1JW2A

Solution structure of hemolysin expression modulating protein hha from escherichia coli. ontario centre for structural proteomics target ec0308_1_72; northeast structural genomics target et88
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HEMOLYSIN EXPRESSION MODULATING PROTEIN Hha
publication title An NMR approach to structural proteomics
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 1jw2A00
2K5SA 1JW2A 4ICGC 2JQTA 2MW2A
chains in the Genus database with same CATH superfamily
3J27A 4M45A 3TABA 3RMCA 1CLQA 3QNNA 4QNCA 3C6NB 2P5GA 1FZ0E 3NHGA 3SCXA 2JQTA 2MW2A 1FZ6E 4B08A 4FJIA 1NEXB 3HP9A 3TJYA 3K2OA 3UO3A 4ADNA 3L0MA 3LDBA 4ICGC 1FZ1E 4JRQA 4DTRA 4J2BA 1MHZG 2JPNA 3E4YA 3CFPA 4M41A 4RG8A 1WAFA 2P1QB 3HGLA 3TAFA 4DTPA 3QEVA 3NCIA 2VIXA 3SJJA 1XVCE 4FJHA 4FK0A 4X5MA 4DTMA 2LF6A 3SNNA 3HGKE 4EYWA 1MTYG 4DTUA 2K5SA 1XU5E 3CFOA 4DTOA 4J2DA 4ADOA 4M42A 3LDSA 3SPZA 4FJJA 5IREA 4KHUA 3C94A 3SUQA 2OZMA 4KHSA 1FZ3E 3TL8B 2OVQB 3SUNA 4JRPA 1Q9XA 3V7DB 4HCBA 3BVOA 4KHNA 1FZ5E 2LF3A 4JS5A 3UIQA 1XVFE 4FJNA 4J2AA 3UO2A 4DU4A 4FJ9A 1MMOG 2FW3A 4DTJA 2HD0A 5IBKB 4FJ5A 4FJKA 3RWUA 3WSOA 2OZSA 1FZIE 5IZ7A 3QEPA 2E31A 4AKGA 1XMFE 3LZJA 4FJ7A 2B7MA 4GAMC 1XMGE 3RMBA 3C6PB 1FZ9E 4KI4A 2DY4A 2QXFA 1FXXA 3HL8A 4E4BA 2VJ5A 3KD1E 2B1EA 3L8BA 3CFRA 3NGIA 1XVBE 2P1MB 2FYOA 4M3UA 4I9LA 1FZHE 4FJGA 2P1NB 4M3TA 1XVDE 4FJLA 3RMDA 3SQ1A 3OGLB 1WAJA 2OVPB 1JW2A 2P1OB 4QNDA 2B8IA 2RKHA 4HCCA 1XL3C 4FJ8A 2MMBA 3E4WA 3QERA 2OYQA 4E3SA 4FVMA 3N1BA 4EPHA 1MHYG 3NE6A 3SQ2A 3SUPA 3SUOA 2YB5A 4AI6A 3N1EA 2DEBA 3NDKA 3TAEA 3SI6A 2JHCA 4M3ZA 3QEXA 2P5OA 4M3XA 4KHQA 1FZ4E 3TAGA 3QEIA 4X5NA 4FJMA 3L1NA 1XMHE 2P1PB 4DU1A 2DTUA 4KI6A 4DTSA 4RNGA 3L2OB 3LD8A 3S9HA 2E32A 2JH8A 4JS4A 4J2EA 4FK2A 4DTNA 1FZ2E 1FYZE 4I6JB 3LZIA 3CQ8A 3SPYA 4I9QA 4DU3A 2H4TA 4M3RA 1FPOA 3SQ4A 2JHAA 4AKIA 2MZWB 3RMAA 1XU3E 3SVIA 1FS1A 4RL5A 4EP9A 2ATQA 2OVRB 1Q9YA 4FJXA 3C6OB 1FZ7E 3QNOA 4FK4A 4AKHA 2PFVA 4DTXA 1XVGE 1IH7A 5H37A 2VJ4A 3NAEA 3KD5E 1N1CA 3C95A 3OGKB 4M3YA 3SQ0A 3J2PA 3QETA 4M3WA 4KHYA 3MKSB 1FZ8E 2JHPA 2PFTA 3QESA 1XVEE 2JH9A 2RCUA 1IG9A 1LDKE 4IT5A 3QEWA 1P22A 4KHWA 3OGMB
chains in the Genus database with same CATH topology
2K5SA 1JW2A 4ICGC 2JQTA 2MW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5S A;  1JW2 A;  4ICG C;  2JQT A;  2MW2 A; 
#chains in the Genus database with same CATH topology
 3J27 A;  4M45 A;  3TAB A;  3RMC A;  1CLQ A;  3QNN A;  4QNC A;  3C6N B;  2P5G A;  1FZ0 E;  3NHG A;  3SCX A;  2JQT A;  2MW2 A;  1FZ6 E;  4B08 A;  4FJI A;  1NEX B;  3HP9 A;  3TJY A;  3K2O A;  3UO3 A;  4ADN A;  3L0M A;  3LDB A;  4ICG C;  1FZ1 E;  4JRQ A;  4DTR A;  4J2B A;  1MHZ G;  2JPN A;  3E4Y A;  3CFP A;  4M41 A;  4RG8 A;  1WAF A;  2P1Q B;  3HGL A;  3TAF A;  4DTP A;  3QEV A;  3NCI A;  2VIX A;  3SJJ A;  1XVC E;  4FJH A;  4FK0 A;  4X5M A;  4DTM A;  2LF6 A;  3SNN A;  3HGK E;  4EYW A;  1MTY G;  4DTU A;  2K5S A;  1XU5 E;  3CFO A;  4DTO A;  4J2D A;  4ADO A;  4M42 A;  3LDS A;  3SPZ A;  4FJJ A;  5IRE A;  4KHU A;  3C94 A;  3SUQ A;  2OZM A;  4KHS A;  1FZ3 E;  3TL8 B;  2OVQ B;  3SUN A;  4JRP A;  1Q9X A;  3V7D B;  4HCB A;  3BVO A;  4KHN A;  1FZ5 E;  2LF3 A;  4JS5 A;  3UIQ A;  1XVF E;  4FJN A;  4J2A A;  3UO2 A;  4DU4 A;  4FJ9 A;  1MMO G;  2FW3 A;  4DTJ A;  2HD0 A;  5IBK B;  4FJ5 A;  4FJK A;  3RWU A;  3WSO A;  2OZS A;  1FZI E;  5IZ7 A;  3QEP A;  2E31 A;  4AKG A;  1XMF E;  3LZJ A;  4FJ7 A;  2B7M A;  4GAM C;  1XMG E;  3RMB A;  3C6P B;  1FZ9 E;  4KI4 A;  2DY4 A;  2QXF A;  1FXX A;  3HL8 A;  4E4B A;  2VJ5 A;  3KD1 E;  2B1E A;  3L8B A;  3CFR A;  3NGI A;  1XVB E;  2P1M B;  2FYO A;  4M3U A;  4I9L A;  1FZH E;  4FJG A;  2P1N B;  4M3T A;  1XVD E;  4FJL A;  3RMD A;  3SQ1 A;  3OGL B;  1WAJ A;  2OVP B;  1JW2 A;  2P1O B;  4QND A;  2B8I A;  2RKH A;  4HCC A;  1XL3 C;  4FJ8 A;  2MMB A;  3E4W A;  3QER A;  2OYQ A;  4E3S A;  4FVM A;  3N1B A;  4EPH A;  1MHY G;  3NE6 A;  3SQ2 A;  3SUP A;  3SUO A;  2YB5 A;  4AI6 A;  3N1E A;  2DEB A;  3NDK A;  3TAE A;  3SI6 A;  2JHC A;  4M3Z A;  3QEX A;  2P5O A;  4M3X A;  4KHQ A;  1FZ4 E;  3TAG A;  3QEI A;  4X5N A;  4FJM A;  3L1N A;  1XMH E;  2P1P B;  4DU1 A;  2DTU A;  4KI6 A;  4DTS A;  4RNG A;  3L2O B;  3LD8 A;  3S9H A;  2E32 A;  2JH8 A;  4JS4 A;  4J2E A;  4FK2 A;  4DTN A;  1FZ2 E;  1FYZ E;  4I6J B;  3LZI A;  3CQ8 A;  3SPY A;  4I9Q A;  4DU3 A;  2H4T A;  4M3R A;  1FPO A;  3SQ4 A;  2JHA A;  4AKI A;  2MZW B;  3RMA A;  1XU3 E;  3SVI A;  1FS1 A;  4RL5 A;  4EP9 A;  2ATQ A;  2OVR B;  1Q9Y A;  4FJX A;  3C6O B;  1FZ7 E;  3QNO A;  4FK4 A;  4AKH A;  2PFV A;  4DTX A;  1XVG E;  1IH7 A;  5H37 A;  2VJ4 A;  3NAE A;  3KD5 E;  1N1C A;  3C95 A;  3OGK B;  4M3Y A;  3SQ0 A;  3J2P A;  3QET A;  4M3W A;  4KHY A;  3MKS B;  1FZ8 E;  2JHP A;  2PFT A;  3QES A;  1XVE E;  2JH9 A;  2RCU A;  1IG9 A;  1LDK E;  4IT5 A;  3QEW A;  1P22 A;  4KHW A;  3OGM B; 
#chains in the Genus database with same CATH homology
 2K5S A;  1JW2 A;  4ICG C;  2JQT A;  2MW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...