1JW2A

Solution structure of hemolysin expression modulating protein hha from escherichia coli. ontario centre for structural proteomics target ec0308_1_72; northeast structural genomics target et88
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYSIN EXPRESSION MODULATING PROTEIN Hha
publication title An NMR approach to structural proteomics
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 1jw2A00
2MW2A 2JQTA 2K5SA 4ICGC 1JW2A
chains in the Genus database with same CATH superfamily
3UO3A 4FJLA 3L0MA 3QEWA 4FK4A 2PFTA 4DTSA 4HCCA 1FZ9E 3CFRA 2OVRB 1FZ4E 2JHPA 2OVPB 4KHSA 2MMBA 4M3YA 4E3SA 3LDBA 1FZ0E 2FYOA 1P22A 3QETA 3SUPA 1FZHE 3UO2A 3NCIA 1FZ5E 2E31A 4ICGC 3QEPA 3S9HA 2DEBA 2P1MB 3L8BA 4DTMA 1IG9A 4FK0A 1XU5E 3LZJA 2DTUA 4DU1A 4AKHA 3SUNA 3SQ0A 3C95A 2OZMA 2OZSA 1MHYG 1FS1A 2VJ4A 2P1OB 2MZWB 4RNGA 4E4BA 3KD1E 4DTXA 4FJ7A 1XMHE 3RMDA 4KI6A 4FJ5A 1XVGE 3CFOA 4DTOA 4X5NA 3LZIA 1NEXB 3HGKE 3N1EA 2VIXA 3CQ8A 2K5SA 3V7DB 1FPOA 3CFPA 4GAMC 4DTUA 4FJIA 4M3RA 4I9QA 3QEXA 3NDKA 4DTRA 4ADOA 3QEIA 3C6NB 4FK2A 4ADNA 1WAJA 3HP9A 3NE6A 2JHCA 3QNNA 4KHUA 1FZ3E 1MMOG 2LF3A 3NGIA 4KHQA 4M3TA 3BVOA 4AI6A 1XMGE 3NHGA 1XU3E 3MKSB 4EYWA 4M3WA 3C6PB 1JW2A 1MHZG 3NAEA 4M42A 1FZ2E 4KI4A 2P1NB 4QNDA 3L2OB 3OGKB 2OVQB 4FJKA 3K2OA 1LDKE 2DY4A 1XVBE 2P5OA 4I9LA 4AKGA 1IH7A 3SI6A 3OGMB 1FZIE 3LD8A 3HGLA 4FJ8A 4JRQA 3E4WA 1FZ1E 3LDSA 4M41A 4DU3A 4QNCA 3OGLB 4JS5A 2QXFA 3TAGA 1FZ6E 4EP9A 2JHAA 3SQ2A 3QERA 2E32A 4DTNA 4J2DA 4JRPA 2P1PB 2P5GA 2B7MA 5IBKB 4JS4A 3TAEA 4RL5A 3KD5E 2RKHA 4M3ZA 1FXXA 3SQ4A 2H4TA 2LF6A 4FJ9A 5IREA 1XVEE 2B1EA 3TJYA 4FJJA 3SVIA 3J2PA 4FJXA 4J2EA 4M3XA 3SPZA 4KHNA 1Q9XA 2RCUA 2HD0A 4HCBA 4FJGA 3QEVA 2FW3A 1N1CA 2JPNA 3SCXA 4AKIA 1XMFE 3TAFA 4DTPA 3RWUA 3J27A 4FJMA 2VJ5A 4IT5A 3SUQA 3E4YA 2B8IA 3SPYA 3N1BA 1FZ8E 4M3UA 3TL8B 4FJHA 2ATQA 3SNNA 3RMCA 4I6JB 1FYZE 2JQTA 4RG8A 4FVMA 4KHWA 4FJNA 4B08A 3WSOA 3L1NA 1XVCE 4KHYA 3SJJA 2OYQA 1WAFA 2P1QB 1XVDE 2YB5A 5H37A 2JH9A 3SUOA 4M45A 3HL8A 1XVFE 1Q9YA 4J2AA 3C94A 2PFVA 1FZ7E 3QNOA 3RMAA 2JH8A 4EPHA 3UIQA 4X5MA 1MTYG 3RMBA 3TABA 4DTJA 4J2BA 2MW2A 1XL3C 4DU4A 5IZ7A 1CLQA 3C6OB 3QESA 3SQ1A
chains in the Genus database with same CATH topology
2MW2A 2JQTA 2K5SA 4ICGC 1JW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  2JQT A;  2K5S A;  4ICG C;  1JW2 A; 
#chains in the Genus database with same CATH topology
 3UO3 A;  4FJL A;  3L0M A;  3QEW A;  4FK4 A;  2PFT A;  4DTS A;  4HCC A;  1FZ9 E;  3CFR A;  2OVR B;  1FZ4 E;  2JHP A;  2OVP B;  4KHS A;  2MMB A;  4M3Y A;  4E3S A;  3LDB A;  1FZ0 E;  2FYO A;  1P22 A;  3QET A;  3SUP A;  1FZH E;  3UO2 A;  3NCI A;  1FZ5 E;  2E31 A;  4ICG C;  3QEP A;  3S9H A;  2DEB A;  2P1M B;  3L8B A;  4DTM A;  1IG9 A;  4FK0 A;  1XU5 E;  3LZJ A;  2DTU A;  4DU1 A;  4AKH A;  3SUN A;  3SQ0 A;  3C95 A;  2OZM A;  2OZS A;  1MHY G;  1FS1 A;  2VJ4 A;  2P1O B;  2MZW B;  4RNG A;  4E4B A;  3KD1 E;  4DTX A;  4FJ7 A;  1XMH E;  3RMD A;  4KI6 A;  4FJ5 A;  1XVG E;  3CFO A;  4DTO A;  4X5N A;  3LZI A;  1NEX B;  3HGK E;  3N1E A;  2VIX A;  3CQ8 A;  2K5S A;  3V7D B;  1FPO A;  3CFP A;  4GAM C;  4DTU A;  4FJI A;  4M3R A;  4I9Q A;  3QEX A;  3NDK A;  4DTR A;  4ADO A;  3QEI A;  3C6N B;  4FK2 A;  4ADN A;  1WAJ A;  3HP9 A;  3NE6 A;  2JHC A;  3QNN A;  4KHU A;  1FZ3 E;  1MMO G;  2LF3 A;  3NGI A;  4KHQ A;  4M3T A;  3BVO A;  4AI6 A;  1XMG E;  3NHG A;  1XU3 E;  3MKS B;  4EYW A;  4M3W A;  3C6P B;  1JW2 A;  1MHZ G;  3NAE A;  4M42 A;  1FZ2 E;  4KI4 A;  2P1N B;  4QND A;  3L2O B;  3OGK B;  2OVQ B;  4FJK A;  3K2O A;  1LDK E;  2DY4 A;  1XVB E;  2P5O A;  4I9L A;  4AKG A;  1IH7 A;  3SI6 A;  3OGM B;  1FZI E;  3LD8 A;  3HGL A;  4FJ8 A;  4JRQ A;  3E4W A;  1FZ1 E;  3LDS A;  4M41 A;  4DU3 A;  4QNC A;  3OGL B;  4JS5 A;  2QXF A;  3TAG A;  1FZ6 E;  4EP9 A;  2JHA A;  3SQ2 A;  3QER A;  2E32 A;  4DTN A;  4J2D A;  4JRP A;  2P1P B;  2P5G A;  2B7M A;  5IBK B;  4JS4 A;  3TAE A;  4RL5 A;  3KD5 E;  2RKH A;  4M3Z A;  1FXX A;  3SQ4 A;  2H4T A;  2LF6 A;  4FJ9 A;  5IRE A;  1XVE E;  2B1E A;  3TJY A;  4FJJ A;  3SVI A;  3J2P A;  4FJX A;  4J2E A;  4M3X A;  3SPZ A;  4KHN A;  1Q9X A;  2RCU A;  2HD0 A;  4HCB A;  4FJG A;  3QEV A;  2FW3 A;  1N1C A;  2JPN A;  3SCX A;  4AKI A;  1XMF E;  3TAF A;  4DTP A;  3RWU A;  3J27 A;  4FJM A;  2VJ5 A;  4IT5 A;  3SUQ A;  3E4Y A;  2B8I A;  3SPY A;  3N1B A;  1FZ8 E;  4M3U A;  3TL8 B;  4FJH A;  2ATQ A;  3SNN A;  3RMC A;  4I6J B;  1FYZ E;  2JQT A;  4RG8 A;  4FVM A;  4KHW A;  4FJN A;  4B08 A;  3WSO A;  3L1N A;  1XVC E;  4KHY A;  3SJJ A;  2OYQ A;  1WAF A;  2P1Q B;  1XVD E;  2YB5 A;  5H37 A;  2JH9 A;  3SUO A;  4M45 A;  3HL8 A;  1XVF E;  1Q9Y A;  4J2A A;  3C94 A;  2PFV A;  1FZ7 E;  3QNO A;  3RMA A;  2JH8 A;  4EPH A;  3UIQ A;  4X5M A;  1MTY G;  3RMB A;  3TAB A;  4DTJ A;  4J2B A;  2MW2 A;  1XL3 C;  4DU4 A;  5IZ7 A;  1CLQ A;  3C6O B;  3QES A;  3SQ1 A; 
#chains in the Genus database with same CATH homology
 2MW2 A;  2JQT A;  2K5S A;  4ICG C;  1JW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...