4ADNA

Fusidic acid resistance protein fusb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAR1
publication title Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
total genus 67
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4adnA01
4E4BA 4ADOA 2MZWB 4ADNA 2YB5A
chains in the Genus database with same CATH superfamily
3SQ1A 1WAFA 3UO3A 4FJGA 3CFPA 2B7MA 4FK0A 4FJ5A 4KHUA 3RMBA 4J2EA 4M42A 3SUQA 3RMAA 4DTSA 1FXXA 3KD1E 2DEBA 1XMGE 1MTYG 3NGIA 1FZ6E 2B1EA 2P1PB 2B8IA 2P1QB 4M3ZA 2OYQA 3LDSA 1FZ4E 2QXFA 1FZ3E 1MHZG 2E31A 2RKHA 2JH8A 4QNCA 3L2OB 3J2PA 1FZHE 3L8BA 4DTXA 2MZWB 4I9LA 4FJLA 4HCBA 3C6PB 4X5MA 3KD5E 4I9QA 3NDKA 4FJMA 3K2OA 4KHYA 3N1EA 4M3RA 1FZ5E 2OVPB 1Q9YA 2P5GA 4FK2A 2P1MB 2RCUA 4DTUA 3QEIA 4AKHA 1XMHE 5IBKB 1WAJA 4KHQA 3LD8A 5H37A 1XVDE 2LF6A 4JS5A 3S9HA 4M3YA 4DTRA 3UO2A 3NAEA 2YB5A 4M3TA 3CFRA 2PFTA 2VIXA 3SQ4A 3C6OB 3RWUA 4FJHA 3HL8A 3SPZA 4RNGA 1P22A 3WSOA 4FJIA 4ICGC 2E32A 4DU3A 3TABA 4E3SA 3C6NB 4AI6A 1FYZE 2PFVA 3SPYA 4J2BA 3L0MA 2JHCA 4FJJA 3QEPA 4DTMA 2DY4A 3RMDA 3NHGA 3QEVA 3V7DB 2JPNA 3SUNA 1Q9XA 4RG8A 3J27A 3SVIA 2OZMA 4FJ8A 4AKIA 3TAGA 3TJYA 2OVRB 4EYWA 3OGKB 4ADNA 3QNOA 4M3XA 3LZJA 4JRQA 1FZIE 3LDBA 3E4WA 3E4YA 1LDKE 2VJ4A 3TAFA 3SNNA 5IZ7A 4FJNA 4KI6A 3NCIA 1XVEE 4I6JB 1FZ7E 1XU5E 4FJKA 3SQ2A 4DTNA 1IH7A 4GAMC 2OVQB 3SJJA 1XL3C 3OGMB 2JQTA 4DU4A 4KHSA 4EPHA 2JH9A 4X5NA 1MMOG 3OGLB 3QESA 3QETA 3QEXA 3SUPA 2DTUA 1XVBE 4JS4A 3SUOA 2JHAA 3NE6A 2P5OA 4M41A 4AKGA 2JHPA 2OZSA 4JRPA 4IT5A 3QNNA 3BVOA 2ATQA 4RL5A 4FJ7A 2VJ5A 3SI6A 4M3WA 3TAEA 2LF3A 4DTJA 2FYOA 4KHWA 3HGKE 1MHYG 3C95A 1CLQA 1XVCE 4DU1A 4FJXA 4DTPA 2K5SA 2MW2A 1N1CA 1XMFE 1XU3E 1FS1A 3MKSB 3QERA 3CQ8A 4ADOA 4M3UA 4FJ9A 1NEXB 3N1BA 1FZ9E 2P1OB 4EP9A 4DTOA 3UIQA 4HCCA 3SCXA 4E4BA 4J2AA 4FK4A 1FZ8E 4QNDA 3HP9A 4M45A 1XVFE 2FW3A 3SQ0A 3CFOA 1FPOA 1IG9A 1JW2A 1FZ2E 4FVMA 3LZIA 4KHNA 3C94A 3QEWA 4KI4A 2MMBA 2P1NB 2HD0A 4J2DA 3HGLA 1FZ0E 2H4TA 5IREA 1FZ1E 3RMCA 3TL8B 4B08A 3L1NA 1XVGE
chains in the Genus database with same CATH topology
3SQ1A 1WAFA 4FJGA 3CFPA 2B7MA 4FK0A 4FJ5A 4KHUA 3RMBA 4J2EA 4M42A 3SUQA 3RMAA 4DTSA 1FXXA 3KD1E 2DEBA 1XMGE 1MTYG 3NGIA 1FZ6E 2B1EA 2P1PB 2B8IA 2P1QB 4M3ZA 2OYQA 3LDSA 1FZ4E 2QXFA 1FZ3E 1MHZG 2E31A 2JH8A 4QNCA 3L2OB 3J2PA 1FZHE 3L8BA 4DTXA 2MZWB 4I9LA 4FJLA 4HCBA 3C6PB 4X5MA 3KD5E 4I9QA 3NDKA 4FJMA 3K2OA 4KHYA 3N1EA 4M3RA 1FZ5E 2OVPB 1Q9YA 2P5GA 4FK2A 2P1MB 2RCUA 4DTUA 3QEIA 4AKHA 1XMHE 5IBKB 1WAJA 4KHQA 3LD8A 5H37A 1XVDE 2LF6A 4JS5A 3S9HA 4M3YA 4DTRA 3NAEA 2YB5A 4M3TA 3CFRA 2PFTA 2VIXA 3SQ4A 3C6OB 3RWUA 4FJHA 3HL8A 3SPZA 4RNGA 1P22A 3WSOA 4FJIA 4DU3A 2E32A 3TABA 4E3SA 3C6NB 4AI6A 1FYZE 2PFVA 3SPYA 4J2BA 3L0MA 2JHCA 4FJJA 3QEPA 4DTMA 2DY4A 3RMDA 3NHGA 3QEVA 3V7DB 2JPNA 3SUNA 1Q9XA 4RG8A 3J27A 3SVIA 2OZMA 4FJ8A 4AKIA 3TAGA 3TJYA 2OVRB 4EYWA 3OGKB 4ADNA 3QNOA 4M3XA 3LZJA 4JRQA 1FZIE 3LDBA 3E4WA 3E4YA 1LDKE 2VJ4A 3TAFA 3SNNA 5IZ7A 4FJNA 4KI6A 3NCIA 1XVEE 4I6JB 1FZ7E 1XU5E 4FJKA 3SQ2A 4DTNA 1IH7A 4GAMC 2OVQB 3SJJA 1XL3C 3OGMB 4KHSA 4DU4A 4EPHA 2JH9A 4X5NA 1MMOG 3OGLB 3QESA 3QETA 3QEXA 3SUPA 2DTUA 1XVBE 4JS4A 3SUOA 2JHAA 3NE6A 2P5OA 4M41A 4AKGA 2JHPA 2OZSA 4JRPA 3QNNA 2ATQA 4RL5A 4FJ7A 2VJ5A 3SI6A 4M3WA 3TAEA 2LF3A 4DTJA 2FYOA 4KHWA 3HGKE 1MHYG 3C95A 1CLQA 1XVCE 4DU1A 4FJXA 4DTPA 1XMFE 1XU3E 1FS1A 3MKSB 3QERA 3CQ8A 4ADOA 4M3UA 4FJ9A 1NEXB 3N1BA 1FZ9E 2P1OB 4EP9A 4DTOA 3UIQA 4HCCA 3SCXA 4E4BA 4J2AA 4FK4A 1FZ8E 4QNDA 3HP9A 4M45A 1XVFE 2FW3A 3SQ0A 3CFOA 1IG9A 1FZ2E 4FVMA 3LZIA 4KHNA 3C94A 3QEWA 4KI4A 2MMBA 2P1NB 2HD0A 4J2DA 3HGLA 1FZ0E 2H4TA 5IREA 1FZ1E 3RMCA 3TL8B 4B08A 3L1NA 1XVGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4B A;  4ADO A;  2MZW B;  4ADN A;  2YB5 A; 
#chains in the Genus database with same CATH topology
 3SQ1 A;  1WAF A;  3UO3 A;  4FJG A;  3CFP A;  2B7M A;  4FK0 A;  4FJ5 A;  4KHU A;  3RMB A;  4J2E A;  4M42 A;  3SUQ A;  3RMA A;  4DTS A;  1FXX A;  3KD1 E;  2DEB A;  1XMG E;  1MTY G;  3NGI A;  1FZ6 E;  2B1E A;  2P1P B;  2B8I A;  2P1Q B;  4M3Z A;  2OYQ A;  3LDS A;  1FZ4 E;  2QXF A;  1FZ3 E;  1MHZ G;  2E31 A;  2RKH A;  2JH8 A;  4QNC A;  3L2O B;  3J2P A;  1FZH E;  3L8B A;  4DTX A;  2MZW B;  4I9L A;  4FJL A;  4HCB A;  3C6P B;  4X5M A;  3KD5 E;  4I9Q A;  3NDK A;  4FJM A;  3K2O A;  4KHY A;  3N1E A;  4M3R A;  1FZ5 E;  2OVP B;  1Q9Y A;  2P5G A;  4FK2 A;  2P1M B;  2RCU A;  4DTU A;  3QEI A;  4AKH A;  1XMH E;  5IBK B;  1WAJ A;  4KHQ A;  3LD8 A;  5H37 A;  1XVD E;  2LF6 A;  4JS5 A;  3S9H A;  4M3Y A;  4DTR A;  3UO2 A;  3NAE A;  2YB5 A;  4M3T A;  3CFR A;  2PFT A;  2VIX A;  3SQ4 A;  3C6O B;  3RWU A;  4FJH A;  3HL8 A;  3SPZ A;  4RNG A;  1P22 A;  3WSO A;  4FJI A;  4ICG C;  2E32 A;  4DU3 A;  3TAB A;  4E3S A;  3C6N B;  4AI6 A;  1FYZ E;  2PFV A;  3SPY A;  4J2B A;  3L0M A;  2JHC A;  4FJJ A;  3QEP A;  4DTM A;  2DY4 A;  3RMD A;  3NHG A;  3QEV A;  3V7D B;  2JPN A;  3SUN A;  1Q9X A;  4RG8 A;  3J27 A;  3SVI A;  2OZM A;  4FJ8 A;  4AKI A;  3TAG A;  3TJY A;  2OVR B;  4EYW A;  3OGK B;  4ADN A;  3QNO A;  4M3X A;  3LZJ A;  4JRQ A;  1FZI E;  3LDB A;  3E4W A;  3E4Y A;  1LDK E;  2VJ4 A;  3TAF A;  3SNN A;  5IZ7 A;  4FJN A;  4KI6 A;  3NCI A;  1XVE E;  4I6J B;  1FZ7 E;  1XU5 E;  4FJK A;  3SQ2 A;  4DTN A;  1IH7 A;  4GAM C;  2OVQ B;  3SJJ A;  1XL3 C;  3OGM B;  2JQT A;  4DU4 A;  4KHS A;  4EPH A;  2JH9 A;  4X5N A;  1MMO G;  3OGL B;  3QES A;  3QET A;  3QEX A;  3SUP A;  2DTU A;  1XVB E;  4JS4 A;  3SUO A;  2JHA A;  3NE6 A;  2P5O A;  4M41 A;  4AKG A;  2JHP A;  2OZS A;  4JRP A;  4IT5 A;  3QNN A;  3BVO A;  2ATQ A;  4RL5 A;  4FJ7 A;  2VJ5 A;  3SI6 A;  4M3W A;  3TAE A;  2LF3 A;  4DTJ A;  2FYO A;  4KHW A;  3HGK E;  1MHY G;  3C95 A;  1CLQ A;  1XVC E;  4DU1 A;  4FJX A;  4DTP A;  2K5S A;  2MW2 A;  1N1C A;  1XMF E;  1XU3 E;  1FS1 A;  3MKS B;  3QER A;  3CQ8 A;  4ADO A;  4M3U A;  4FJ9 A;  1NEX B;  3N1B A;  1FZ9 E;  2P1O B;  4EP9 A;  4DTO A;  3UIQ A;  4HCC A;  3SCX A;  4E4B A;  4J2A A;  4FK4 A;  1FZ8 E;  4QND A;  3HP9 A;  4M45 A;  1XVF E;  2FW3 A;  3SQ0 A;  3CFO A;  1FPO A;  1IG9 A;  1JW2 A;  1FZ2 E;  4FVM A;  3LZI A;  4KHN A;  3C94 A;  3QEW A;  4KI4 A;  2MMB A;  2P1N B;  2HD0 A;  4J2D A;  3HGL A;  1FZ0 E;  2H4T A;  5IRE A;  1FZ1 E;  3RMC A;  3TL8 B;  4B08 A;  3L1N A;  1XVG E; 
#chains in the Genus database with same CATH homology
 3SQ1 A;  1WAF A;  4FJG A;  3CFP A;  2B7M A;  4FK0 A;  4FJ5 A;  4KHU A;  3RMB A;  4J2E A;  4M42 A;  3SUQ A;  3RMA A;  4DTS A;  1FXX A;  3KD1 E;  2DEB A;  1XMG E;  1MTY G;  3NGI A;  1FZ6 E;  2B1E A;  2P1P B;  2B8I A;  2P1Q B;  4M3Z A;  2OYQ A;  3LDS A;  1FZ4 E;  2QXF A;  1FZ3 E;  1MHZ G;  2E31 A;  2JH8 A;  4QNC A;  3L2O B;  3J2P A;  1FZH E;  3L8B A;  4DTX A;  2MZW B;  4I9L A;  4FJL A;  4HCB A;  3C6P B;  4X5M A;  3KD5 E;  4I9Q A;  3NDK A;  4FJM A;  3K2O A;  4KHY A;  3N1E A;  4M3R A;  1FZ5 E;  2OVP B;  1Q9Y A;  2P5G A;  4FK2 A;  2P1M B;  2RCU A;  4DTU A;  3QEI A;  4AKH A;  1XMH E;  5IBK B;  1WAJ A;  4KHQ A;  3LD8 A;  5H37 A;  1XVD E;  2LF6 A;  4JS5 A;  3S9H A;  4M3Y A;  4DTR A;  3NAE A;  2YB5 A;  4M3T A;  3CFR A;  2PFT A;  2VIX A;  3SQ4 A;  3C6O B;  3RWU A;  4FJH A;  3HL8 A;  3SPZ A;  4RNG A;  1P22 A;  3WSO A;  4FJI A;  4DU3 A;  2E32 A;  3TAB A;  4E3S A;  3C6N B;  4AI6 A;  1FYZ E;  2PFV A;  3SPY A;  4J2B A;  3L0M A;  2JHC A;  4FJJ A;  3QEP A;  4DTM A;  2DY4 A;  3RMD A;  3NHG A;  3QEV A;  3V7D B;  2JPN A;  3SUN A;  1Q9X A;  4RG8 A;  3J27 A;  3SVI A;  2OZM A;  4FJ8 A;  4AKI A;  3TAG A;  3TJY A;  2OVR B;  4EYW A;  3OGK B;  4ADN A;  3QNO A;  4M3X A;  3LZJ A;  4JRQ A;  1FZI E;  3LDB A;  3E4W A;  3E4Y A;  1LDK E;  2VJ4 A;  3TAF A;  3SNN A;  5IZ7 A;  4FJN A;  4KI6 A;  3NCI A;  1XVE E;  4I6J B;  1FZ7 E;  1XU5 E;  4FJK A;  3SQ2 A;  4DTN A;  1IH7 A;  4GAM C;  2OVQ B;  3SJJ A;  1XL3 C;  3OGM B;  4KHS A;  4DU4 A;  4EPH A;  2JH9 A;  4X5N A;  1MMO G;  3OGL B;  3QES A;  3QET A;  3QEX A;  3SUP A;  2DTU A;  1XVB E;  4JS4 A;  3SUO A;  2JHA A;  3NE6 A;  2P5O A;  4M41 A;  4AKG A;  2JHP A;  2OZS A;  4JRP A;  3QNN A;  2ATQ A;  4RL5 A;  4FJ7 A;  2VJ5 A;  3SI6 A;  4M3W A;  3TAE A;  2LF3 A;  4DTJ A;  2FYO A;  4KHW A;  3HGK E;  1MHY G;  3C95 A;  1CLQ A;  1XVC E;  4DU1 A;  4FJX A;  4DTP A;  1XMF E;  1XU3 E;  1FS1 A;  3MKS B;  3QER A;  3CQ8 A;  4ADO A;  4M3U A;  4FJ9 A;  1NEX B;  3N1B A;  1FZ9 E;  2P1O B;  4EP9 A;  4DTO A;  3UIQ A;  4HCC A;  3SCX A;  4E4B A;  4J2A A;  4FK4 A;  1FZ8 E;  4QND A;  3HP9 A;  4M45 A;  1XVF E;  2FW3 A;  3SQ0 A;  3CFO A;  1IG9 A;  1FZ2 E;  4FVM A;  3LZI A;  4KHN A;  3C94 A;  3QEW A;  4KI4 A;  2MMB A;  2P1N B;  2HD0 A;  4J2D A;  3HGL A;  1FZ0 E;  2H4T A;  5IRE A;  1FZ1 E;  3RMC A;  3TL8 B;  4B08 A;  3L1N A;  1XVG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...