4QNCA

Crystal structure of a semisweet in an occluded state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords chemical transport protein
publication title Structures of bacterial homologues of SWEET transporters in two distinct conformations.
pubmed doi rcsb
source organism Leptospira biflexa serovar patoc
total genus 32
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4qncA00
4QNDA 4X5NA 4RNGA 4X5MA 4QNCA
chains in the Genus database with same CATH superfamily
4I9QA 3L8BA 3NHGA 3SJJA 4FJIA 1FXXA 4B08A 1FZ6E 3V7DB 3SI6A 4M42A 2VJ5A 1WAJA 1JW2A 2LF3A 3LZJA 3HGKE 3SQ4A 2JHCA 4ADOA 3BVOA 4FJHA 3QEPA 4KI4A 1P22A 3OGLB 1FZ3E 2ATQA 2LF6A 2OVPB 4IT5A 4RL5A 4X5NA 3NAEA 3RMAA 3SCXA 2OZMA 3SVIA 3SQ0A 4X5MA 4ICGC 2P1MB 2JPNA 3RWUA 2OVRB 3C6NB 3KD1E 3UIQA 1XU5E 3L0MA 3UO2A 3LDSA 4I6JB 4FK2A 1Q9YA 3OGKB 3QEVA 4M3XA 1FZ2E 1XMGE 3N1EA 4DTNA 3RMCA 3SPZA 1XVDE 4DU1A 4JRPA 4KHUA 2RKHA 3UO3A 1FYZE 1FZIE 4E3SA 4FJ5A 3QEXA 2OVQB 3LDBA 3CFPA 2YB5A 4DTPA 4FK4A 3NGIA 2DTUA 4M3UA 4DU4A 2MZWB 4EYWA 4KHWA 3QEIA 2P1QB 1Q9XA 3LZIA 1FS1A 1IH7A 1NEXB 3J27A 4DTMA 4M3ZA 3C6PB 3RMBA 1FZ7E 4JS4A 1FZ4E 2B7MA 2P5GA 4EPHA 4EP9A 1IG9A 4AKHA 4ADNA 2MMBA 2VJ4A 3E4WA 2P1OB 2P5OA 4M3RA 2B1EA 4M45A 4FJXA 4HCBA 3MKSB 1FZHE 3QNNA 2DEBA 3SQ1A 3NCIA 2QXFA 2MW2A 3TL8B 3OGMB 4J2AA 4RG8A 4FJKA 3C95A 3QETA 2OZSA 3QESA 4M3YA 1XVBE 2RCUA 2OYQA 3WSOA 1FZ8E 4HCCA 3TAEA 4M3WA 4FK0A 3J2PA 5IBKB 3HGLA 4JS5A 3SQ2A 3S9HA 4KHSA 1LDKE 3QNOA 1XVGE 4FJMA 4FJ8A 4JRQA 4DTSA 1XU3E 3SUPA 2FW3A 3SNNA 4QNCA 2P1NB 1MHYG 4KHQA 4J2DA 4KHNA 4I9LA 4AKIA 1XVFE 3N1BA 3C94A 3NE6A 1N1CA 5H37A 3KD5E 4J2EA 4FJ7A 4E4BA 4FJJA 4KI6A 1FPOA 2H4TA 3L1NA 4AKGA 1FZ0E 2PFTA 1WAFA 4KHYA 2B8IA 4DTOA 1XVEE 3C6OB 2JH8A 2HD0A 1XVCE 3TABA 2P1PB 1MTYG 2E32A 5IREA 1FZ5E 3HL8A 4FJ9A 4M3TA 1MHZG 3CFRA 3RMDA 5IZ7A 2JQTA 3E4YA 3HP9A 3LD8A 3QEWA 3TAGA 2JHAA 4AI6A 1XMFE 4M41A 4RNGA 3L2OB 4DTUA 3SUQA 3QERA 1XL3C 2FYOA 4FJLA 2DY4A 1CLQA 3NDKA 4FVMA 1FZ1E 2JHPA 4FJGA 4QNDA 4GAMC 2JH9A 2K5SA 4J2BA 3CQ8A 4DTJA 2PFVA 3K2OA 2E31A 3SUNA 1MMOG 3CFOA 2VIXA 3TJYA 4DU3A 3SUOA 1XMHE 3TAFA 4FJNA 3SPYA 4DTXA 4DTRA 1FZ9E
chains in the Genus database with same CATH topology
4I9QA 3L8BA 3NHGA 3SJJA 4FJIA 1FXXA 4B08A 1FZ6E 3V7DB 3SI6A 4M42A 2VJ5A 1WAJA 2LF3A 3LZJA 3HGKE 3SQ4A 2JHCA 4ADOA 4FJHA 3QEPA 4KI4A 1P22A 3OGLB 1FZ3E 2ATQA 2LF6A 2OVPB 4RL5A 3NAEA 4X5NA 3SCXA 3RMAA 2OZMA 3SVIA 3SQ0A 4X5MA 2P1MB 2JPNA 3RWUA 2OVRB 3C6NB 3KD1E 3UIQA 1XU5E 3L0MA 3LDSA 4FK2A 4I6JB 1Q9YA 3OGKB 3QEVA 4M3XA 1FZ2E 1XMGE 3N1EA 4DTNA 3RMCA 3SPZA 1XVDE 4DU1A 4JRPA 4KHUA 4E3SA 1FYZE 1FZIE 4FJ5A 3QEXA 2OVQB 3LDBA 3CFPA 2YB5A 4DTPA 4FK4A 3NGIA 2DTUA 4M3UA 4DU4A 2MZWB 4EYWA 4KHWA 3QEIA 2P1QB 1Q9XA 3LZIA 1FS1A 1IH7A 1NEXB 3J27A 4DTMA 4M3ZA 3C6PB 3RMBA 1FZ7E 4JS4A 1FZ4E 2B7MA 2P5GA 4EPHA 4EP9A 1IG9A 4AKHA 4ADNA 2MMBA 2VJ4A 3E4WA 2P1OB 2P5OA 4M3RA 2B1EA 4M45A 4FJXA 4HCBA 3MKSB 1FZHE 3QNNA 2DEBA 3SQ1A 3NCIA 2QXFA 3TL8B 3OGMB 4J2AA 4RG8A 4FJKA 3C95A 3QETA 2OZSA 3QESA 4M3YA 1XVBE 2RCUA 2OYQA 3WSOA 1FZ8E 4HCCA 3TAEA 4M3WA 4FK0A 3J2PA 5IBKB 3HGLA 4JS5A 3SQ2A 3S9HA 4KHSA 1LDKE 3QNOA 1XVGE 4FJMA 4FJ8A 4JRQA 4DTSA 1XU3E 3SUPA 2FW3A 3SNNA 4QNCA 2P1NB 1MHYG 4KHQA 4J2DA 4KHNA 4I9LA 4AKIA 1XVFE 3N1BA 3C94A 3NE6A 3KD5E 5H37A 4J2EA 4FJ7A 4E4BA 4FJJA 4KI6A 2H4TA 4AKGA 3L1NA 1FZ0E 2PFTA 1WAFA 4KHYA 2B8IA 4DTOA 1XVEE 3C6OB 2JH8A 2HD0A 1XVCE 3TABA 2P1PB 1MTYG 2E32A 5IREA 1FZ5E 3HL8A 4FJ9A 4M3TA 1MHZG 3CFRA 3RMDA 5IZ7A 3E4YA 3HP9A 3LD8A 3QEWA 3TAGA 2JHAA 4AI6A 1XMFE 4M41A 4RNGA 3L2OB 4DTUA 3SUQA 3QERA 1XL3C 2FYOA 4FJLA 2DY4A 1CLQA 3NDKA 4FVMA 1FZ1E 2JHPA 4FJGA 4QNDA 4GAMC 2JH9A 4J2BA 3CQ8A 4DTJA 2PFVA 3K2OA 2E31A 3SUNA 1MMOG 3CFOA 2VIXA 3TJYA 4DU3A 3SUOA 1XMHE 3TAFA 4FJNA 3SPYA 4DTXA 4DTRA 1FZ9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QND A;  4X5N A;  4RNG A;  4X5M A;  4QNC A; 
#chains in the Genus database with same CATH topology
 4I9Q A;  3L8B A;  3NHG A;  3SJJ A;  4FJI A;  1FXX A;  4B08 A;  1FZ6 E;  3V7D B;  3SI6 A;  4M42 A;  2VJ5 A;  1WAJ A;  1JW2 A;  2LF3 A;  3LZJ A;  3HGK E;  3SQ4 A;  2JHC A;  4ADO A;  3BVO A;  4FJH A;  3QEP A;  4KI4 A;  1P22 A;  3OGL B;  1FZ3 E;  2ATQ A;  2LF6 A;  2OVP B;  4IT5 A;  4RL5 A;  4X5N A;  3NAE A;  3RMA A;  3SCX A;  2OZM A;  3SVI A;  3SQ0 A;  4X5M A;  4ICG C;  2P1M B;  2JPN A;  3RWU A;  2OVR B;  3C6N B;  3KD1 E;  3UIQ A;  1XU5 E;  3L0M A;  3UO2 A;  3LDS A;  4I6J B;  4FK2 A;  1Q9Y A;  3OGK B;  3QEV A;  4M3X A;  1FZ2 E;  1XMG E;  3N1E A;  4DTN A;  3RMC A;  3SPZ A;  1XVD E;  4DU1 A;  4JRP A;  4KHU A;  2RKH A;  3UO3 A;  1FYZ E;  1FZI E;  4E3S A;  4FJ5 A;  3QEX A;  2OVQ B;  3LDB A;  3CFP A;  2YB5 A;  4DTP A;  4FK4 A;  3NGI A;  2DTU A;  4M3U A;  4DU4 A;  2MZW B;  4EYW A;  4KHW A;  3QEI A;  2P1Q B;  1Q9X A;  3LZI A;  1FS1 A;  1IH7 A;  1NEX B;  3J27 A;  4DTM A;  4M3Z A;  3C6P B;  3RMB A;  1FZ7 E;  4JS4 A;  1FZ4 E;  2B7M A;  2P5G A;  4EPH A;  4EP9 A;  1IG9 A;  4AKH A;  4ADN A;  2MMB A;  2VJ4 A;  3E4W A;  2P1O B;  2P5O A;  4M3R A;  2B1E A;  4M45 A;  4FJX A;  4HCB A;  3MKS B;  1FZH E;  3QNN A;  2DEB A;  3SQ1 A;  3NCI A;  2QXF A;  2MW2 A;  3TL8 B;  3OGM B;  4J2A A;  4RG8 A;  4FJK A;  3C95 A;  3QET A;  2OZS A;  3QES A;  4M3Y A;  1XVB E;  2RCU A;  2OYQ A;  3WSO A;  1FZ8 E;  4HCC A;  3TAE A;  4M3W A;  4FK0 A;  3J2P A;  5IBK B;  3HGL A;  4JS5 A;  3SQ2 A;  3S9H A;  4KHS A;  1LDK E;  3QNO A;  1XVG E;  4FJM A;  4FJ8 A;  4JRQ A;  4DTS A;  1XU3 E;  3SUP A;  2FW3 A;  3SNN A;  4QNC A;  2P1N B;  1MHY G;  4KHQ A;  4J2D A;  4KHN A;  4I9L A;  4AKI A;  1XVF E;  3N1B A;  3C94 A;  3NE6 A;  1N1C A;  5H37 A;  3KD5 E;  4J2E A;  4FJ7 A;  4E4B A;  4FJJ A;  4KI6 A;  1FPO A;  2H4T A;  3L1N A;  4AKG A;  1FZ0 E;  2PFT A;  1WAF A;  4KHY A;  2B8I A;  4DTO A;  1XVE E;  3C6O B;  2JH8 A;  2HD0 A;  1XVC E;  3TAB A;  2P1P B;  1MTY G;  2E32 A;  5IRE A;  1FZ5 E;  3HL8 A;  4FJ9 A;  4M3T A;  1MHZ G;  3CFR A;  3RMD A;  5IZ7 A;  2JQT A;  3E4Y A;  3HP9 A;  3LD8 A;  3QEW A;  3TAG A;  2JHA A;  4AI6 A;  1XMF E;  4M41 A;  4RNG A;  3L2O B;  4DTU A;  3SUQ A;  3QER A;  1XL3 C;  2FYO A;  4FJL A;  2DY4 A;  1CLQ A;  3NDK A;  4FVM A;  1FZ1 E;  2JHP A;  4FJG A;  4QND A;  4GAM C;  2JH9 A;  2K5S A;  4J2B A;  3CQ8 A;  4DTJ A;  2PFV A;  3K2O A;  2E31 A;  3SUN A;  1MMO G;  3CFO A;  2VIX A;  3TJY A;  4DU3 A;  3SUO A;  1XMH E;  3TAF A;  4FJN A;  3SPY A;  4DTX A;  4DTR A;  1FZ9 E; 
#chains in the Genus database with same CATH homology
 4I9Q A;  3L8B A;  3NHG A;  3SJJ A;  4FJI A;  1FXX A;  4B08 A;  1FZ6 E;  3V7D B;  3SI6 A;  4M42 A;  2VJ5 A;  1WAJ A;  2LF3 A;  3LZJ A;  3HGK E;  3SQ4 A;  2JHC A;  4ADO A;  4FJH A;  3QEP A;  4KI4 A;  1P22 A;  3OGL B;  1FZ3 E;  2ATQ A;  2LF6 A;  2OVP B;  4RL5 A;  3NAE A;  4X5N A;  3SCX A;  3RMA A;  2OZM A;  3SVI A;  3SQ0 A;  4X5M A;  2P1M B;  2JPN A;  3RWU A;  2OVR B;  3C6N B;  3KD1 E;  3UIQ A;  1XU5 E;  3L0M A;  3LDS A;  4FK2 A;  4I6J B;  1Q9Y A;  3OGK B;  3QEV A;  4M3X A;  1FZ2 E;  1XMG E;  3N1E A;  4DTN A;  3RMC A;  3SPZ A;  1XVD E;  4DU1 A;  4JRP A;  4KHU A;  4E3S A;  1FYZ E;  1FZI E;  4FJ5 A;  3QEX A;  2OVQ B;  3LDB A;  3CFP A;  2YB5 A;  4DTP A;  4FK4 A;  3NGI A;  2DTU A;  4M3U A;  4DU4 A;  2MZW B;  4EYW A;  4KHW A;  3QEI A;  2P1Q B;  1Q9X A;  3LZI A;  1FS1 A;  1IH7 A;  1NEX B;  3J27 A;  4DTM A;  4M3Z A;  3C6P B;  3RMB A;  1FZ7 E;  4JS4 A;  1FZ4 E;  2B7M A;  2P5G A;  4EPH A;  4EP9 A;  1IG9 A;  4AKH A;  4ADN A;  2MMB A;  2VJ4 A;  3E4W A;  2P1O B;  2P5O A;  4M3R A;  2B1E A;  4M45 A;  4FJX A;  4HCB A;  3MKS B;  1FZH E;  3QNN A;  2DEB A;  3SQ1 A;  3NCI A;  2QXF A;  3TL8 B;  3OGM B;  4J2A A;  4RG8 A;  4FJK A;  3C95 A;  3QET A;  2OZS A;  3QES A;  4M3Y A;  1XVB E;  2RCU A;  2OYQ A;  3WSO A;  1FZ8 E;  4HCC A;  3TAE A;  4M3W A;  4FK0 A;  3J2P A;  5IBK B;  3HGL A;  4JS5 A;  3SQ2 A;  3S9H A;  4KHS A;  1LDK E;  3QNO A;  1XVG E;  4FJM A;  4FJ8 A;  4JRQ A;  4DTS A;  1XU3 E;  3SUP A;  2FW3 A;  3SNN A;  4QNC A;  2P1N B;  1MHY G;  4KHQ A;  4J2D A;  4KHN A;  4I9L A;  4AKI A;  1XVF E;  3N1B A;  3C94 A;  3NE6 A;  3KD5 E;  5H37 A;  4J2E A;  4FJ7 A;  4E4B A;  4FJJ A;  4KI6 A;  2H4T A;  4AKG A;  3L1N A;  1FZ0 E;  2PFT A;  1WAF A;  4KHY A;  2B8I A;  4DTO A;  1XVE E;  3C6O B;  2JH8 A;  2HD0 A;  1XVC E;  3TAB A;  2P1P B;  1MTY G;  2E32 A;  5IRE A;  1FZ5 E;  3HL8 A;  4FJ9 A;  4M3T A;  1MHZ G;  3CFR A;  3RMD A;  5IZ7 A;  3E4Y A;  3HP9 A;  3LD8 A;  3QEW A;  3TAG A;  2JHA A;  4AI6 A;  1XMF E;  4M41 A;  4RNG A;  3L2O B;  4DTU A;  3SUQ A;  3QER A;  1XL3 C;  2FYO A;  4FJL A;  2DY4 A;  1CLQ A;  3NDK A;  4FVM A;  1FZ1 E;  2JHP A;  4FJG A;  4QND A;  4GAM C;  2JH9 A;  4J2B A;  3CQ8 A;  4DTJ A;  2PFV A;  3K2O A;  2E31 A;  3SUN A;  1MMO G;  3CFO A;  2VIX A;  3TJY A;  4DU3 A;  3SUO A;  1XMH E;  3TAF A;  4FJN A;  3SPY A;  4DTX A;  4DTR A;  1FZ9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...