4ADNA

Fusidic acid resistance protein fusb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibiotic resistance
molecule keywords FAR1
publication title Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 67
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4adnA01
4E4BA 4ADNA 4ADOA 2YB5A 2MZWB
chains in the Genus database with same CATH superfamily
2JHCA 4IT5A 1FPOA 3OGMB 1XU3E 2H4TA 1MHZG 3C95A 4FJGA 2P1MB 2YB5A 2PFVA 1FZ2E 3RMAA 3TAEA 1XMFE 1XVEE 2E32A 3RWUA 4KI4A 3QEWA 2JHAA 3C94A 4M3UA 4DTUA 2VJ4A 4FVMA 4M45A 4JS5A 2RCUA 3LZIA 2DY4A 2MMBA 4DTNA 3HP9A 4DTOA 3TAFA 4KHQA 4ADNA 3NHGA 4M3RA 3QESA 1FXXA 4M3XA 4DU3A 3J2PA 4FJNA 1FZ0E 4JRQA 3MKSB 4FJJA 3LDSA 1Q9XA 2FYOA 2JH8A 3QETA 2DTUA 4ADOA 4E3SA 4GAMC 3SUNA 1XU5E 4EP9A 1JW2A 2JPNA 2OVQB 2P1OB 2P1PB 3C6PB 3V7DB 3SQ0A 4FK0A 3J27A 3QNNA 1CLQA 2MW2A 3C6NB 1XVDE 4KHWA 1FZ9E 1Q9YA 3WSOA 3L0MA 1IG9A 4M41A 4J2DA 3E4YA 4QNCA 4J2EA 1FZ3E 4FJ9A 4I6JB 2OYQA 2E31A 3LD8A 4KI6A 5H37A 4KHUA 4DTPA 3LZJA 3K2OA 2VIXA 3C6OB 3SUQA 1FZ8E 2RKHA 4EPHA 2VJ5A 1XVGE 1N1CA 4AKIA 1WAFA 1MTYG 4FJHA 1FYZE 4KHYA 3UO2A 2P1QB 3QNOA 3QEVA 3CFPA 3HL8A 2JHPA 3SVIA 1XVFE 3QEPA 2DEBA 2JH9A 2P5OA 2OZSA 3UIQA 4FJLA 4EYWA 4E4BA 3KD1E 4DU4A 4RL5A 3HGKE 4KHSA 4M3ZA 4M3WA 3SQ4A 1MMOG 5IBKB 3NAEA 3QERA 3N1EA 4FJ7A 3SCXA 1NEXB 3RMBA 4KHNA 3SUOA 1FZ4E 2HD0A 3CFOA 4DU1A 4I9LA 1FS1A 2FW3A 3L1NA 1MHYG 1LDKE 3RMDA 3LDBA 2P5GA 1FZHE 1WAJA 2LF6A 1FZ1E 4RG8A 5IREA 3SQ2A 4X5MA 4AI6A 1XMHE 1XVBE 2ATQA 3E4WA 2MZWB 1XL3C 4M42A 2OVPB 4DTXA 3SI6A 4M3YA 3CFRA 4DTRA 3SNNA 3NCIA 3HGLA 4QNDA 3SJJA 4FJIA 2OVRB 2B1EA 4JRPA 3CQ8A 3TJYA 1IH7A 3NDKA 4AKHA 2OZMA 3QEXA 4FK4A 4J2BA 2B7MA 4FJ8A 4AKGA 4FJKA 4HCBA 1FZIE 3SPZA 2PFTA 4FK2A 3S9HA 4DTJA 2K5SA 4HCCA 3SUPA 3QEIA 3SQ1A 4ICGC 1FZ7E 2QXFA 4FJMA 4M3TA 2B8IA 4DTMA 3SPYA 3OGKB 3BVOA 1P22A 3TAGA 3NE6A 3L2OB 2P1NB 1FZ6E 3L8BA 4FJ5A 4J2AA 4X5NA 3NGIA 3RMCA 5IZ7A 3TABA 3KD5E 4DTSA 1FZ5E 4RNGA 1XMGE 4I9QA 4JS4A 4FJXA 3TL8B 3UO3A 4B08A 2LF3A 2JQTA 3N1BA 3OGLB 1XVCE
chains in the Genus database with same CATH topology
2JHCA 3OGMB 1XU3E 2H4TA 1MHZG 3C95A 4FJGA 2P1MB 2YB5A 2PFVA 1FZ2E 3RMAA 3TAEA 1XMFE 1XVEE 2E32A 3RWUA 4KI4A 3QEWA 2JHAA 3C94A 4M3UA 4DTUA 2VJ4A 4FVMA 4M45A 4JS5A 2RCUA 3LZIA 2DY4A 2MMBA 4DTNA 3HP9A 4DTOA 3TAFA 4KHQA 4ADNA 3NHGA 4M3RA 3QESA 1FXXA 4M3XA 4DU3A 3J2PA 4FJNA 1FZ0E 4JRQA 3MKSB 4FJJA 3LDSA 1Q9XA 2FYOA 2JH8A 3QETA 2DTUA 4ADOA 4E3SA 4GAMC 3SUNA 1XU5E 4EP9A 2JPNA 2OVQB 2P1OB 2P1PB 3C6PB 3V7DB 3SQ0A 4FK0A 3J27A 3QNNA 1CLQA 3C6NB 1XVDE 4KHWA 1FZ9E 1Q9YA 3WSOA 3L0MA 1IG9A 4M41A 4J2DA 3E4YA 4QNCA 4J2EA 1FZ3E 4FJ9A 4I6JB 2OYQA 2E31A 3LD8A 4KI6A 5H37A 4KHUA 4DTPA 3LZJA 3K2OA 2VIXA 3C6OB 3SUQA 1FZ8E 4EPHA 2VJ5A 1XVGE 4AKIA 1WAFA 1MTYG 4FJHA 1FYZE 4KHYA 2P1QB 3QNOA 3QEVA 3CFPA 3HL8A 2JHPA 3SVIA 1XVFE 3QEPA 2DEBA 2JH9A 2P5OA 2OZSA 3UIQA 4FJLA 4EYWA 4E4BA 3KD1E 4DU4A 4RL5A 3HGKE 4KHSA 4M3ZA 4M3WA 3SQ4A 1MMOG 5IBKB 3NAEA 3QERA 3N1EA 4FJ7A 3SCXA 1NEXB 3RMBA 4KHNA 3SUOA 1FZ4E 2HD0A 3CFOA 4DU1A 4I9LA 1FS1A 2FW3A 3L1NA 1MHYG 1LDKE 3RMDA 3LDBA 2P5GA 1FZHE 1WAJA 2LF6A 1FZ1E 4RG8A 5IREA 3SQ2A 4X5MA 4AI6A 1XMHE 1XVBE 2ATQA 3E4WA 2MZWB 1XL3C 4M42A 2OVPB 4DTXA 3SI6A 4M3YA 3CFRA 4DTRA 3SNNA 3NCIA 3HGLA 4QNDA 3SJJA 4FJIA 2OVRB 2B1EA 4JRPA 3CQ8A 3TJYA 1IH7A 3NDKA 4AKHA 2OZMA 3QEXA 4FK4A 4J2BA 2B7MA 4FJ8A 4AKGA 4FJKA 4HCBA 1FZIE 3SPZA 2PFTA 4FK2A 3S9HA 4DTJA 4HCCA 3SUPA 3QEIA 3SQ1A 1FZ7E 2QXFA 4FJMA 4M3TA 2B8IA 4DTMA 3SPYA 3OGKB 1P22A 3TAGA 3NE6A 3L2OB 2P1NB 1FZ6E 3L8BA 4FJ5A 4J2AA 4X5NA 3NGIA 3RMCA 5IZ7A 3TABA 3KD5E 4DTSA 1FZ5E 4RNGA 1XMGE 4I9QA 4JS4A 4FJXA 3TL8B 4B08A 2LF3A 3N1BA 3OGLB 1XVCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E4B A;  4ADN A;  4ADO A;  2YB5 A;  2MZW B; 
#chains in the Genus database with same CATH topology
 2JHC A;  4IT5 A;  1FPO A;  3OGM B;  1XU3 E;  2H4T A;  1MHZ G;  3C95 A;  4FJG A;  2P1M B;  2YB5 A;  2PFV A;  1FZ2 E;  3RMA A;  3TAE A;  1XMF E;  1XVE E;  2E32 A;  3RWU A;  4KI4 A;  3QEW A;  2JHA A;  3C94 A;  4M3U A;  4DTU A;  2VJ4 A;  4FVM A;  4M45 A;  4JS5 A;  2RCU A;  3LZI A;  2DY4 A;  2MMB A;  4DTN A;  3HP9 A;  4DTO A;  3TAF A;  4KHQ A;  4ADN A;  3NHG A;  4M3R A;  3QES A;  1FXX A;  4M3X A;  4DU3 A;  3J2P A;  4FJN A;  1FZ0 E;  4JRQ A;  3MKS B;  4FJJ A;  3LDS A;  1Q9X A;  2FYO A;  2JH8 A;  3QET A;  2DTU A;  4ADO A;  4E3S A;  4GAM C;  3SUN A;  1XU5 E;  4EP9 A;  1JW2 A;  2JPN A;  2OVQ B;  2P1O B;  2P1P B;  3C6P B;  3V7D B;  3SQ0 A;  4FK0 A;  3J27 A;  3QNN A;  1CLQ A;  2MW2 A;  3C6N B;  1XVD E;  4KHW A;  1FZ9 E;  1Q9Y A;  3WSO A;  3L0M A;  1IG9 A;  4M41 A;  4J2D A;  3E4Y A;  4QNC A;  4J2E A;  1FZ3 E;  4FJ9 A;  4I6J B;  2OYQ A;  2E31 A;  3LD8 A;  4KI6 A;  5H37 A;  4KHU A;  4DTP A;  3LZJ A;  3K2O A;  2VIX A;  3C6O B;  3SUQ A;  1FZ8 E;  2RKH A;  4EPH A;  2VJ5 A;  1XVG E;  1N1C A;  4AKI A;  1WAF A;  1MTY G;  4FJH A;  1FYZ E;  4KHY A;  3UO2 A;  2P1Q B;  3QNO A;  3QEV A;  3CFP A;  3HL8 A;  2JHP A;  3SVI A;  1XVF E;  3QEP A;  2DEB A;  2JH9 A;  2P5O A;  2OZS A;  3UIQ A;  4FJL A;  4EYW A;  4E4B A;  3KD1 E;  4DU4 A;  4RL5 A;  3HGK E;  4KHS A;  4M3Z A;  4M3W A;  3SQ4 A;  1MMO G;  5IBK B;  3NAE A;  3QER A;  3N1E A;  4FJ7 A;  3SCX A;  1NEX B;  3RMB A;  4KHN A;  3SUO A;  1FZ4 E;  2HD0 A;  3CFO A;  4DU1 A;  4I9L A;  1FS1 A;  2FW3 A;  3L1N A;  1MHY G;  1LDK E;  3RMD A;  3LDB A;  2P5G A;  1FZH E;  1WAJ A;  2LF6 A;  1FZ1 E;  4RG8 A;  5IRE A;  3SQ2 A;  4X5M A;  4AI6 A;  1XMH E;  1XVB E;  2ATQ A;  3E4W A;  2MZW B;  1XL3 C;  4M42 A;  2OVP B;  4DTX A;  3SI6 A;  4M3Y A;  3CFR A;  4DTR A;  3SNN A;  3NCI A;  3HGL A;  4QND A;  3SJJ A;  4FJI A;  2OVR B;  2B1E A;  4JRP A;  3CQ8 A;  3TJY A;  1IH7 A;  3NDK A;  4AKH A;  2OZM A;  3QEX A;  4FK4 A;  4J2B A;  2B7M A;  4FJ8 A;  4AKG A;  4FJK A;  4HCB A;  1FZI E;  3SPZ A;  2PFT A;  4FK2 A;  3S9H A;  4DTJ A;  2K5S A;  4HCC A;  3SUP A;  3QEI A;  3SQ1 A;  4ICG C;  1FZ7 E;  2QXF A;  4FJM A;  4M3T A;  2B8I A;  4DTM A;  3SPY A;  3OGK B;  3BVO A;  1P22 A;  3TAG A;  3NE6 A;  3L2O B;  2P1N B;  1FZ6 E;  3L8B A;  4FJ5 A;  4J2A A;  4X5N A;  3NGI A;  3RMC A;  5IZ7 A;  3TAB A;  3KD5 E;  4DTS A;  1FZ5 E;  4RNG A;  1XMG E;  4I9Q A;  4JS4 A;  4FJX A;  3TL8 B;  3UO3 A;  4B08 A;  2LF3 A;  2JQT A;  3N1B A;  3OGL B;  1XVC E; 
#chains in the Genus database with same CATH homology
 2JHC A;  3OGM B;  1XU3 E;  2H4T A;  1MHZ G;  3C95 A;  4FJG A;  2P1M B;  2YB5 A;  2PFV A;  1FZ2 E;  3RMA A;  3TAE A;  1XMF E;  1XVE E;  2E32 A;  3RWU A;  4KI4 A;  3QEW A;  2JHA A;  3C94 A;  4M3U A;  4DTU A;  2VJ4 A;  4FVM A;  4M45 A;  4JS5 A;  2RCU A;  3LZI A;  2DY4 A;  2MMB A;  4DTN A;  3HP9 A;  4DTO A;  3TAF A;  4KHQ A;  4ADN A;  3NHG A;  4M3R A;  3QES A;  1FXX A;  4M3X A;  4DU3 A;  3J2P A;  4FJN A;  1FZ0 E;  4JRQ A;  3MKS B;  4FJJ A;  3LDS A;  1Q9X A;  2FYO A;  2JH8 A;  3QET A;  2DTU A;  4ADO A;  4E3S A;  4GAM C;  3SUN A;  1XU5 E;  4EP9 A;  2JPN A;  2OVQ B;  2P1O B;  2P1P B;  3C6P B;  3V7D B;  3SQ0 A;  4FK0 A;  3J27 A;  3QNN A;  1CLQ A;  3C6N B;  1XVD E;  4KHW A;  1FZ9 E;  1Q9Y A;  3WSO A;  3L0M A;  1IG9 A;  4M41 A;  4J2D A;  3E4Y A;  4QNC A;  4J2E A;  1FZ3 E;  4FJ9 A;  4I6J B;  2OYQ A;  2E31 A;  3LD8 A;  4KI6 A;  5H37 A;  4KHU A;  4DTP A;  3LZJ A;  3K2O A;  2VIX A;  3C6O B;  3SUQ A;  1FZ8 E;  4EPH A;  2VJ5 A;  1XVG E;  4AKI A;  1WAF A;  1MTY G;  4FJH A;  1FYZ E;  4KHY A;  2P1Q B;  3QNO A;  3QEV A;  3CFP A;  3HL8 A;  2JHP A;  3SVI A;  1XVF E;  3QEP A;  2DEB A;  2JH9 A;  2P5O A;  2OZS A;  3UIQ A;  4FJL A;  4EYW A;  4E4B A;  3KD1 E;  4DU4 A;  4RL5 A;  3HGK E;  4KHS A;  4M3Z A;  4M3W A;  3SQ4 A;  1MMO G;  5IBK B;  3NAE A;  3QER A;  3N1E A;  4FJ7 A;  3SCX A;  1NEX B;  3RMB A;  4KHN A;  3SUO A;  1FZ4 E;  2HD0 A;  3CFO A;  4DU1 A;  4I9L A;  1FS1 A;  2FW3 A;  3L1N A;  1MHY G;  1LDK E;  3RMD A;  3LDB A;  2P5G A;  1FZH E;  1WAJ A;  2LF6 A;  1FZ1 E;  4RG8 A;  5IRE A;  3SQ2 A;  4X5M A;  4AI6 A;  1XMH E;  1XVB E;  2ATQ A;  3E4W A;  2MZW B;  1XL3 C;  4M42 A;  2OVP B;  4DTX A;  3SI6 A;  4M3Y A;  3CFR A;  4DTR A;  3SNN A;  3NCI A;  3HGL A;  4QND A;  3SJJ A;  4FJI A;  2OVR B;  2B1E A;  4JRP A;  3CQ8 A;  3TJY A;  1IH7 A;  3NDK A;  4AKH A;  2OZM A;  3QEX A;  4FK4 A;  4J2B A;  2B7M A;  4FJ8 A;  4AKG A;  4FJK A;  4HCB A;  1FZI E;  3SPZ A;  2PFT A;  4FK2 A;  3S9H A;  4DTJ A;  4HCC A;  3SUP A;  3QEI A;  3SQ1 A;  1FZ7 E;  2QXF A;  4FJM A;  4M3T A;  2B8I A;  4DTM A;  3SPY A;  3OGK B;  1P22 A;  3TAG A;  3NE6 A;  3L2O B;  2P1N B;  1FZ6 E;  3L8B A;  4FJ5 A;  4J2A A;  4X5N A;  3NGI A;  3RMC A;  5IZ7 A;  3TAB A;  3KD5 E;  4DTS A;  1FZ5 E;  4RNG A;  1XMG E;  4I9Q A;  4JS4 A;  4FJX A;  3TL8 B;  4B08 A;  2LF3 A;  3N1B A;  3OGL B;  1XVC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...