A;  3KD5 E;  2DTU A;  1FZ0 E;  3SJJ A;  4FJN A;  1XVD E;  1FS1 A;  3LD8 A;  3S9H A;  2FYO A;  4JS4 A;  3N1E A;  1FZ5 E;  1MHY G;  3RMB A;  3V7D B;  3SCX A;  3WSO A;  3CFP A;  4FJ9 A;  4B08 A;  4KHQ A;  3CFR A;  2PFT A;  2DEB A;  3LDB A;  4RG8 A;  2OVP B;  4I6J B;  4M3Y A;  3L1N A;  3SI6 A;  3LDS A;  2OVQ B;  3TAB A;  2OZS A;  3HGK E;  2P1Q B;  4EYW A;  3MKS B;  3NE6 A;  3QNN A;  4DTP A;  3RMD A;  3TJY A;  1FZ8 E;  3C6P B;  4DTU A;  1XVB E;  2P1O B;  4KHU A;  1WAJ A;  2JHC A;  3NGI A;  2JHP A;  3RMA A;  4M3Z A;  3TL8 B;  4DTN A;  2YB5 A;  4X5M A;  1XVF E;  4FJ5 A;  4HCB A;  4X5N A;  3SQ0 A;  5IZ7 A;  1P22 A;  4DU1 A;  2VIX A;  1Q9X A;  4J2A A;  1XMF E;  3OGL B;  4HCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...