2B8IA

Crystal structure and functional studies reveal that pas factor from vibrio vulnificus is a novel member of the saposin-fold family
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
IRPYMKALIYETLVNLANQDPEQHATIRQNLYEQLDLPFDKQLALYAGALGPASSGKLENHEAISNAVDSVVQLLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and functional studies reveal that PAS factor from Vibrio vulnificus is a novel member of the saposin-fold family
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Lipid binding protein
molecule keywords PAS factor
total genus 27
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.100 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2b8iA00
2B8IA
chains in the Genus database with same CATH superfamily
4M3ZA 2OVPB 3UO3A 1XMHE 3LD8A 3L8BA 3SQ4A 1FZ2E 4HCBA 2OVQB 3C6NB 4FJIA 4I9QA 1FXXA 1XMFE 4KHWA 3CFOA 3SI6A 3C95A 4DTMA 4I6JB 3NAEA 4DU3A 2QXFA 3QEVA 3SPYA 1MHZG 1MMOG 4X5NA 1FZ5E 4DTXA 2P1QB 3E4YA 1IG9A 1IH7A 3SQ1A 1XVBE 3TAEA 4M3UA 1LDKE 2MW2A 3CFPA 2P5GA 3V7DB 4QNCA 3NHGA 2OYQA 3QNNA 2VJ5A 1XVFE 1XVDE 2B8IA 2MZWB 1FZ3E 4FJ7A 1MTYG 1FPOA 2LF6A 2YB5A 4X5MA 4ADOA 4KHYA 4DTRA 3C94A 4M41A 1FZ0E 4JRQA 3SUOA 4FJ5A 4RG8A 4KI4A 1XL3C 4AI6A 3E4WA 3C6OB 4FJKA 3QERA 4M45A 4DU1A 4EP9A 1FZ4E 1XMGE 1XVGE 1P22A 2DEBA 4B08A 4J2EA 4IT5A 4M3TA 2VIXA 3RMCA 3SPZA 3RMBA 4FJHA 3TJYA 2P5OA 3LZIA 3KD1E 3QEWA 4RNGA 1FZ6E 2JHAA 3C6PB 4FK2A 1CLQA 4FVMA 4M42A 2PFVA 4GAMC 4DTOA 2H4TA 3SUPA 3QESA 3TAGA 2JPNA 2K5SA 4FJNA 4AKIA 4E4BA 4M3RA 4J2AA 1XU3E 1FZHE 1XVEE 4DTNA 4FJXA 4FJJA 4FK0A 3OGLB 3SUQA 4QNDA 3HGLA 3SVIA 5IREA 3QETA 3HP9A 4KHUA 3K2OA 4FJ9A 3TL8B 3RMDA 4ADNA 3QNOA 1XVCE 1FZ8E 2JQTA 4KHNA 2RKHA 4M3YA 1NEXB 1XU5E 2P1PB 4KHSA 3N1EA 1FS1A 2LF3A 4ICGC 2JHCA 3QEPA 4J2DA 3L0MA 1FZ1E 2B1EA 4FK4A 4AKHA 3TAFA 3OGMB 3HL8A 2OVRB 2JH8A 3MKSB 2OZMA 2HD0A 2VJ4A 3NE6A 3UIQA 3WSOA 2E31A 2ATQA 3CQ8A 3QEIA 3TABA 4M3XA 4EYWA 5H37A 2JHPA 4FJGA 4DTPA 5IZ7A 3SJJA 4FJMA 2JH9A 3QEXA 4KHQA 1JW2A 3LZJA 3SQ2A 2DY4A 3HGKE 3J2PA 3SCXA 3KD5E 1FYZE 1N1CA 4FJLA 3L2OB 3LDSA 4HCCA 2PFTA 1WAJA 2FYOA 3NGIA 3J27A 1MHYG 4DTUA 4FJ8A 3RMAA 2P1MB 4JS4A 2DTUA 4JRPA 4EPHA 3NCIA 3L1NA 3S9HA 3RWUA 4I9LA 2RCUA 4AKGA 1FZ7E 3CFRA 4RL5A 3LDBA 2P1NB 4KI6A 4DU4A 5IBKB 3BVOA 2MMBA 1FZ9E 1FZIE 3SUNA 3N1BA 2FW3A 4DTJA 4J2BA 4E3SA 2OZSA 2B7MA 1Q9YA 1WAFA 2E32A 3UO2A 3NDKA 3OGKB 4JS5A 3SNNA 1Q9XA 4M3WA 2P1OB 4DTSA 3SQ0A
chains in the Genus database with same CATH topology
4M3ZA 2OVPB 1XMHE 3LD8A 3L8BA 3SQ4A 1FZ2E 4HCBA 2OVQB 3C6NB 4FJIA 4I9QA 1FXXA 1XMFE 4KHWA 3CFOA 3SI6A 3C95A 4DTMA 4I6JB 3NAEA 4DU3A 2QXFA 3QEVA 3SPYA 1MHZG 1MMOG 4X5NA 1FZ5E 4DTXA 2P1QB 3E4YA 1IG9A 1IH7A 3SQ1A 1XVBE 3TAEA 4M3UA 1LDKE 2P5GA 3CFPA 3V7DB 4QNCA 3NHGA 2OYQA 3QNNA 2VJ5A 1XVFE 1XVDE 2B8IA 2MZWB 1FZ3E 4FJ7A 1MTYG 2LF6A 2YB5A 4X5MA 4ADOA 4KHYA 4DTRA 3C94A 4M41A 1FZ0E 4JRQA 3SUOA 4FJ5A 4RG8A 4KI4A 1XL3C 4AI6A 3E4WA 3C6OB 4FJKA 3QERA 4M45A 4DU1A 4EP9A 1FZ4E 1XMGE 1XVGE 1P22A 2DEBA 4B08A 4J2EA 4M3TA 2VIXA 3RMCA 3SPZA 3RMBA 4FJHA 3TJYA 2P5OA 3LZIA 3KD1E 3QEWA 4RNGA 1FZ6E 2JHAA 3C6PB 4FK2A 1CLQA 4FVMA 4M42A 2PFVA 4GAMC 4DTOA 2H4TA 3SUPA 3QESA 3TAGA 2JPNA 4FJNA 4AKIA 4E4BA 4M3RA 4J2AA 1XU3E 1FZHE 1XVEE 4DTNA 4FJXA 4FJJA 4FK0A 3OGLB 3SUQA 4QNDA 3HGLA 3SVIA 5IREA 3QETA 3HP9A 4KHUA 3K2OA 4FJ9A 3TL8B 3RMDA 4ADNA 3QNOA 1XVCE 1FZ8E 4KHNA 4M3YA 1NEXB 1XU5E 2P1PB 4KHSA 3N1EA 1FS1A 2LF3A 2JHCA 3QEPA 4J2DA 3L0MA 1FZ1E 2B1EA 4FK4A 4AKHA 3TAFA 3OGMB 3HL8A 2OVRB 2JH8A 3MKSB 2OZMA 2HD0A 2VJ4A 3NE6A 3UIQA 3WSOA 2E31A 2ATQA 3CQ8A 3QEIA 3TABA 4M3XA 4EYWA 5H37A 2JHPA 4FJGA 4DTPA 5IZ7A 3SJJA 4FJMA 2JH9A 3QEXA 4KHQA 3LZJA 3SQ2A 2DY4A 3HGKE 3J2PA 3SCXA 3KD5E 1FYZE 4FJLA 3L2OB 3LDSA 4HCCA 2PFTA 1WAJA 2FYOA 3NGIA 3J27A 1MHYG 4DTUA 4FJ8A 3RMAA 2P1MB 4JS4A 2DTUA 4JRPA 4EPHA 3NCIA 3L1NA 3S9HA 3RWUA 4I9LA 2RCUA 4AKGA 1FZ7E 3CFRA 4RL5A 3LDBA 2P1NB 4KI6A 4DU4A 5IBKB 2MMBA 1FZ9E 1FZIE 3SUNA 3N1BA 2FW3A 4DTJA 4J2BA 4E3SA 2OZSA 2B7MA 1Q9YA 1WAFA 2E32A 3NDKA 3OGKB 4JS5A 3SNNA 1Q9XA 4M3WA 2P1OB 4DTSA 3SQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8I A; 
#chains in the Genus database with same CATH topology
 4M3Z A;  2OVP B;  3UO3 A;  1XMH E;  3LD8 A;  3L8B A;  3SQ4 A;  1FZ2 E;  4HCB A;  2OVQ B;  3C6N B;  4FJI A;  4I9Q A;  1FXX A;  1XMF E;  4KHW A;  3CFO A;  3SI6 A;  3C95 A;  4DTM A;  4I6J B;  3NAE A;  4DU3 A;  2QXF A;  3QEV A;  3SPY A;  1MHZ G;  1MMO G;  4X5N A;  1FZ5 E;  4DTX A;  2P1Q B;  3E4Y A;  1IG9 A;  1IH7 A;  3SQ1 A;  1XVB E;  3TAE A;  4M3U A;  1LDK E;  2MW2 A;  3CFP A;  2P5G A;  3V7D B;  4QNC A;  3NHG A;  2OYQ A;  3QNN A;  2VJ5 A;  1XVF E;  1XVD E;  2B8I A;  2MZW B;  1FZ3 E;  4FJ7 A;  1MTY G;  1FPO A;  2LF6 A;  2YB5 A;  4X5M A;  4ADO A;  4KHY A;  4DTR A;  3C94 A;  4M41 A;  1FZ0 E;  4JRQ A;  3SUO A;  4FJ5 A;  4RG8 A;  4KI4 A;  1XL3 C;  4AI6 A;  3E4W A;  3C6O B;  4FJK A;  3QER A;  4M45 A;  4DU1 A;  4EP9 A;  1FZ4 E;  1XMG E;  1XVG E;  1P22 A;  2DEB A;  4B08 A;  4J2E A;  4IT5 A;  4M3T A;  2VIX A;  3RMC A;  3SPZ A;  3RMB A;  4FJH A;  3TJY A;  2P5O A;  3LZI A;  3KD1 E;  3QEW A;  4RNG A;  1FZ6 E;  2JHA A;  3C6P B;  4FK2 A;  1CLQ A;  4FVM A;  4M42 A;  2PFV A;  4GAM C;  4DTO A;  2H4T A;  3SUP A;  3QES A;  3TAG A;  2JPN A;  2K5S A;  4FJN A;  4AKI A;  4E4B A;  4M3R A;  4J2A A;  1XU3 E;  1FZH E;  1XVE E;  4DTN A;  4FJX A;  4FJJ A;  4FK0 A;  3OGL B;  3SUQ A;  4QND A;  3HGL A;  3SVI A;  5IRE A;  3QET A;  3HP9 A;  4KHU A;  3K2O A;  4FJ9 A;  3TL8 B;  3RMD A;  4ADN A;  3QNO A;  1XVC E;  1FZ8 E;  2JQT A;  4KHN A;  2RKH A;  4M3Y A;  1NEX B;  1XU5 E;  2P1P B;  4KHS A;  3N1E A;  1FS1 A;  2LF3 A;  4ICG C;  2JHC A;  3QEP A;  4J2D A;  3L0M A;  1FZ1 E;  2B1E A;  4FK4 A;  4AKH A;  3TAF A;  3OGM B;  3HL8 A;  2OVR B;  2JH8 A;  3MKS B;  2OZM A;  2HD0 A;  2VJ4 A;  3NE6 A;  3UIQ A;  3WSO A;  2E31 A;  2ATQ A;  3CQ8 A;  3QEI A;  3TAB A;  4M3X A;  4EYW A;  5H37 A;  2JHP A;  4FJG A;  4DTP A;  5IZ7 A;  3SJJ A;  4FJM A;  2JH9 A;  3QEX A;  4KHQ A;  1JW2 A;  3LZJ A;  3SQ2 A;  2DY4 A;  3HGK E;  3J2P A;  3SCX A;  3KD5 E;  1FYZ E;  1N1C A;  4FJL A;  3L2O B;  3LDS A;  4HCC A;  2PFT A;  1WAJ A;  2FYO A;  3NGI A;  3J27 A;  1MHY G;  4DTU A;  4FJ8 A;  3RMA A;  2P1M B;  4JS4 A;  2DTU A;  4JRP A;  4EPH A;  3NCI A;  3L1N A;  3S9H A;  3RWU A;  4I9L A;  2RCU A;  4AKG A;  1FZ7 E;  3CFR A;  4RL5 A;  3LDB A;  2P1N B;  4KI6 A;  4DU4 A;  5IBK B;  3BVO A;  2MMB A;  1FZ9 E;  1FZI E;  3SUN A;  3N1B A;  2FW3 A;  4DTJ A;  4J2B A;  4E3S A;  2OZS A;  2B7M A;  1Q9Y A;  1WAF A;  2E32 A;  3UO2 A;  3NDK A;  3OGK B;  4JS5 A;  3SNN A;  1Q9X A;  4M3W A;  2P1O B;  4DTS A;  3SQ0 A; 
#chains in the Genus database with same CATH homology
 4M3Z A;  2OVP B;  1XMH E;  3LD8 A;  3L8B A;  3SQ4 A;  1FZ2 E;  4HCB A;  2OVQ B;  3C6N B;  4FJI A;  4I9Q A;  1FXX A;  1XMF E;  4KHW A;  3CFO A;  3SI6 A;  3C95 A;  4DTM A;  4I6J B;  3NAE A;  4DU3 A;  2QXF A;  3QEV A;  3SPY A;  1MHZ G;  1MMO G;  4X5N A;  1FZ5 E;  4DTX A;  2P1Q B;  3E4Y A;  1IG9 A;  1IH7 A;  3SQ1 A;  1XVB E;  3TAE A;  4M3U A;  1LDK E;  2P5G A;  3CFP A;  3V7D B;  4QNC A;  3NHG A;  2OYQ A;  3QNN A;  2VJ5 A;  1XVF E;  1XVD E;  2B8I A;  2MZW B;  1FZ3 E;  4FJ7 A;  1MTY G;  2LF6 A;  2YB5 A;  4X5M A;  4ADO A;  4KHY A;  4DTR A;  3C94 A;  4M41 A;  1FZ0 E;  4JRQ A;  3SUO A;  4FJ5 A;  4RG8 A;  4KI4 A;  1XL3 C;  4AI6 A;  3E4W A;  3C6O B;  4FJK A;  3QER A;  4M45 A;  4DU1 A;  4EP9 A;  1FZ4 E;  1XMG E;  1XVG E;  1P22 A;  2DEB A;  4B08 A;  4J2E A;  4M3T A;  2VIX A;  3RMC A;  3SPZ A;  3RMB A;  4FJH A;  3TJY A;  2P5O A;  3LZI A;  3KD1 E;  3QEW A;  4RNG A;  1FZ6 E;  2JHA A;  3C6P B;  4FK2 A;  1CLQ A;  4FVM A;  4M42 A;  2PFV A;  4GAM C;  4DTO A;  2H4T A;  3SUP A;  3QES A;  3TAG A;  2JPN A;  4FJN A;  4AKI A;  4E4B A;  4M3R A;  4J2A A;  1XU3 E;  1FZH E;  1XVE E;  4DTN A;  4FJX A;  4FJJ A;  4FK0 A;  3OGL B;  3SUQ A;  4QND A;  3HGL A;  3SVI A;  5IRE A;  3QET A;  3HP9 A;  4KHU A;  3K2O A;  4FJ9 A;  3TL8 B;  3RMD A;  4ADN A;  3QNO A;  1XVC E;  1FZ8 E;  4KHN A;  4M3Y A;  1NEX B;  1XU5 E;  2P1P B;  4KHS A;  3N1E A;  1FS1 A;  2LF3 A;  2JHC A;  3QEP A;  4J2D A;  3L0M A;  1FZ1 E;  2B1E A;  4FK4 A;  4AKH A;  3TAF A;  3OGM B;  3HL8 A;  2OVR B;  2JH8 A;  3MKS B;  2OZM A;  2HD0 A;  2VJ4 A;  3NE6 A;  3UIQ A;  3WSO A;  2E31 A;  2ATQ A;  3CQ8 A;  3QEI A;  3TAB A;  4M3X A;  4EYW A;  5H37 A;  2JHP A;  4FJG A;  4DTP A;  5IZ7 A;  3SJJ A;  4FJM A;  2JH9 A;  3QEX A;  4KHQ A;  3LZJ A;  3SQ2 A;  2DY4 A;  3HGK E;  3J2P A;  3SCX A;  3KD5 E;  1FYZ E;  4FJL A;  3L2O B;  3LDS A;  4HCC A;  2PFT A;  1WAJ A;  2FYO A;  3NGI A;  3J27 A;  1MHY G;  4DTU A;  4FJ8 A;  3RMA A;  2P1M B;  4JS4 A;  2DTU A;  4JRP A;  4EPH A;  3NCI A;  3L1N A;  3S9H A;  3RWU A;  4I9L A;  2RCU A;  4AKG A;  1FZ7 E;  3CFR A;  4RL5 A;  3LDB A;  2P1N B;  4KI6 A;  4DU4 A;  5IBK B;  2MMB A;  1FZ9 E;  1FZI E;  3SUN A;  3N1B A;  2FW3 A;  4DTJ A;  4J2B A;  4E3S A;  2OZS A;  2B7M A;  1Q9Y A;  1WAF A;  2E32 A;  3NDK A;  3OGK B;  4JS5 A;  3SNN A;  1Q9X A;  4M3W A;  2P1O B;  4DTS A;  3SQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...