4ADNA

Fusidic acid resistance protein fusb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
b'MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAR1
publication title Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
total genus 67
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4adnA01
2MZWB 4ADNA 4E4BA 4ADOA 2YB5A
chains in the Genus database with same CATH superfamily
1MHYG 3LDSA 2RCUA 3C95A 4I9LA 4RG8A 3KD1E 4FJJA 3L0MA 3TL8B 1XMHE 2QXFA 1WAFA 2P1MB 5IZ7A 3QEWA 4M3XA 1XL3C 2OVRB 2H4TA 3SQ0A 4J2BA 1XVFE 4QNCA 4AKGA 4M3UA 2B7MA 4KHQA 2OZMA 4FJ9A 3HGKE 2LF3A 3HGLA 1XVGE 2PFVA 1FPOA 4RNGA 4DU3A 3QEPA 4DTSA 4FJLA 2FYOA 3HL8A 2E31A 4J2EA 2JQTA 1MMOG 2MW2A 2HD0A 3SQ2A 4RL5A 3QEXA 1FZ6E 2JH9A 1FZ1E 4FVMA 4FK2A 4AI6A 2K5SA 3UO3A 4DTRA 3SI6A 2B1EA 3L1NA 3SVIA 4FJKA 4M42A 3LZJA 3TAFA 3E4WA 3NDKA 3CFRA 3TAEA 3SPYA 4FJMA 4FJHA 3OGKB 4HCBA 2DY4A 2LF6A 1XMGE 4JS4A 1Q9YA 3SCXA 4FK4A 4DU4A 3SUPA 2RKHA 4KHUA 3QNOA 4JS5A 3RMCA 2VJ5A 4I6JB 3MKSB 1FZ5E 4M3WA 3LZIA 3TABA 4B08A 1Q9XA 3OGMB 2OVPB 4EPHA 1FS1A 3SUOA 1N1CA 4J2AA 2JH8A 3J2PA 4EP9A 4M41A 1P22A 3HP9A 2PFTA 3SQ4A 4ICGC 3NE6A 4M3RA 4M45A 3TJYA 1IH7A 2P1PB 4KHYA 2OVQB 3L8BA 4DTOA 4KHWA 3KD5E 4FJ8A 4AKIA 3UO2A 3QNNA 3C6OB 3SPZA 1XU3E 2JHAA 4X5MA 3C6PB 5H37A 2MMBA 3CFOA 4HCCA 3K2OA 1FZ9E 1XVDE 3S9HA 4FK0A 4I9QA 3CQ8A 2DTUA 4FJ7A 1FZIE 2P5OA 1XVEE 2JHPA 3N1BA 3NCIA 4DTXA 4FJGA 3QESA 3RWUA 3NHGA 1FZ2E 3E4YA 4EYWA 1XVCE 4E3SA 1FZ4E 4FJIA 4DTMA 3WSOA 1XU5E 3N1EA 2P1QB 2VIXA 2MZWB 2JHCA 3RMBA 4M3ZA 1NEXB 4GAMC 4DTUA 3C6NB 3SQ1A 1FZ0E 4DTJA 3SNNA 4KI4A 1CLQA 1FYZE 2DEBA 3TAGA 2OZSA 4E4BA 4JRPA 4DTPA 2B8IA 2OYQA 4KHNA 2JPNA 4IT5A 3QERA 4DU1A 1FZ7E 3SUQA 3LD8A 4KHSA 4X5NA 2P1OB 2VJ4A 3NAEA 1MHZG 1XMFE 3C94A 1WAJA 1IG9A 1FZ8E 3RMDA 3RMAA 4FJNA 4M3YA 5IREA 4J2DA 1FZ3E 2FW3A 3NGIA 3QEVA 4AKHA 3SUNA 4JRQA 4ADOA 3QETA 2YB5A 3SJJA 1JW2A 4M3TA 4DTNA 4KI6A 3J27A 3V7DB 4FJ5A 1XVBE 3BVOA 3QEIA 3CFPA 3L2OB 3UIQA 1LDKE 1MTYG 2P1NB 1FZHE 1FXXA 3OGLB 4QNDA 4ADNA 4FJXA 2P5GA 5IBKB 2ATQA 3LDBA 2E32A
chains in the Genus database with same CATH topology
1MHYG 3LDSA 2RCUA 3C95A 4I9LA 4RG8A 3KD1E 4FJJA 3L0MA 3TL8B 1XMHE 2QXFA 1WAFA 2P1MB 5IZ7A 3QEWA 4M3XA 1XL3C 2OVRB 2H4TA 3SQ0A 4J2BA 1XVFE 4QNCA 4AKGA 4M3UA 2B7MA 4KHQA 2OZMA 4FJ9A 3HGKE 2LF3A 3HGLA 1XVGE 2PFVA 4RNGA 4DU3A 3QEPA 4DTSA 4FJLA 2FYOA 3HL8A 2E31A 4J2EA 1MMOG 2HD0A 3SQ2A 4RL5A 3QEXA 1FZ6E 2JH9A 1FZ1E 4FVMA 4FK2A 4AI6A 4DTRA 3SI6A 2B1EA 3L1NA 3SVIA 4FJKA 4M42A 3LZJA 3TAFA 3E4WA 3NDKA 3CFRA 3TAEA 3SPYA 4FJMA 4FJHA 3OGKB 4HCBA 2DY4A 2LF6A 1XMGE 4JS4A 1Q9YA 3SCXA 4FK4A 4DU4A 3SUPA 4KHUA 3QNOA 4JS5A 3RMCA 2VJ5A 4I6JB 3MKSB 1FZ5E 4M3WA 3LZIA 3TABA 4B08A 1Q9XA 3OGMB 2OVPB 4EPHA 1FS1A 3SUOA 4J2AA 2JH8A 3J2PA 4EP9A 4M41A 1P22A 3HP9A 2PFTA 3SQ4A 3NE6A 4M3RA 4M45A 3TJYA 1IH7A 2P1PB 4KHYA 2OVQB 3L8BA 4DTOA 4KHWA 3KD5E 4FJ8A 4AKIA 3QNNA 3C6OB 3SPZA 1XU3E 2JHAA 4X5MA 3C6PB 5H37A 2MMBA 3CFOA 4HCCA 3K2OA 1FZ9E 1XVDE 3S9HA 4FK0A 4I9QA 3CQ8A 2DTUA 4FJ7A 1FZIE 2P5OA 1XVEE 2JHPA 3N1BA 3NCIA 4DTXA 4FJGA 3QESA 3RWUA 3NHGA 1FZ2E 3E4YA 4EYWA 1XVCE 4E3SA 1FZ4E 4FJIA 4DTMA 3WSOA 1XU5E 3N1EA 2P1QB 2VIXA 2MZWB 2JHCA 3RMBA 4M3ZA 1NEXB 4GAMC 4DTUA 3C6NB 3SQ1A 1FZ0E 4DTJA 3SNNA 4KI4A 1CLQA 1FYZE 2DEBA 3TAGA 2OZSA 4E4BA 4JRPA 4DTPA 2B8IA 2OYQA 4KHNA 2JPNA 3QERA 4DU1A 1FZ7E 3SUQA 3LD8A 4KHSA 4X5NA 2P1OB 2VJ4A 3NAEA 1MHZG 1XMFE 3C94A 1WAJA 1IG9A 1FZ8E 3RMDA 3RMAA 4FJNA 4M3YA 5IREA 4J2DA 1FZ3E 2FW3A 3NGIA 3QEVA 4AKHA 3SUNA 4JRQA 4ADOA 3QETA 2YB5A 3SJJA 4M3TA 4DTNA 4KI6A 3J27A 3V7DB 4FJ5A 1XVBE 3QEIA 3CFPA 3L2OB 3UIQA 1LDKE 1MTYG 2P1NB 1FZHE 1FXXA 3OGLB 4QNDA 4ADNA 4FJXA 2P5GA 5IBKB 2ATQA 3LDBA 2E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MZW B;  4ADN A;  4E4B A;  4ADO A;  2YB5 A; 
#chains in the Genus database with same CATH topology
 1MHY G;  3LDS A;  2RCU A;  3C95 A;  4I9L A;  4RG8 A;  3KD1 E;  4FJJ A;  3L0M A;  3TL8 B;  1XMH E;  2QXF A;  1WAF A;  2P1M B;  5IZ7 A;  3QEW A;  4M3X A;  1XL3 C;  2OVR B;  2H4T A;  3SQ0 A;  4J2B A;  1XVF E;  4QNC A;  4AKG A;  4M3U A;  2B7M A;  4KHQ A;  2OZM A;  4FJ9 A;  3HGK E;  2LF3 A;  3HGL A;  1XVG E;  2PFV A;  1FPO A;  4RNG A;  4DU3 A;  3QEP A;  4DTS A;  4FJL A;  2FYO A;  3HL8 A;  2E31 A;  4J2E A;  2JQT A;  1MMO G;  2MW2 A;  2HD0 A;  3SQ2 A;  4RL5 A;  3QEX A;  1FZ6 E;  2JH9 A;  1FZ1 E;  4FVM A;  4FK2 A;  4AI6 A;  2K5S A;  3UO3 A;  4DTR A;  3SI6 A;  2B1E A;  3L1N A;  3SVI A;  4FJK A;  4M42 A;  3LZJ A;  3TAF A;  3E4W A;  3NDK A;  3CFR A;  3TAE A;  3SPY A;  4FJM A;  4FJH A;  3OGK B;  4HCB A;  2DY4 A;  2LF6 A;  1XMG E;  4JS4 A;  1Q9Y A;  3SCX A;  4FK4 A;  4DU4 A;  3SUP A;  2RKH A;  4KHU A;  3QNO A;  4JS5 A;  3RMC A;  2VJ5 A;  4I6J B;  3MKS B;  1FZ5 E;  4M3W A;  3LZI A;  3TAB A;  4B08 A;  1Q9X A;  3OGM B;  2OVP B;  4EPH A;  1FS1 A;  3SUO A;  1N1C A;  4J2A A;  2JH8 A;  3J2P A;  4EP9 A;  4M41 A;  1P22 A;  3HP9 A;  2PFT A;  3SQ4 A;  4ICG C;  3NE6 A;  4M3R A;  4M45 A;  3TJY A;  1IH7 A;  2P1P B;  4KHY A;  2OVQ B;  3L8B A;  4DTO A;  4KHW A;  3KD5 E;  4FJ8 A;  4AKI A;  3UO2 A;  3QNN A;  3C6O B;  3SPZ A;  1XU3 E;  2JHA A;  4X5M A;  3C6P B;  5H37 A;  2MMB A;  3CFO A;  4HCC A;  3K2O A;  1FZ9 E;  1XVD E;  3S9H A;  4FK0 A;  4I9Q A;  3CQ8 A;  2DTU A;  4FJ7 A;  1FZI E;  2P5O A;  1XVE E;  2JHP A;  3N1B A;  3NCI A;  4DTX A;  4FJG A;  3QES A;  3RWU A;  3NHG A;  1FZ2 E;  3E4Y A;  4EYW A;  1XVC E;  4E3S A;  1FZ4 E;  4FJI A;  4DTM A;  3WSO A;  1XU5 E;  3N1E A;  2P1Q B;  2VIX A;  2MZW B;  2JHC A;  3RMB A;  4M3Z A;  1NEX B;  4GAM C;  4DTU A;  3C6N B;  3SQ1 A;  1FZ0 E;  4DTJ A;  3SNN A;  4KI4 A;  1CLQ A;  1FYZ E;  2DEB A;  3TAG A;  2OZS A;  4E4B A;  4JRP A;  4DTP A;  2B8I A;  2OYQ A;  4KHN A;  2JPN A;  4IT5 A;  3QER A;  4DU1 A;  1FZ7 E;  3SUQ A;  3LD8 A;  4KHS A;  4X5N A;  2P1O B;  2VJ4 A;  3NAE A;  1MHZ G;  1XMF E;  3C94 A;  1WAJ A;  1IG9 A;  1FZ8 E;  3RMD A;  3RMA A;  4FJN A;  4M3Y A;  5IRE A;  4J2D A;  1FZ3 E;  2FW3 A;  3NGI A;  3QEV A;  4AKH A;  3SUN A;  4JRQ A;  4ADO A;  3QET A;  2YB5 A;  3SJJ A;  1JW2 A;  4M3T A;  4DTN A;  4KI6 A;  3J27 A;  3V7D B;  4FJ5 A;  1XVB E;  3BVO A;  3QEI A;  3CFP A;  3L2O B;  3UIQ A;  1LDK E;  1MTY G;  2P1N B;  1FZH E;  1FXX A;  3OGL B;  4QND A;  4ADN A;  4FJX A;  2P5G A;  5IBK B;  2ATQ A;  3LDB A;  2E32 A; 
#chains in the Genus database with same CATH homology
 1MHY G;  3LDS A;  2RCU A;  3C95 A;  4I9L A;  4RG8 A;  3KD1 E;  4FJJ A;  3L0M A;  3TL8 B;  1XMH E;  2QXF A;  1WAF A;  2P1M B;  5IZ7 A;  3QEW A;  4M3X A;  1XL3 C;  2OVR B;  2H4T A;  3SQ0 A;  4J2B A;  1XVF E;  4QNC A;  4AKG A;  4M3U A;  2B7M A;  4KHQ A;  2OZM A;  4FJ9 A;  3HGK E;  2LF3 A;  3HGL A;  1XVG E;  2PFV A;  4RNG A;  4DU3 A;  3QEP A;  4DTS A;  4FJL A;  2FYO A;  3HL8 A;  2E31 A;  4J2E A;  1MMO G;  2HD0 A;  3SQ2 A;  4RL5 A;  3QEX A;  1FZ6 E;  2JH9 A;  1FZ1 E;  4FVM A;  4FK2 A;  4AI6 A;  4DTR A;  3SI6 A;  2B1E A;  3L1N A;  3SVI A;  4FJK A;  4M42 A;  3LZJ A;  3TAF A;  3E4W A;  3NDK A;  3CFR A;  3TAE A;  3SPY A;  4FJM A;  4FJH A;  3OGK B;  4HCB A;  2DY4 A;  2LF6 A;  1XMG E;  4JS4 A;  1Q9Y A;  3SCX A;  4FK4 A;  4DU4 A;  3SUP A;  4KHU A;  3QNO A;  4JS5 A;  3RMC A;  2VJ5 A;  4I6J B;  3MKS B;  1FZ5 E;  4M3W A;  3LZI A;  3TAB A;  4B08 A;  1Q9X A;  3OGM B;  2OVP B;  4EPH A;  1FS1 A;  3SUO A;  4J2A A;  2JH8 A;  3J2P A;  4EP9 A;  4M41 A;  1P22 A;  3HP9 A;  2PFT A;  3SQ4 A;  3NE6 A;  4M3R A;  4M45 A;  3TJY A;  1IH7 A;  2P1P B;  4KHY A;  2OVQ B;  3L8B A;  4DTO A;  4KHW A;  3KD5 E;  4FJ8 A;  4AKI A;  3QNN A;  3C6O B;  3SPZ A;  1XU3 E;  2JHA A;  4X5M A;  3C6P B;  5H37 A;  2MMB A;  3CFO A;  4HCC A;  3K2O A;  1FZ9 E;  1XVD E;  3S9H A;  4FK0 A;  4I9Q A;  3CQ8 A;  2DTU A;  4FJ7 A;  1FZI E;  2P5O A;  1XVE E;  2JHP A;  3N1B A;  3NCI A;  4DTX A;  4FJG A;  3QES A;  3RWU A;  3NHG A;  1FZ2 E;  3E4Y A;  4EYW A;  1XVC E;  4E3S A;  1FZ4 E;  4FJI A;  4DTM A;  3WSO A;  1XU5 E;  3N1E A;  2P1Q B;  2VIX A;  2MZW B;  2JHC A;  3RMB A;  4M3Z A;  1NEX B;  4GAM C;  4DTU A;  3C6N B;  3SQ1 A;  1FZ0 E;  4DTJ A;  3SNN A;  4KI4 A;  1CLQ A;  1FYZ E;  2DEB A;  3TAG A;  2OZS A;  4E4B A;  4JRP A;  4DTP A;  2B8I A;  2OYQ A;  4KHN A;  2JPN A;  3QER A;  4DU1 A;  1FZ7 E;  3SUQ A;  3LD8 A;  4KHS A;  4X5N A;  2P1O B;  2VJ4 A;  3NAE A;  1MHZ G;  1XMF E;  3C94 A;  1WAJ A;  1IG9 A;  1FZ8 E;  3RMD A;  3RMA A;  4FJN A;  4M3Y A;  5IRE A;  4J2D A;  1FZ3 E;  2FW3 A;  3NGI A;  3QEV A;  4AKH A;  3SUN A;  4JRQ A;  4ADO A;  3QET A;  2YB5 A;  3SJJ A;  4M3T A;  4DTN A;  4KI6 A;  3J27 A;  3V7D B;  4FJ5 A;  1XVB E;  3QEI A;  3CFP A;  3L2O B;  3UIQ A;  1LDK E;  1MTY G;  2P1N B;  1FZH E;  1FXX A;  3OGL B;  4QND A;  4ADN A;  4FJX A;  2P5G A;  5IBK B;  2ATQ A;  3LDB A;  2E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...