2B8IA

Crystal structure and functional studies reveal that pas factor from vibrio vulnificus is a novel member of the saposin-fold family
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
IRPYMKALIYETLVNLANQDPEQHATIRQNLYEQLDLPFDKQLALYAGALGPASSGKLENHEAISNAVDSVVQLLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAS factor
publication title Crystal structure and functional studies reveal that PAS factor from Vibrio vulnificus is a novel member of the saposin-fold family
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Lipid binding protein
total genus 27
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.100 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2b8iA00
2B8IA
chains in the Genus database with same CATH superfamily
3SQ0A 4EP9A 4FJGA 3OGLB 3SUNA 4HCCA 3UO2A 4DTNA 3HGKE 3SQ4A 1XU3E 1JW2A 3LZIA 2LF3A 3QNNA 3WSOA 3QEXA 4JRPA 4M45A 1P22A 2K5SA 2QXFA 3BVOA 3C95A 1XMGE 3OGMB 4M3XA 3V7DB 2OZMA 3RMDA 1IH7A 2P1OB 2OYQA 5IREA 4KHUA 4M3YA 1WAFA 3QETA 3QERA 3TAFA 4FJIA 2OVQB 4HCBA 3RMCA 2P5OA 1FZ0E 3SNNA 4M3ZA 2P1PB 3C6NB 1CLQA 3SPZA 3SUQA 3SJJA 4KHYA 2JPNA 4FK2A 2JH9A 4I6JB 4FJNA 3OGKB 2P1QB 3NDKA 1XVBE 4DU3A 4DTOA 4FJKA 1Q9XA 3NGIA 1FZ7E 2HD0A 4M3UA 2H4TA 4M41A 3TL8B 3QEWA 3L2OB 4FJ5A 2DEBA 4DTJA 2MW2A 3TAEA 3SI6A 5H37A 1MHZG 3QNOA 3SCXA 3CFPA 4AKGA 2P1NB 1FZ2E 4DU4A 4FJHA 1N1CA 3SQ2A 3TAGA 4RG8A 4FVMA 4FJLA 4KI6A 4ADNA 4DTPA 2MMBA 1FZ8E 4B08A 1FZ6E 3TJYA 1MMOG 3E4YA 2VJ5A 3C94A 5IBKB 4FK0A 4X5MA 3NCIA 3LD8A 2DY4A 4QNDA 3MKSB 3QESA 2OVRB 4DU1A 4M3RA 3L1NA 2E32A 3TABA 3QEIA 3SUPA 1FZ5E 4FJXA 3N1EA 1Q9YA 1FZ9E 3HP9A 1XMFE 3J2PA 4AKIA 4J2DA 3L0MA 4AKHA 4E3SA 4IT5A 5IZ7A 2E31A 4RNGA 1FPOA 2JHPA 4DTRA 3SUOA 4FJJA 4GAMC 4J2EA 4M3WA 3L8BA 3LZJA 4JS5A 1WAJA 1XVFE 2PFTA 3RWUA 1XVDE 3NE6A 2RCUA 2VJ4A 4E4BA 3CQ8A 3KD5E 1FYZE 1MHYG 1FZIE 1FXXA 4JRQA 4J2BA 1NEXB 3NHGA 1FS1A 3E4WA 3SQ1A 4FJ7A 4M42A 2YB5A 4FJMA 1XL3C 4KHNA 1IG9A 1LDKE 3SPYA 4DTXA 3C6OB 4I9LA 4KHSA 2JH8A 4I9QA 2ATQA 3CFRA 2B1EA 4RL5A 2FW3A 1XMHE 2PFVA 1MTYG 3SVIA 4KHQA 4AI6A 4DTSA 1FZ4E 2B8IA 2MZWB 2OZSA 4ICGC 4M3TA 4ADOA 3RMBA 3KD1E 4FK4A 2JHAA 1FZ1E 3NAEA 4JS4A 3LDBA 4EYWA 1XVCE 2JQTA 2OVPB 1XVGE 2JHCA 4DTUA 3QEPA 3HGLA 4QNCA 2LF6A 3HL8A 3K2OA 2DTUA 1FZHE 1XVEE 3CFOA 3J27A 4EPHA 2P5GA 3UIQA 4FJ9A 4KI4A 4J2AA 4KHWA 1FZ3E 3C6PB 3LDSA 3S9HA 2FYOA 2B7MA 4DTMA 3RMAA 3QEVA 4FJ8A 4X5NA 2P1MB 2VIXA 3UO3A 1XU5E 2RKHA 3N1BA
chains in the Genus database with same CATH topology
3SQ0A 4EP9A 4FJGA 3OGLB 3SUNA 4HCCA 4DTNA 3HGKE 3SQ4A 1XU3E 3LZIA 2LF3A 3QNNA 3WSOA 3QEXA 4JRPA 4M45A 1P22A 2QXFA 3C95A 4M3XA 1XMGE 3OGMB 3V7DB 2OZMA 3RMDA 1IH7A 2P1OB 2OYQA 5IREA 4KHUA 4M3YA 1WAFA 3QETA 3QERA 3TAFA 4FJIA 2OVQB 4HCBA 3RMCA 2P5OA 1FZ0E 3SNNA 4M3ZA 2P1PB 3C6NB 1CLQA 3SPZA 3SUQA 3SJJA 4KHYA 2JPNA 4FK2A 2JH9A 4I6JB 4FJNA 3OGKB 2P1QB 3NDKA 1XVBE 4DU3A 4DTOA 4FJKA 1Q9XA 3NGIA 1FZ7E 2HD0A 4M3UA 2H4TA 4M41A 3TL8B 3QEWA 3L2OB 4FJ5A 2DEBA 4DTJA 3TAEA 3SI6A 5H37A 1MHZG 3QNOA 3SCXA 3CFPA 4AKGA 2P1NB 1FZ2E 4DU4A 4FJHA 3SQ2A 3TAGA 4RG8A 4FVMA 4FJLA 4KI6A 4ADNA 4DTPA 2MMBA 1FZ8E 4B08A 1FZ6E 3TJYA 1MMOG 3E4YA 2VJ5A 3C94A 5IBKB 4FK0A 4X5MA 3NCIA 3LD8A 2DY4A 4QNDA 3MKSB 3QESA 2OVRB 4DU1A 4M3RA 3L1NA 2E32A 3TABA 3QEIA 3SUPA 1FZ5E 4FJXA 3N1EA 1Q9YA 1FZ9E 3HP9A 1XMFE 3J2PA 4AKIA 4J2DA 3L0MA 4AKHA 4E3SA 5IZ7A 2E31A 4RNGA 2JHPA 3SUOA 4DTRA 4FJJA 4GAMC 4J2EA 4M3WA 3L8BA 3LZJA 4JS5A 1WAJA 1XVFE 2PFTA 3RWUA 1XVDE 3NE6A 2RCUA 2VJ4A 4E4BA 3CQ8A 3KD5E 1FYZE 1MHYG 1FZIE 1FXXA 4JRQA 4J2BA 1NEXB 3NHGA 1FS1A 3E4WA 3SQ1A 4FJ7A 4M42A 2YB5A 4FJMA 1XL3C 4KHNA 1IG9A 1LDKE 3SPYA 4DTXA 3C6OB 4I9LA 4KHSA 2JH8A 4I9QA 2ATQA 3CFRA 2B1EA 4RL5A 2FW3A 1XMHE 2PFVA 1MTYG 3SVIA 4KHQA 4AI6A 4DTSA 1FZ4E 2B8IA 2MZWB 2OZSA 4M3TA 4ADOA 3RMBA 3KD1E 4FK4A 2JHAA 1FZ1E 3NAEA 4JS4A 3LDBA 4EYWA 1XVCE 2OVPB 1XVGE 2JHCA 4DTUA 3QEPA 3HGLA 4QNCA 2LF6A 3HL8A 3K2OA 2DTUA 1FZHE 1XVEE 3CFOA 3J27A 4EPHA 2P5GA 3UIQA 4FJ9A 4KI4A 4J2AA 4KHWA 1FZ3E 3C6PB 3LDSA 3S9HA 2FYOA 2B7MA 4DTMA 3RMAA 3QEVA 4FJ8A 4X5NA 2P1MB 2VIXA 1XU5E 3N1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8I A; 
#chains in the Genus database with same CATH topology
 3SQ0 A;  4EP9 A;  4FJG A;  3OGL B;  3SUN A;  4HCC A;  3UO2 A;  4DTN A;  3HGK E;  3SQ4 A;  1XU3 E;  1JW2 A;  3LZI A;  2LF3 A;  3QNN A;  3WSO A;  3QEX A;  4JRP A;  4M45 A;  1P22 A;  2K5S A;  2QXF A;  3BVO A;  3C95 A;  1XMG E;  3OGM B;  4M3X A;  3V7D B;  2OZM A;  3RMD A;  1IH7 A;  2P1O B;  2OYQ A;  5IRE A;  4KHU A;  4M3Y A;  1WAF A;  3QET A;  3QER A;  3TAF A;  4FJI A;  2OVQ B;  4HCB A;  3RMC A;  2P5O A;  1FZ0 E;  3SNN A;  4M3Z A;  2P1P B;  3C6N B;  1CLQ A;  3SPZ A;  3SUQ A;  3SJJ A;  4KHY A;  2JPN A;  4FK2 A;  2JH9 A;  4I6J B;  4FJN A;  3OGK B;  2P1Q B;  3NDK A;  1XVB E;  4DU3 A;  4DTO A;  4FJK A;  1Q9X A;  3NGI A;  1FZ7 E;  2HD0 A;  4M3U A;  2H4T A;  4M41 A;  3TL8 B;  3QEW A;  3L2O B;  4FJ5 A;  2DEB A;  4DTJ A;  2MW2 A;  3TAE A;  3SI6 A;  5H37 A;  1MHZ G;  3QNO A;  3SCX A;  3CFP A;  4AKG A;  2P1N B;  1FZ2 E;  4DU4 A;  4FJH A;  1N1C A;  3SQ2 A;  3TAG A;  4RG8 A;  4FVM A;  4FJL A;  4KI6 A;  4ADN A;  4DTP A;  2MMB A;  1FZ8 E;  4B08 A;  1FZ6 E;  3TJY A;  1MMO G;  3E4Y A;  2VJ5 A;  3C94 A;  5IBK B;  4FK0 A;  4X5M A;  3NCI A;  3LD8 A;  2DY4 A;  4QND A;  3MKS B;  3QES A;  2OVR B;  4DU1 A;  4M3R A;  3L1N A;  2E32 A;  3TAB A;  3QEI A;  3SUP A;  1FZ5 E;  4FJX A;  3N1E A;  1Q9Y A;  1FZ9 E;  3HP9 A;  1XMF E;  3J2P A;  4AKI A;  4J2D A;  3L0M A;  4AKH A;  4E3S A;  4IT5 A;  5IZ7 A;  2E31 A;  4RNG A;  1FPO A;  2JHP A;  4DTR A;  3SUO A;  4FJJ A;  4GAM C;  4J2E A;  4M3W A;  3L8B A;  3LZJ A;  4JS5 A;  1WAJ A;  1XVF E;  2PFT A;  3RWU A;  1XVD E;  3NE6 A;  2RCU A;  2VJ4 A;  4E4B A;  3CQ8 A;  3KD5 E;  1FYZ E;  1MHY G;  1FZI E;  1FXX A;  4JRQ A;  4J2B A;  1NEX B;  3NHG A;  1FS1 A;  3E4W A;  3SQ1 A;  4FJ7 A;  4M42 A;  2YB5 A;  4FJM A;  1XL3 C;  4KHN A;  1IG9 A;  1LDK E;  3SPY A;  4DTX A;  3C6O B;  4I9L A;  4KHS A;  2JH8 A;  4I9Q A;  2ATQ A;  3CFR A;  2B1E A;  4RL5 A;  2FW3 A;  1XMH E;  2PFV A;  1MTY G;  3SVI A;  4KHQ A;  4AI6 A;  4DTS A;  1FZ4 E;  2B8I A;  2MZW B;  2OZS A;  4ICG C;  4M3T A;  4ADO A;  3RMB A;  3KD1 E;  4FK4 A;  2JHA A;  1FZ1 E;  3NAE A;  4JS4 A;  3LDB A;  4EYW A;  1XVC E;  2JQT A;  2OVP B;  1XVG E;  2JHC A;  4DTU A;  3QEP A;  3HGL A;  4QNC A;  2LF6 A;  3HL8 A;  3K2O A;  2DTU A;  1FZH E;  1XVE E;  3CFO A;  3J27 A;  4EPH A;  2P5G A;  3UIQ A;  4FJ9 A;  4KI4 A;  4J2A A;  4KHW A;  1FZ3 E;  3C6P B;  3LDS A;  3S9H A;  2FYO A;  2B7M A;  4DTM A;  3RMA A;  3QEV A;  4FJ8 A;  4X5N A;  2P1M B;  2VIX A;  3UO3 A;  1XU5 E;  2RKH A;  3N1B A; 
#chains in the Genus database with same CATH homology
 3SQ0 A;  4EP9 A;  4FJG A;  3OGL B;  3SUN A;  4HCC A;  4DTN A;  3HGK E;  3SQ4 A;  1XU3 E;  3LZI A;  2LF3 A;  3QNN A;  3WSO A;  3QEX A;  4JRP A;  4M45 A;  1P22 A;  2QXF A;  3C95 A;  4M3X A;  1XMG E;  3OGM B;  3V7D B;  2OZM A;  3RMD A;  1IH7 A;  2P1O B;  2OYQ A;  5IRE A;  4KHU A;  4M3Y A;  1WAF A;  3QET A;  3QER A;  3TAF A;  4FJI A;  2OVQ B;  4HCB A;  3RMC A;  2P5O A;  1FZ0 E;  3SNN A;  4M3Z A;  2P1P B;  3C6N B;  1CLQ A;  3SPZ A;  3SUQ A;  3SJJ A;  4KHY A;  2JPN A;  4FK2 A;  2JH9 A;  4I6J B;  4FJN A;  3OGK B;  2P1Q B;  3NDK A;  1XVB E;  4DU3 A;  4DTO A;  4FJK A;  1Q9X A;  3NGI A;  1FZ7 E;  2HD0 A;  4M3U A;  2H4T A;  4M41 A;  3TL8 B;  3QEW A;  3L2O B;  4FJ5 A;  2DEB A;  4DTJ A;  3TAE A;  3SI6 A;  5H37 A;  1MHZ G;  3QNO A;  3SCX A;  3CFP A;  4AKG A;  2P1N B;  1FZ2 E;  4DU4 A;  4FJH A;  3SQ2 A;  3TAG A;  4RG8 A;  4FVM A;  4FJL A;  4KI6 A;  4ADN A;  4DTP A;  2MMB A;  1FZ8 E;  4B08 A;  1FZ6 E;  3TJY A;  1MMO G;  3E4Y A;  2VJ5 A;  3C94 A;  5IBK B;  4FK0 A;  4X5M A;  3NCI A;  3LD8 A;  2DY4 A;  4QND A;  3MKS B;  3QES A;  2OVR B;  4DU1 A;  4M3R A;  3L1N A;  2E32 A;  3TAB A;  3QEI A;  3SUP A;  1FZ5 E;  4FJX A;  3N1E A;  1Q9Y A;  1FZ9 E;  3HP9 A;  1XMF E;  3J2P A;  4AKI A;  4J2D A;  3L0M A;  4AKH A;  4E3S A;  5IZ7 A;  2E31 A;  4RNG A;  2JHP A;  3SUO A;  4DTR A;  4FJJ A;  4GAM C;  4J2E A;  4M3W A;  3L8B A;  3LZJ A;  4JS5 A;  1WAJ A;  1XVF E;  2PFT A;  3RWU A;  1XVD E;  3NE6 A;  2RCU A;  2VJ4 A;  4E4B A;  3CQ8 A;  3KD5 E;  1FYZ E;  1MHY G;  1FZI E;  1FXX A;  4JRQ A;  4J2B A;  1NEX B;  3NHG A;  1FS1 A;  3E4W A;  3SQ1 A;  4FJ7 A;  4M42 A;  2YB5 A;  4FJM A;  1XL3 C;  4KHN A;  1IG9 A;  1LDK E;  3SPY A;  4DTX A;  3C6O B;  4I9L A;  4KHS A;  2JH8 A;  4I9Q A;  2ATQ A;  3CFR A;  2B1E A;  4RL5 A;  2FW3 A;  1XMH E;  2PFV A;  1MTY G;  3SVI A;  4KHQ A;  4AI6 A;  4DTS A;  1FZ4 E;  2B8I A;  2MZW B;  2OZS A;  4M3T A;  4ADO A;  3RMB A;  3KD1 E;  4FK4 A;  2JHA A;  1FZ1 E;  3NAE A;  4JS4 A;  3LDB A;  4EYW A;  1XVC E;  2OVP B;  1XVG E;  2JHC A;  4DTU A;  3QEP A;  3HGL A;  4QNC A;  2LF6 A;  3HL8 A;  3K2O A;  2DTU A;  1FZH E;  1XVE E;  3CFO A;  3J27 A;  4EPH A;  2P5G A;  3UIQ A;  4FJ9 A;  4KI4 A;  4J2A A;  4KHW A;  1FZ3 E;  3C6P B;  3LDS A;  3S9H A;  2FYO A;  2B7M A;  4DTM A;  3RMA A;  3QEV A;  4FJ8 A;  4X5N A;  2P1M B;  2VIX A;  1XU5 E;  3N1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...