2B8IA

Crystal structure and functional studies reveal that pas factor from vibrio vulnificus is a novel member of the saposin-fold family
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
77
structure length
77
Chain Sequence
IRPYMKALIYETLVNLANQDPEQHATIRQNLYEQLDLPFDKQLALYAGALGPASSGKLENHEAISNAVDSVVQLLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAS factor
publication title Crystal structure and functional studies reveal that PAS factor from Vibrio vulnificus is a novel member of the saposin-fold family
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Lipid binding protein
total genus 27
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-10-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.100 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2b8iA00
2B8IA
chains in the Genus database with same CATH superfamily
2FW3A 3E4WA 4I6JB 1P22A 3LDSA 3SCXA 2JH8A 3RMDA 4DU1A 1FZ1E 3SPZA 2OYQA 3SQ4A 3N1EA 4QNCA 3SVIA 3SUQA 3KD1E 2H4TA 4FJJA 3N1BA 2PFVA 2B8IA 4DTPA 2MMBA 4DTRA 4M3WA 1NEXB 2P1NB 1MHYG 3TABA 2P5GA 3SUOA 3SUNA 2OVQB 2OVPB 3QESA 4DTSA 4ADOA 1IG9A 4FJMA 3E4YA 3WSOA 1FZHE 1FZ4E 3CQ8A 3TL8B 1XVDE 4JS4A 3RMAA 3NCIA 1Q9XA 3UIQA 4J2BA 4FK0A 4AI6A 2ATQA 4DTMA 1MTYG 1WAJA 4JS5A 1XVGE 3NHGA 3QNOA 2DTUA 2E31A 2OZSA 4RG8A 3NE6A 1FZ7E 4M3ZA 2LF6A 1FXXA 2JHCA 2RCUA 1FS1A 1FZ8E 1WAFA 4FJLA 4FVMA 1FZ5E 4E4BA 4JRPA 3TAGA 3KD5E 3TAFA 1XVFE 2JH9A 3QEIA 2PFTA 4J2DA 2OZMA 2B1EA 4FK4A 1N1CA 4ADNA 4E3SA 1XVEE 4FJHA 1FZ2E 2B7MA 3S9HA 4KHWA 4RNGA 4B08A 2P1OB 4KHSA 2JQTA 4QNDA 2MW2A 4J2AA 4FJNA 4FJ9A 4FJ5A 1XVCE 3LD8A 4J2EA 3OGMB 3NGIA 4IT5A 3SQ0A 4M3RA 3C94A 4AKGA 3L1NA 1FZ3E 3HGKE 3QETA 3QNNA 4I9LA 2DEBA 4EPHA 3C6NB 4DTJA 3UO3A 1FZ9E 2JHAA 3TJYA 4FJXA 4FJ8A 2QXFA 3K2OA 1XMHE 3C6PB 3MKSB 3QEPA 4GAMC 5IREA 2JPNA 3NDKA 4KHNA 3BVOA 4EP9A 4DTUA 1IH7A 4I9QA 4KI4A 1MHZG 1XL3C 2JHPA 3QERA 3C95A 4M3XA 4M45A 1MMOG 3OGLB 3SNNA 1XVBE 1XU5E 2OVRB 3J27A 4FJGA 4JRQA 3OGKB 1FZIE 4DTNA 3RWUA 4EYWA 5H37A 1FZ6E 4DTOA 2P1MB 1LDKE 1XU3E 3NAEA 2P1PB 4FJIA 3CFOA 3L2OB 4DTXA 2FYOA 2P1QB 4RL5A 1FYZE 3CFPA 3SUPA 2MZWB 3TAEA 3UO2A 3QEXA 4X5MA 2YB5A 4ICGC 2VIXA 3J2PA 2P5OA 3QEVA 3LDBA 3QEWA 1JW2A 4M41A 2DY4A 4HCBA 2VJ5A 3HGLA 1XMFE 4X5NA 3RMCA 3SI6A 4FJKA 2LF3A 4DU4A 4DU3A 1FZ0E 3SQ2A 4AKHA 3CFRA 4M3YA 3LZIA 3L0MA 1Q9YA 1XMGE 4M42A 1FPOA 1CLQA 3RMBA 3SPYA 4KHYA 2HD0A 4KHUA 4KI6A 2VJ4A 4AKIA 5IZ7A 3C6OB 3HL8A 3L8BA 3LZJA 3SJJA 4FK2A 4KHQA 3HP9A 2E32A 4HCCA 3SQ1A 4M3UA 4FJ7A 4M3TA 2K5SA 5IBKB 2RKHA 3V7DB
chains in the Genus database with same CATH topology
2FW3A 3E4WA 4I6JB 1P22A 3LDSA 3SCXA 2JH8A 3RMDA 4DU1A 1FZ1E 3SPZA 2OYQA 3SQ4A 3N1EA 4QNCA 3SVIA 3SUQA 3KD1E 2H4TA 4FJJA 3N1BA 2PFVA 2B8IA 4DTPA 2MMBA 4DTRA 4M3WA 1NEXB 2P1NB 1MHYG 3TABA 2P5GA 3SUOA 3SUNA 2OVQB 2OVPB 3QESA 4DTSA 4ADOA 1IG9A 4FJMA 3E4YA 3WSOA 1FZHE 1FZ4E 3CQ8A 3TL8B 1XVDE 4JS4A 3RMAA 3NCIA 1Q9XA 3UIQA 4J2BA 4FK0A 4AI6A 2ATQA 4DTMA 1MTYG 1WAJA 4JS5A 1XVGE 3NHGA 3QNOA 2DTUA 2E31A 2OZSA 4RG8A 3NE6A 1FZ7E 4M3ZA 2LF6A 1FXXA 2JHCA 2RCUA 1FS1A 1FZ8E 1WAFA 4FJLA 4FVMA 1FZ5E 4E4BA 4JRPA 3TAGA 3KD5E 3TAFA 1XVFE 2JH9A 3QEIA 2PFTA 4J2DA 2OZMA 2B1EA 4FK4A 4ADNA 4E3SA 1XVEE 4FJHA 1FZ2E 2B7MA 3S9HA 4KHWA 4RNGA 4B08A 2P1OB 4KHSA 4QNDA 4J2AA 4FJNA 4FJ9A 4FJ5A 1XVCE 3LD8A 4J2EA 3OGMB 3NGIA 3SQ0A 4M3RA 3C94A 4AKGA 3L1NA 1FZ3E 3HGKE 3QETA 3QNNA 4I9LA 2DEBA 4EPHA 3C6NB 4DTJA 4KI4A 1FZ9E 2JHAA 3TJYA 4FJXA 4FJ8A 2QXFA 3K2OA 1XMHE 3C6PB 3MKSB 3QEPA 4GAMC 5IREA 2JPNA 3NDKA 4KHNA 4EP9A 4DTUA 1IH7A 4I9QA 4M3XA 1MHZG 1XL3C 2JHPA 3QERA 3C95A 4M45A 1MMOG 3OGLB 3SNNA 1XVBE 1XU5E 2OVRB 3J27A 4FJGA 4JRQA 3OGKB 1FZIE 4DTNA 3RWUA 4EYWA 5H37A 1FZ6E 4DTOA 2P1MB 1LDKE 1XU3E 3NAEA 2P1PB 4FJIA 3CFOA 3L2OB 4DTXA 2FYOA 2P1QB 4RL5A 1FYZE 3CFPA 3SUPA 2MZWB 3TAEA 3QEXA 4X5MA 2YB5A 2VIXA 3J2PA 2P5OA 3QEVA 3LDBA 3QEWA 4M41A 2DY4A 4HCBA 2VJ5A 3HGLA 1XMFE 4X5NA 3RMCA 3SI6A 4FJKA 2LF3A 4DU4A 4DU3A 1FZ0E 3SQ2A 4AKHA 3CFRA 4M3YA 3LZIA 3L0MA 1Q9YA 1XMGE 4M42A 1CLQA 3RMBA 3SPYA 4KHYA 2HD0A 4KHUA 4KI6A 2VJ4A 4AKIA 5IZ7A 3C6OB 3HL8A 3L8BA 3LZJA 3SJJA 4FK2A 4KHQA 3HP9A 2E32A 4HCCA 3SQ1A 4M3UA 4FJ7A 4M3TA 5IBKB 3V7DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B8I A; 
#chains in the Genus database with same CATH topology
 2FW3 A;  3E4W A;  4I6J B;  1P22 A;  3LDS A;  3SCX A;  2JH8 A;  3RMD A;  4DU1 A;  1FZ1 E;  3SPZ A;  2OYQ A;  3SQ4 A;  3N1E A;  4QNC A;  3SVI A;  3SUQ A;  3KD1 E;  2H4T A;  4FJJ A;  3N1B A;  2PFV A;  2B8I A;  4DTP A;  2MMB A;  4DTR A;  4M3W A;  1NEX B;  2P1N B;  1MHY G;  3TAB A;  2P5G A;  3SUO A;  3SUN A;  2OVQ B;  2OVP B;  3QES A;  4DTS A;  4ADO A;  1IG9 A;  4FJM A;  3E4Y A;  3WSO A;  1FZH E;  1FZ4 E;  3CQ8 A;  3TL8 B;  1XVD E;  4JS4 A;  3RMA A;  3NCI A;  1Q9X A;  3UIQ A;  4J2B A;  4FK0 A;  4AI6 A;  2ATQ A;  4DTM A;  1MTY G;  1WAJ A;  4JS5 A;  1XVG E;  3NHG A;  3QNO A;  2DTU A;  2E31 A;  2OZS A;  4RG8 A;  3NE6 A;  1FZ7 E;  4M3Z A;  2LF6 A;  1FXX A;  2JHC A;  2RCU A;  1FS1 A;  1FZ8 E;  1WAF A;  4FJL A;  4FVM A;  1FZ5 E;  4E4B A;  4JRP A;  3TAG A;  3KD5 E;  3TAF A;  1XVF E;  2JH9 A;  3QEI A;  2PFT A;  4J2D A;  2OZM A;  2B1E A;  4FK4 A;  1N1C A;  4ADN A;  4E3S A;  1XVE E;  4FJH A;  1FZ2 E;  2B7M A;  3S9H A;  4KHW A;  4RNG A;  4B08 A;  2P1O B;  4KHS A;  2JQT A;  4QND A;  2MW2 A;  4J2A A;  4FJN A;  4FJ9 A;  4FJ5 A;  1XVC E;  3LD8 A;  4J2E A;  3OGM B;  3NGI A;  4IT5 A;  3SQ0 A;  4M3R A;  3C94 A;  4AKG A;  3L1N A;  1FZ3 E;  3HGK E;  3QET A;  3QNN A;  4I9L A;  2DEB A;  4EPH A;  3C6N B;  4DTJ A;  3UO3 A;  1FZ9 E;  2JHA A;  3TJY A;  4FJX A;  4FJ8 A;  2QXF A;  3K2O A;  1XMH E;  3C6P B;  3MKS B;  3QEP A;  4GAM C;  5IRE A;  2JPN A;  3NDK A;  4KHN A;  3BVO A;  4EP9 A;  4DTU A;  1IH7 A;  4I9Q A;  4KI4 A;  1MHZ G;  1XL3 C;  2JHP A;  3QER A;  3C95 A;  4M3X A;  4M45 A;  1MMO G;  3OGL B;  3SNN A;  1XVB E;  1XU5 E;  2OVR B;  3J27 A;  4FJG A;  4JRQ A;  3OGK B;  1FZI E;  4DTN A;  3RWU A;  4EYW A;  5H37 A;  1FZ6 E;  4DTO A;  2P1M B;  1LDK E;  1XU3 E;  3NAE A;  2P1P B;  4FJI A;  3CFO A;  3L2O B;  4DTX A;  2FYO A;  2P1Q B;  4RL5 A;  1FYZ E;  3CFP A;  3SUP A;  2MZW B;  3TAE A;  3UO2 A;  3QEX A;  4X5M A;  2YB5 A;  4ICG C;  2VIX A;  3J2P A;  2P5O A;  3QEV A;  3LDB A;  3QEW A;  1JW2 A;  4M41 A;  2DY4 A;  4HCB A;  2VJ5 A;  3HGL A;  1XMF E;  4X5N A;  3RMC A;  3SI6 A;  4FJK A;  2LF3 A;  4DU4 A;  4DU3 A;  1FZ0 E;  3SQ2 A;  4AKH A;  3CFR A;  4M3Y A;  3LZI A;  3L0M A;  1Q9Y A;  1XMG E;  4M42 A;  1FPO A;  1CLQ A;  3RMB A;  3SPY A;  4KHY A;  2HD0 A;  4KHU A;  4KI6 A;  2VJ4 A;  4AKI A;  5IZ7 A;  3C6O B;  3HL8 A;  3L8B A;  3LZJ A;  3SJJ A;  4FK2 A;  4KHQ A;  3HP9 A;  2E32 A;  4HCC A;  3SQ1 A;  4M3U A;  4FJ7 A;  4M3T A;  2K5S A;  5IBK B;  2RKH A;  3V7D B; 
#chains in the Genus database with same CATH homology
 2FW3 A;  3E4W A;  4I6J B;  1P22 A;  3LDS A;  3SCX A;  2JH8 A;  3RMD A;  4DU1 A;  1FZ1 E;  3SPZ A;  2OYQ A;  3SQ4 A;  3N1E A;  4QNC A;  3SVI A;  3SUQ A;  3KD1 E;  2H4T A;  4FJJ A;  3N1B A;  2PFV A;  2B8I A;  4DTP A;  2MMB A;  4DTR A;  4M3W A;  1NEX B;  2P1N B;  1MHY G;  3TAB A;  2P5G A;  3SUO A;  3SUN A;  2OVQ B;  2OVP B;  3QES A;  4DTS A;  4ADO A;  1IG9 A;  4FJM A;  3E4Y A;  3WSO A;  1FZH E;  1FZ4 E;  3CQ8 A;  3TL8 B;  1XVD E;  4JS4 A;  3RMA A;  3NCI A;  1Q9X A;  3UIQ A;  4J2B A;  4FK0 A;  4AI6 A;  2ATQ A;  4DTM A;  1MTY G;  1WAJ A;  4JS5 A;  1XVG E;  3NHG A;  3QNO A;  2DTU A;  2E31 A;  2OZS A;  4RG8 A;  3NE6 A;  1FZ7 E;  4M3Z A;  2LF6 A;  1FXX A;  2JHC A;  2RCU A;  1FS1 A;  1FZ8 E;  1WAF A;  4FJL A;  4FVM A;  1FZ5 E;  4E4B A;  4JRP A;  3TAG A;  3KD5 E;  3TAF A;  1XVF E;  2JH9 A;  3QEI A;  2PFT A;  4J2D A;  2OZM A;  2B1E A;  4FK4 A;  4ADN A;  4E3S A;  1XVE E;  4FJH A;  1FZ2 E;  2B7M A;  3S9H A;  4KHW A;  4RNG A;  4B08 A;  2P1O B;  4KHS A;  4QND A;  4J2A A;  4FJN A;  4FJ9 A;  4FJ5 A;  1XVC E;  3LD8 A;  4J2E A;  3OGM B;  3NGI A;  3SQ0 A;  4M3R A;  3C94 A;  4AKG A;  3L1N A;  1FZ3 E;  3HGK E;  3QET A;  3QNN A;  4I9L A;  2DEB A;  4EPH A;  3C6N B;  4DTJ A;  4KI4 A;  1FZ9 E;  2JHA A;  3TJY A;  4FJX A;  4FJ8 A;  2QXF A;  3K2O A;  1XMH E;  3C6P B;  3MKS B;  3QEP A;  4GAM C;  5IRE A;  2JPN A;  3NDK A;  4KHN A;  4EP9 A;  4DTU A;  1IH7 A;  4I9Q A;  4M3X A;  1MHZ G;  1XL3 C;  2JHP A;  3QER A;  3C95 A;  4M45 A;  1MMO G;  3OGL B;  3SNN A;  1XVB E;  1XU5 E;  2OVR B;  3J27 A;  4FJG A;  4JRQ A;  3OGK B;  1FZI E;  4DTN A;  3RWU A;  4EYW A;  5H37 A;  1FZ6 E;  4DTO A;  2P1M B;  1LDK E;  1XU3 E;  3NAE A;  2P1P B;  4FJI A;  3CFO A;  3L2O B;  4DTX A;  2FYO A;  2P1Q B;  4RL5 A;  1FYZ E;  3CFP A;  3SUP A;  2MZW B;  3TAE A;  3QEX A;  4X5M A;  2YB5 A;  2VIX A;  3J2P A;  2P5O A;  3QEV A;  3LDB A;  3QEW A;  4M41 A;  2DY4 A;  4HCB A;  2VJ5 A;  3HGL A;  1XMF E;  4X5N A;  3RMC A;  3SI6 A;  4FJK A;  2LF3 A;  4DU4 A;  4DU3 A;  1FZ0 E;  3SQ2 A;  4AKH A;  3CFR A;  4M3Y A;  3LZI A;  3L0M A;  1Q9Y A;  1XMG E;  4M42 A;  1CLQ A;  3RMB A;  3SPY A;  4KHY A;  2HD0 A;  4KHU A;  4KI6 A;  2VJ4 A;  4AKI A;  5IZ7 A;  3C6O B;  3HL8 A;  3L8B A;  3LZJ A;  3SJJ A;  4FK2 A;  4KHQ A;  3HP9 A;  2E32 A;  4HCC A;  3SQ1 A;  4M3U A;  4FJ7 A;  4M3T A;  5IBK B;  3V7D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...