2B8IA

Crystal structure and functional studies reveal that pas factor from vibrio vulnificus is a novel member of the saposin-fold family
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
IRPYMKALIYETLVNLANQDPEQHATIRQNLYEQLDLPFDKQLALYAGALGPASSGKLENHEAISNAVDSVVQLLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid binding protein
molecule keywords PAS factor
publication title Crystal structure and functional studies reveal that PAS factor from Vibrio vulnificus is a novel member of the saposin-fold family
pubmed doi rcsb
source organism Vibrio vulnificus
total genus 27
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.100 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2b8iA00
2B8IA
chains in the Genus database with same CATH superfamily
1FZ0E 1WAFA 2JH9A 2JPNA 2QXFA 3LZJA 3QETA 3L1NA 2B8IA 2OVPB 2K5SA 3C6OB 4GAMC 3HL8A 1XMGE 2VJ4A 4RL5A 3QEPA 4M3YA 3UO2A 3SUNA 1XMHE 1Q9YA 4HCBA 4RNGA 2DEBA 4FJNA 4AI6A 4M3XA 4AKIA 4JS4A 4M3WA 4E3SA 1XVEE 4QNCA 1XVFE 1MTYG 2JHCA 1NEXB 2YB5A 4FVMA 4FJ8A 2RKHA 3SUOA 3KD5E 4DU3A 4M3ZA 5IZ7A 4FK4A 3E4WA 1LDKE 2E31A 3HGKE 1MHYG 2JH8A 4FJGA 4FJ7A 4FJKA 3C94A 5IREA 4M45A 3NCIA 3QEVA 2H4TA 3TL8B 3NAEA 1XVDE 4M3RA 3SI6A 3SPZA 3S9HA 4M41A 2DTUA 1Q9XA 4FJ9A 3SUQA 3L8BA 3J2PA 4QNDA 3NDKA 3UO3A 4KI4A 1XU5E 3CFRA 2PFTA 4JS5A 2PFVA 4M3UA 3LZIA 1N1CA 4I9QA 4J2AA 2MMBA 2OYQA 4KHYA 2ATQA 1FZ1E 1P22A 2VIXA 2LF3A 4FK0A 4KI6A 4IT5A 1FZ2E 2P1PB 2MZWB 3SQ0A 2OZMA 1MHZG 3BVOA 4EP9A 3NGIA 3LD8A 3RMAA 4DTSA 3CFOA 1JW2A 2RCUA 1FZIE 4I6JB 2P1MB 3SQ4A 3SPYA 2P5GA 1FZ4E 4FJHA 3OGKB 2P1NB 2FYOA 3NHGA 5H37A 4FJIA 4KHNA 4I9LA 4DTNA 3CFPA 1FPOA 2VJ5A 3LDSA 2JHAA 3QERA 4DTRA 3TABA 2B7MA 3QNNA 2P1OB 3RMBA 3QEIA 4J2BA 4FJMA 2JHPA 1IH7A 4ICGC 3RMCA 1FZ9E 3SUPA 4KHUA 3TAEA 1FZ7E 3QESA 4DTOA 3RMDA 2OVQB 1FXXA 3C6PB 1XVBE 4FJXA 4JRQA 2B1EA 4DU1A 3QNOA 4FJJA 2LF6A 4M42A 3CQ8A 3NE6A 5IBKB 1WAJA 3KD1E 3TAFA 1FZ3E 3J27A 4J2DA 3TJYA 3MKSB 1FS1A 3SQ1A 1FZHE 4DTPA 1IG9A 4AKGA 1XU3E 4KHQA 2OZSA 3SQ2A 4M3TA 1CLQA 4E4BA 4DTXA 3RWUA 4X5MA 3QEXA 1FYZE 1XMFE 2P1QB 3OGMB 3L2OB 4RG8A 2E32A 1FZ8E 2MW2A 3UIQA 2JQTA 3C6NB 4ADNA 3K2OA 4HCCA 4KHSA 2OVRB 4KHWA 3LDBA 4EPHA 3N1EA 1FZ5E 4DTUA 4ADOA 3WSOA 2DY4A 4X5NA 3HP9A 3N1BA 2HD0A 1XL3C 1XVGE 3L0MA 4AKHA 4FJLA 1FZ6E 1XVCE 3SVIA 3SJJA 3E4YA 4DTJA 4B08A 3HGLA 3SCXA 4FK2A 4J2EA 4JRPA 1MMOG 3SNNA 3V7DB 3QEWA 4EYWA 4FJ5A 3TAGA 4DU4A 2P5OA 3C95A 2FW3A 4DTMA 3OGLB
chains in the Genus database with same CATH topology
1FZ0E 1WAFA 2JH9A 2JPNA 2QXFA 3LZJA 3QETA 3L1NA 2B8IA 2OVPB 3C6OB 4GAMC 3HL8A 1XMGE 2VJ4A 4RL5A 3QEPA 4M3YA 3SUNA 1XMHE 1Q9YA 4HCBA 4RNGA 2DEBA 4FJNA 4AI6A 4M3XA 4AKIA 4JS4A 4M3WA 4E3SA 1XVEE 4QNCA 1XVFE 1MTYG 2JHCA 1NEXB 2YB5A 4FVMA 4FJ8A 3SUOA 3KD5E 4DU3A 4M3ZA 5IZ7A 4FK4A 3E4WA 1LDKE 2E31A 3HGKE 1MHYG 2JH8A 4FJGA 4FJ7A 4FJKA 3C94A 5IREA 4M45A 3NCIA 3QEVA 2H4TA 3TL8B 3NAEA 1XVDE 4M3RA 3SI6A 3SPZA 3S9HA 4M41A 2DTUA 1Q9XA 4FJ9A 3SUQA 3L8BA 3J2PA 4QNDA 3NDKA 4KI4A 1XU5E 3CFRA 2PFTA 4JS5A 2PFVA 4M3UA 3LZIA 4I9QA 4J2AA 2MMBA 2OYQA 4KHYA 2ATQA 1FZ1E 1P22A 2VIXA 2LF3A 4FK0A 4KI6A 1FZ2E 2P1PB 2MZWB 3SQ0A 2OZMA 1MHZG 3NGIA 4EP9A 3RMAA 3LD8A 4DTSA 3CFOA 2RCUA 1FZIE 4I6JB 2P1MB 3SQ4A 3SPYA 2P5GA 1FZ4E 4FJHA 3OGKB 2P1NB 2FYOA 3NHGA 5H37A 4FJIA 4KHNA 4I9LA 4DTNA 3CFPA 2VJ5A 3LDSA 2JHAA 3QERA 4DTRA 3TABA 2B7MA 3QNNA 2P1OB 3RMBA 3QEIA 4J2BA 4FJMA 2JHPA 1IH7A 3RMCA 1FZ9E 3SUPA 4KHUA 3TAEA 1FZ7E 3QESA 4DTOA 3RMDA 2OVQB 1FXXA 3C6PB 1XVBE 4FJXA 4JRQA 2B1EA 4DU1A 3QNOA 4FJJA 2LF6A 4M42A 3CQ8A 3NE6A 5IBKB 1WAJA 3KD1E 3TAFA 1FZ3E 3J27A 4J2DA 3TJYA 3MKSB 1FS1A 3SQ1A 1FZHE 4DTPA 1IG9A 4AKGA 1XU3E 4KHQA 2OZSA 3SQ2A 4M3TA 1CLQA 4E4BA 4DTXA 3RWUA 4X5MA 3QEXA 1FYZE 1XMFE 2P1QB 3OGMB 3L2OB 4RG8A 2E32A 1FZ8E 3UIQA 3C6NB 4ADNA 3K2OA 4HCCA 4KHSA 2OVRB 4KHWA 3LDBA 4EPHA 3N1EA 1FZ5E 4DTUA 4ADOA 3WSOA 2DY4A 4X5NA 3HP9A 3N1BA 2HD0A 1XL3C 1XVGE 3L0MA 4AKHA 4FJLA 1FZ6E 1XVCE 3SVIA 3SJJA 3E4YA 4DTJA 4B08A 3HGLA 3SCXA 4FK2A 4J2EA 4JRPA 1MMOG 3SNNA 3V7DB 3QEWA 4EYWA 4FJ5A 3TAGA 4DU4A 2P5OA 3C95A 2FW3A 4DTMA 3OGLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8I A; 
#chains in the Genus database with same CATH topology
 1FZ0 E;  1WAF A;  2JH9 A;  2JPN A;  2QXF A;  3LZJ A;  3QET A;  3L1N A;  2B8I A;  2OVP B;  2K5S A;  3C6O B;  4GAM C;  3HL8 A;  1XMG E;  2VJ4 A;  4RL5 A;  3QEP A;  4M3Y A;  3UO2 A;  3SUN A;  1XMH E;  1Q9Y A;  4HCB A;  4RNG A;  2DEB A;  4FJN A;  4AI6 A;  4M3X A;  4AKI A;  4JS4 A;  4M3W A;  4E3S A;  1XVE E;  4QNC A;  1XVF E;  1MTY G;  2JHC A;  1NEX B;  2YB5 A;  4FVM A;  4FJ8 A;  2RKH A;  3SUO A;  3KD5 E;  4DU3 A;  4M3Z A;  5IZ7 A;  4FK4 A;  3E4W A;  1LDK E;  2E31 A;  3HGK E;  1MHY G;  2JH8 A;  4FJG A;  4FJ7 A;  4FJK A;  3C94 A;  5IRE A;  4M45 A;  3NCI A;  3QEV A;  2H4T A;  3TL8 B;  3NAE A;  1XVD E;  4M3R A;  3SI6 A;  3SPZ A;  3S9H A;  4M41 A;  2DTU A;  1Q9X A;  4FJ9 A;  3SUQ A;  3L8B A;  3J2P A;  4QND A;  3NDK A;  3UO3 A;  4KI4 A;  1XU5 E;  3CFR A;  2PFT A;  4JS5 A;  2PFV A;  4M3U A;  3LZI A;  1N1C A;  4I9Q A;  4J2A A;  2MMB A;  2OYQ A;  4KHY A;  2ATQ A;  1FZ1 E;  1P22 A;  2VIX A;  2LF3 A;  4FK0 A;  4KI6 A;  4IT5 A;  1FZ2 E;  2P1P B;  2MZW B;  3SQ0 A;  2OZM A;  1MHZ G;  3BVO A;  4EP9 A;  3NGI A;  3LD8 A;  3RMA A;  4DTS A;  3CFO A;  1JW2 A;  2RCU A;  1FZI E;  4I6J B;  2P1M B;  3SQ4 A;  3SPY A;  2P5G A;  1FZ4 E;  4FJH A;  3OGK B;  2P1N B;  2FYO A;  3NHG A;  5H37 A;  4FJI A;  4KHN A;  4I9L A;  4DTN A;  3CFP A;  1FPO A;  2VJ5 A;  3LDS A;  2JHA A;  3QER A;  4DTR A;  3TAB A;  2B7M A;  3QNN A;  2P1O B;  3RMB A;  3QEI A;  4J2B A;  4FJM A;  2JHP A;  1IH7 A;  4ICG C;  3RMC A;  1FZ9 E;  3SUP A;  4KHU A;  3TAE A;  1FZ7 E;  3QES A;  4DTO A;  3RMD A;  2OVQ B;  1FXX A;  3C6P B;  1XVB E;  4FJX A;  4JRQ A;  2B1E A;  4DU1 A;  3QNO A;  4FJJ A;  2LF6 A;  4M42 A;  3CQ8 A;  3NE6 A;  5IBK B;  1WAJ A;  3KD1 E;  3TAF A;  1FZ3 E;  3J27 A;  4J2D A;  3TJY A;  3MKS B;  1FS1 A;  3SQ1 A;  1FZH E;  4DTP A;  1IG9 A;  4AKG A;  1XU3 E;  4KHQ A;  2OZS A;  3SQ2 A;  4M3T A;  1CLQ A;  4E4B A;  4DTX A;  3RWU A;  4X5M A;  3QEX A;  1FYZ E;  1XMF E;  2P1Q B;  3OGM B;  3L2O B;  4RG8 A;  2E32 A;  1FZ8 E;  2MW2 A;  3UIQ A;  2JQT A;  3C6N B;  4ADN A;  3K2O A;  4HCC A;  4KHS A;  2OVR B;  4KHW A;  3LDB A;  4EPH A;  3N1E A;  1FZ5 E;  4DTU A;  4ADO A;  3WSO A;  2DY4 A;  4X5N A;  3HP9 A;  3N1B A;  2HD0 A;  1XL3 C;  1XVG E;  3L0M A;  4AKH A;  4FJL A;  1FZ6 E;  1XVC E;  3SVI A;  3SJJ A;  3E4Y A;  4DTJ A;  4B08 A;  3HGL A;  3SCX A;  4FK2 A;  4J2E A;  4JRP A;  1MMO G;  3SNN A;  3V7D B;  3QEW A;  4EYW A;  4FJ5 A;  3TAG A;  4DU4 A;  2P5O A;  3C95 A;  2FW3 A;  4DTM A;  3OGL B; 
#chains in the Genus database with same CATH homology
 1FZ0 E;  1WAF A;  2JH9 A;  2JPN A;  2QXF A;  3LZJ A;  3QET A;  3L1N A;  2B8I A;  2OVP B;  3C6O B;  4GAM C;  3HL8 A;  1XMG E;  2VJ4 A;  4RL5 A;  3QEP A;  4M3Y A;  3SUN A;  1XMH E;  1Q9Y A;  4HCB A;  4RNG A;  2DEB A;  4FJN A;  4AI6 A;  4M3X A;  4AKI A;  4JS4 A;  4M3W A;  4E3S A;  1XVE E;  4QNC A;  1XVF E;  1MTY G;  2JHC A;  1NEX B;  2YB5 A;  4FVM A;  4FJ8 A;  3SUO A;  3KD5 E;  4DU3 A;  4M3Z A;  5IZ7 A;  4FK4 A;  3E4W A;  1LDK E;  2E31 A;  3HGK E;  1MHY G;  2JH8 A;  4FJG A;  4FJ7 A;  4FJK A;  3C94 A;  5IRE A;  4M45 A;  3NCI A;  3QEV A;  2H4T A;  3TL8 B;  3NAE A;  1XVD E;  4M3R A;  3SI6 A;  3SPZ A;  3S9H A;  4M41 A;  2DTU A;  1Q9X A;  4FJ9 A;  3SUQ A;  3L8B A;  3J2P A;  4QND A;  3NDK A;  4KI4 A;  1XU5 E;  3CFR A;  2PFT A;  4JS5 A;  2PFV A;  4M3U A;  3LZI A;  4I9Q A;  4J2A A;  2MMB A;  2OYQ A;  4KHY A;  2ATQ A;  1FZ1 E;  1P22 A;  2VIX A;  2LF3 A;  4FK0 A;  4KI6 A;  1FZ2 E;  2P1P B;  2MZW B;  3SQ0 A;  2OZM A;  1MHZ G;  3NGI A;  4EP9 A;  3RMA A;  3LD8 A;  4DTS A;  3CFO A;  2RCU A;  1FZI E;  4I6J B;  2P1M B;  3SQ4 A;  3SPY A;  2P5G A;  1FZ4 E;  4FJH A;  3OGK B;  2P1N B;  2FYO A;  3NHG A;  5H37 A;  4FJI A;  4KHN A;  4I9L A;  4DTN A;  3CFP A;  2VJ5 A;  3LDS A;  2JHA A;  3QER A;  4DTR A;  3TAB A;  2B7M A;  3QNN A;  2P1O B;  3RMB A;  3QEI A;  4J2B A;  4FJM A;  2JHP A;  1IH7 A;  3RMC A;  1FZ9 E;  3SUP A;  4KHU A;  3TAE A;  1FZ7 E;  3QES A;  4DTO A;  3RMD A;  2OVQ B;  1FXX A;  3C6P B;  1XVB E;  4FJX A;  4JRQ A;  2B1E A;  4DU1 A;  3QNO A;  4FJJ A;  2LF6 A;  4M42 A;  3CQ8 A;  3NE6 A;  5IBK B;  1WAJ A;  3KD1 E;  3TAF A;  1FZ3 E;  3J27 A;  4J2D A;  3TJY A;  3MKS B;  1FS1 A;  3SQ1 A;  1FZH E;  4DTP A;  1IG9 A;  4AKG A;  1XU3 E;  4KHQ A;  2OZS A;  3SQ2 A;  4M3T A;  1CLQ A;  4E4B A;  4DTX A;  3RWU A;  4X5M A;  3QEX A;  1FYZ E;  1XMF E;  2P1Q B;  3OGM B;  3L2O B;  4RG8 A;  2E32 A;  1FZ8 E;  3UIQ A;  3C6N B;  4ADN A;  3K2O A;  4HCC A;  4KHS A;  2OVR B;  4KHW A;  3LDB A;  4EPH A;  3N1E A;  1FZ5 E;  4DTU A;  4ADO A;  3WSO A;  2DY4 A;  4X5N A;  3HP9 A;  3N1B A;  2HD0 A;  1XL3 C;  1XVG E;  3L0M A;  4AKH A;  4FJL A;  1FZ6 E;  1XVC E;  3SVI A;  3SJJ A;  3E4Y A;  4DTJ A;  4B08 A;  3HGL A;  3SCX A;  4FK2 A;  4J2E A;  4JRP A;  1MMO G;  3SNN A;  3V7D B;  3QEW A;  4EYW A;  4FJ5 A;  3TAG A;  4DU4 A;  2P5O A;  3C95 A;  2FW3 A;  4DTM A;  3OGL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...