4ADNA

Fusidic acid resistance protein fusb
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
213
structure length
213
Chain Sequence
MKTMIYPHQYNYIRSVILRLKNVYKTVNDKETVKVIQSETYNDINEIFGHIDDDIEESLKVLMNIRLSNKEIEAILNKFLEYVVPFELPSPQKLQKVFKKVKKIKIPQFEEYDLKVSSFVGWNELASNRKYIIYYDEKKQLKGLYGEISNQVVKGFCTICNKESNVSLFMKKSKTNSDGQYVKKGDYICRDSIHCNKQLTDINQFYNFIDKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Fusb: An Elongation Factor G-Binding Fusidic Acid Resistance Protein Active in Ribosomal Translocation and Recycling
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Antibiotic resistance
molecule keywords FAR1
total genus 67
structure length 213
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07299 EF-G-binding_N Elongation factor G-binding protein, N-terminal
A PF16571 FBP_C FBP C-terminal treble-clef zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.250 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4adnA01
4ADNA 4ADOA 2MZWB 4E4BA 2YB5A
chains in the Genus database with same CATH superfamily
4JS5A 3RMCA 4KI4A 4I9QA 3HL8A 4J2AA 4I6JB 2VIXA 3RMDA 4ADOA 2LF6A 4FJ7A 4JS4A 2DTUA 3QEVA 4J2DA 4E4BA 3TAFA 3NE6A 4KHSA 2FW3A 4AKHA 3K2OA 4DTUA 1FZ4E 1MHYG 4M3ZA 1MHZG 2HD0A 4RL5A 4FJKA 4KHUA 1LDKE 4DTNA 3E4YA 3SQ1A 2RKHA 3S9HA 1XVBE 2DEBA 3LZIA 5H37A 4EPHA 3SUQA 3NAEA 3LDBA 1FZ6E 2OZMA 4FJJA 2OYQA 1MTYG 3QNNA 1IG9A 3SCXA 4FJXA 4IT5A 4M3XA 1WAJA 4M3RA 3OGKB 3LD8A 4AKGA 1XL3C 4DTMA 2DY4A 1FS1A 3QERA 2H4TA 4FJ5A 2P1NB 1FZ5E 3CFRA 3LZJA 3QEXA 1FZ0E 2P1MB 3CFOA 2K5SA 4DU4A 3HGKE 2VJ5A 1XVDE 3C95A 4HCBA 5IZ7A 3SVIA 2P5GA 2JH8A 1CLQA 2JH9A 2PFTA 4FVMA 2P1PB 4FK4A 3C94A 2E32A 4GAMC 3SUOA 3QESA 3C6PB 4KI6A 4FJ8A 3TJYA 4DTSA 4X5MA 3L1NA 3UIQA 4M42A 4M3WA 4FK2A 1NEXB 3TAGA 2P1OB 3SJJA 3HGLA 4QNCA 3SUNA 1Q9XA 2B8IA 1XVGE 3KD1E 4DTPA 3UO2A 4EYWA 4DU3A 1FYZE 3L0MA 2OZSA 4FJLA 4KHNA 5IBKB 3QEWA 4AI6A 3RMBA 3SNNA 4M45A 3QEPA 3J27A 4AKIA 2JHCA 3N1BA 2P5OA 1XVFE 4KHWA 3CFPA 3SPZA 4J2EA 3QETA 3HP9A 4ICGC 3TL8B 4JRQA 3MKSB 4DTJA 1XVCE 3SQ2A 3KD5E 3L8BA 3C6OB 3QEIA 3BVOA 1FZ3E 3OGMB 3RWUA 4J2BA 3CQ8A 1Q9YA 2ATQA 2VJ4A 4B08A 1XMFE 2B7MA 3J2PA 1FZ1E 3NHGA 3TABA 3TAEA 3SI6A 1MMOG 1FZ9E 1FZIE 2LF3A 1FZ2E 2JQTA 4I9LA 3SQ4A 1XU5E 2MW2A 4M3YA 1P22A 3E4WA 2YB5A 3WSOA 4DU1A 2PFVA 4FJHA 4ADNA 2JHAA 4HCCA 4FJNA 2FYOA 3L2OB 4QNDA 3SUPA 3V7DB 2QXFA 2OVQB 3SQ0A 4X5NA 3QNOA 3SPYA 2E31A 1XU3E 2RCUA 4DTRA 4KHQA 4M3TA 1IH7A 1FZ7E 4EP9A 1XVEE 3NDKA 1FZ8E 2B1EA 4M3UA 2JPNA 4KHYA 3NCIA 3LDSA 1XMGE 2P1QB 4E3SA 1FPOA 2OVPB 1WAFA 1XMHE 2MMBA 4RG8A 1FZHE 1FXXA 4M41A 2MZWB 3C6NB 3UO3A 4FJMA 2OVRB 2JHPA 4DTXA 4FJIA 4FK0A 3NGIA 4FJ9A 4FJGA 1JW2A 4DTOA 3OGLB 4RNGA 1N1CA 5IREA 3N1EA 4JRPA 3RMAA
chains in the Genus database with same CATH topology
4JS5A 3RMCA 4KI4A 4I9QA 3HL8A 4J2AA 4I6JB 2VIXA 3RMDA 4ADOA 2LF6A 4FJ7A 4JS4A 2DTUA 3QEVA 4J2DA 4E4BA 3TAFA 3NE6A 4KHSA 2FW3A 4AKHA 3K2OA 4DTUA 1FZ4E 1MHYG 4M3ZA 1MHZG 2HD0A 4RL5A 4FJKA 4KHUA 1LDKE 4DTNA 3E4YA 3SQ1A 3S9HA 1XVBE 2DEBA 3LZIA 5H37A 4EPHA 3SUQA 3NAEA 3LDBA 1FZ6E 2OZMA 4FJJA 2OYQA 1MTYG 3QNNA 1IG9A 3SCXA 4FJXA 4M3XA 1WAJA 4M3RA 3OGKB 3LD8A 4AKGA 1XL3C 4DTMA 2DY4A 1FS1A 3QERA 2H4TA 4FJ5A 2P1NB 1FZ5E 3CFRA 3LZJA 3QEXA 1FZ0E 2P1MB 3CFOA 4DU4A 3HGKE 2VJ5A 1XVDE 3C95A 4HCBA 5IZ7A 3SVIA 2P5GA 2JH8A 1CLQA 2JH9A 2PFTA 4FVMA 2P1PB 4FK4A 3C94A 2E32A 4GAMC 3SUOA 3QESA 3C6PB 4KI6A 4FJ8A 3TJYA 4DTSA 4X5MA 3L1NA 3UIQA 4M42A 4M3WA 4FK2A 1NEXB 3TAGA 2P1OB 3SJJA 3HGLA 4QNCA 3SUNA 1Q9XA 2B8IA 1XVGE 3KD1E 4DTPA 4EYWA 4DU3A 1FYZE 3L0MA 2OZSA 4FJLA 4KHNA 5IBKB 3QEWA 4AI6A 3RMBA 3SNNA 4M45A 3QEPA 3J27A 4AKIA 2JHCA 3N1BA 2P5OA 1XVFE 4KHWA 3CFPA 3SPZA 4J2EA 3QETA 3HP9A 3TL8B 3KD5E 4JRQA 3MKSB 4DTJA 1XVCE 3SQ2A 3L8BA 3C6OB 3QEIA 1FZ3E 3OGMB 3RWUA 4J2BA 3CQ8A 1Q9YA 2ATQA 2VJ4A 4B08A 1XMFE 2B7MA 3J2PA 1FZ1E 3NHGA 3TABA 3TAEA 3SI6A 1MMOG 1FZ9E 1FZIE 2LF3A 1FZ2E 4I9LA 3SQ4A 1XU5E 4M3YA 1P22A 3E4WA 2YB5A 3WSOA 4DU1A 2PFVA 4FJHA 4ADNA 2JHAA 4HCCA 4FJNA 2FYOA 3L2OB 4QNDA 3SUPA 3V7DB 2QXFA 2OVQB 3SQ0A 4X5NA 3QNOA 3SPYA 2E31A 1XU3E 2RCUA 4DTRA 4KHQA 4M3TA 1IH7A 1FZ7E 4EP9A 1XVEE 3NDKA 1FZ8E 2B1EA 4M3UA 2JPNA 4KHYA 3NCIA 3LDSA 1XMGE 2P1QB 4E3SA 2OVPB 1WAFA 1XMHE 2MMBA 4RG8A 1FZHE 1FXXA 4M41A 2MZWB 3C6NB 4FJMA 2OVRB 2JHPA 4DTXA 4FJIA 4FK0A 3NGIA 4FJ9A 4FJGA 4DTOA 3OGLB 4RNGA 5IREA 3N1EA 4JRPA 3RMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ADN A;  4ADO A;  2MZW B;  4E4B A;  2YB5 A; 
#chains in the Genus database with same CATH topology
 4JS5 A;  3RMC A;  4KI4 A;  4I9Q A;  3HL8 A;  4J2A A;  4I6J B;  2VIX A;  3RMD A;  4ADO A;  2LF6 A;  4FJ7 A;  4JS4 A;  2DTU A;  3QEV A;  4J2D A;  4E4B A;  3TAF A;  3NE6 A;  4KHS A;  2FW3 A;  4AKH A;  3K2O A;  4DTU A;  1FZ4 E;  1MHY G;  4M3Z A;  1MHZ G;  2HD0 A;  4RL5 A;  4FJK A;  4KHU A;  1LDK E;  4DTN A;  3E4Y A;  3SQ1 A;  2RKH A;  3S9H A;  1XVB E;  2DEB A;  3LZI A;  5H37 A;  4EPH A;  3SUQ A;  3NAE A;  3LDB A;  1FZ6 E;  2OZM A;  4FJJ A;  2OYQ A;  1MTY G;  3QNN A;  1IG9 A;  3SCX A;  4FJX A;  4IT5 A;  4M3X A;  1WAJ A;  4M3R A;  3OGK B;  3LD8 A;  4AKG A;  1XL3 C;  4DTM A;  2DY4 A;  1FS1 A;  3QER A;  2H4T A;  4FJ5 A;  2P1N B;  1FZ5 E;  3CFR A;  3LZJ A;  3QEX A;  1FZ0 E;  2P1M B;  3CFO A;  2K5S A;  4DU4 A;  3HGK E;  2VJ5 A;  1XVD E;  3C95 A;  4HCB A;  5IZ7 A;  3SVI A;  2P5G A;  2JH8 A;  1CLQ A;  2JH9 A;  2PFT A;  4FVM A;  2P1P B;  4FK4 A;  3C94 A;  2E32 A;  4GAM C;  3SUO A;  3QES A;  3C6P B;  4KI6 A;  4FJ8 A;  3TJY A;  4DTS A;  4X5M A;  3L1N A;  3UIQ A;  4M42 A;  4M3W A;  4FK2 A;  1NEX B;  3TAG A;  2P1O B;  3SJJ A;  3HGL A;  4QNC A;  3SUN A;  1Q9X A;  2B8I A;  1XVG E;  3KD1 E;  4DTP A;  3UO2 A;  4EYW A;  4DU3 A;  1FYZ E;  3L0M A;  2OZS A;  4FJL A;  4KHN A;  5IBK B;  3QEW A;  4AI6 A;  3RMB A;  3SNN A;  4M45 A;  3QEP A;  3J27 A;  4AKI A;  2JHC A;  3N1B A;  2P5O A;  1XVF E;  4KHW A;  3CFP A;  3SPZ A;  4J2E A;  3QET A;  3HP9 A;  4ICG C;  3TL8 B;  4JRQ A;  3MKS B;  4DTJ A;  1XVC E;  3SQ2 A;  3KD5 E;  3L8B A;  3C6O B;  3QEI A;  3BVO A;  1FZ3 E;  3OGM B;  3RWU A;  4J2B A;  3CQ8 A;  1Q9Y A;  2ATQ A;  2VJ4 A;  4B08 A;  1XMF E;  2B7M A;  3J2P A;  1FZ1 E;  3NHG A;  3TAB A;  3TAE A;  3SI6 A;  1MMO G;  1FZ9 E;  1FZI E;  2LF3 A;  1FZ2 E;  2JQT A;  4I9L A;  3SQ4 A;  1XU5 E;  2MW2 A;  4M3Y A;  1P22 A;  3E4W A;  2YB5 A;  3WSO A;  4DU1 A;  2PFV A;  4FJH A;  4ADN A;  2JHA A;  4HCC A;  4FJN A;  2FYO A;  3L2O B;  4QND A;  3SUP A;  3V7D B;  2QXF A;  2OVQ B;  3SQ0 A;  4X5N A;  3QNO A;  3SPY A;  2E31 A;  1XU3 E;  2RCU A;  4DTR A;  4KHQ A;  4M3T A;  1IH7 A;  1FZ7 E;  4EP9 A;  1XVE E;  3NDK A;  1FZ8 E;  2B1E A;  4M3U A;  2JPN A;  4KHY A;  3NCI A;  3LDS A;  1XMG E;  2P1Q B;  4E3S A;  1FPO A;  2OVP B;  1WAF A;  1XMH E;  2MMB A;  4RG8 A;  1FZH E;  1FXX A;  4M41 A;  2MZW B;  3C6N B;  3UO3 A;  4FJM A;  2OVR B;  2JHP A;  4DTX A;  4FJI A;  4FK0 A;  3NGI A;  4FJ9 A;  4FJG A;  1JW2 A;  4DTO A;  3OGL B;  4RNG A;  1N1C A;  5IRE A;  3N1E A;  4JRP A;  3RMA A; 
#chains in the Genus database with same CATH homology
 4JS5 A;  3RMC A;  4KI4 A;  4I9Q A;  3HL8 A;  4J2A A;  4I6J B;  2VIX A;  3RMD A;  4ADO A;  2LF6 A;  4FJ7 A;  4JS4 A;  2DTU A;  3QEV A;  4J2D A;  4E4B A;  3TAF A;  3NE6 A;  4KHS A;  2FW3 A;  4AKH A;  3K2O A;  4DTU A;  1FZ4 E;  1MHY G;  4M3Z A;  1MHZ G;  2HD0 A;  4RL5 A;  4FJK A;  4KHU A;  1LDK E;  4DTN A;  3E4Y A;  3SQ1 A;  3S9H A;  1XVB E;  2DEB A;  3LZI A;  5H37 A;  4EPH A;  3SUQ A;  3NAE A;  3LDB A;  1FZ6 E;  2OZM A;  4FJJ A;  2OYQ A;  1MTY G;  3QNN A;  1IG9 A;  3SCX A;  4FJX A;  4M3X A;  1WAJ A;  4M3R A;  3OGK B;  3LD8 A;  4AKG A;  1XL3 C;  4DTM A;  2DY4 A;  1FS1 A;  3QER A;  2H4T A;  4FJ5 A;  2P1N B;  1FZ5 E;  3CFR A;  3LZJ A;  3QEX A;  1FZ0 E;  2P1M B;  3CFO A;  4DU4 A;  3HGK E;  2VJ5 A;  1XVD E;  3C95 A;  4HCB A;  5IZ7 A;  3SVI A;  2P5G A;  2JH8 A;  1CLQ A;  2JH9 A;  2PFT A;  4FVM A;  2P1P B;  4FK4 A;  3C94 A;  2E32 A;  4GAM C;  3SUO A;  3QES A;  3C6P B;  4KI6 A;  4FJ8 A;  3TJY A;  4DTS A;  4X5M A;  3L1N A;  3UIQ A;  4M42 A;  4M3W A;  4FK2 A;  1NEX B;  3TAG A;  2P1O B;  3SJJ A;  3HGL A;  4QNC A;  3SUN A;  1Q9X A;  2B8I A;  1XVG E;  3KD1 E;  4DTP A;  4EYW A;  4DU3 A;  1FYZ E;  3L0M A;  2OZS A;  4FJL A;  4KHN A;  5IBK B;  3QEW A;  4AI6 A;  3RMB A;  3SNN A;  4M45 A;  3QEP A;  3J27 A;  4AKI A;  2JHC A;  3N1B A;  2P5O A;  1XVF E;  4KHW A;  3CFP A;  3SPZ A;  4J2E A;  3QET A;  3HP9 A;  3TL8 B;  3KD5 E;  4JRQ A;  3MKS B;  4DTJ A;  1XVC E;  3SQ2 A;  3L8B A;  3C6O B;  3QEI A;  1FZ3 E;  3OGM B;  3RWU A;  4J2B A;  3CQ8 A;  1Q9Y A;  2ATQ A;  2VJ4 A;  4B08 A;  1XMF E;  2B7M A;  3J2P A;  1FZ1 E;  3NHG A;  3TAB A;  3TAE A;  3SI6 A;  1MMO G;  1FZ9 E;  1FZI E;  2LF3 A;  1FZ2 E;  4I9L A;  3SQ4 A;  1XU5 E;  4M3Y A;  1P22 A;  3E4W A;  2YB5 A;  3WSO A;  4DU1 A;  2PFV A;  4FJH A;  4ADN A;  2JHA A;  4HCC A;  4FJN A;  2FYO A;  3L2O B;  4QND A;  3SUP A;  3V7D B;  2QXF A;  2OVQ B;  3SQ0 A;  4X5N A;  3QNO A;  3SPY A;  2E31 A;  1XU3 E;  2RCU A;  4DTR A;  4KHQ A;  4M3T A;  1IH7 A;  1FZ7 E;  4EP9 A;  1XVE E;  3NDK A;  1FZ8 E;  2B1E A;  4M3U A;  2JPN A;  4KHY A;  3NCI A;  3LDS A;  1XMG E;  2P1Q B;  4E3S A;  2OVP B;  1WAF A;  1XMH E;  2MMB A;  4RG8 A;  1FZH E;  1FXX A;  4M41 A;  2MZW B;  3C6N B;  4FJM A;  2OVR B;  2JHP A;  4DTX A;  4FJI A;  4FK0 A;  3NGI A;  4FJ9 A;  4FJG A;  4DTO A;  3OGL B;  4RNG A;  5IRE A;  3N1E A;  4JRP A;  3RMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...