4QNCA

Crystal structure of a semisweet in an occluded state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemical transport protein
publication title Structures of bacterial homologues of SWEET transporters in two distinct conformations.
pubmed doi rcsb
source organism Leptospira biflexa serovar patoc
molecule tags Membrane protein
total genus 32
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4qncA00
4X5NA 4QNCA 4QNDA 4RNGA 4X5MA
chains in the Genus database with same CATH superfamily
3L8BA 4I9QA 3SCXA 3LD8A 1FZ2E 3QESA 2MW2A 2RKHA 1FZ1E 2DEBA 3QERA 4M3YA 3C95A 3QEPA 4KI4A 4M3RA 2VJ5A 1XVBE 5IZ7A 2VIXA 3V7DB 4FJIA 3L0MA 3N1EA 4FJMA 4DTUA 2HD0A 2DY4A 5H37A 4FJXA 4KHWA 3J2PA 2OVQB 1FZHE 1XMHE 4M3ZA 2JQTA 3TJYA 2RCUA 4M41A 3C6PB 3LDBA 3SQ4A 4QNDA 2PFTA 2JHAA 1WAFA 4FJGA 4J2AA 4FJ8A 4KHSA 2JHCA 4J2BA 3C94A 2OZSA 3OGLB 4E4BA 4FJ7A 2JH9A 3TAEA 1FZ8E 4ADOA 3SPZA 4JS5A 3QNNA 4EYWA 1FZ9E 3UO3A 3QEXA 4FK2A 4JRQA 4X5MA 3QEIA 4DTSA 2JH8A 1XU3E 3CFPA 4X5NA 3NGIA 3KD5E 4AKGA 1FYZE 3TAFA 4AKHA 4DU3A 4DTNA 1MTYG 4DTOA 2P1MB 3CFOA 3K2OA 4DU4A 4KHQA 3OGMB 1CLQA 2E32A 2MMBA 4EPHA 2H4TA 1WAJA 1XMFE 3HL8A 3N1BA 1FZIE 4KHUA 4DU1A 1FS1A 4EP9A 4FK0A 4JS4A 3BVOA 4DTRA 2FYOA 3RMBA 3RMCA 3QEWA 1IG9A 2P1NB 4M3WA 1XVEE 2DTUA 3LDSA 3MKSB 4FJHA 3TABA 3SUNA 1MMOG 4FJ5A 3SNNA 4E3SA 1Q9YA 1FZ5E 3E4WA 4RL5A 4J2DA 2E31A 3NAEA 2LF6A 2P1OB 2YB5A 3C6NB 2JHPA 3SUQA 3SUOA 1JW2A 2P1PB 5IREA 3QETA 3WSOA 3SI6A 4FJLA 1LDKE 1XMGE 3QEVA 1NEXB 3NHGA 1MHZG 3L1NA 1MHYG 4I9LA 3L2OB 5IBKB 4JRPA 4B08A 1FZ4E 2LF3A 3HGLA 3SJJA 4GAMC 1Q9XA 3S9HA 1P22A 3C6OB 2QXFA 2PFVA 4ICGC 4DTPA 4J2EA 4M3XA 2K5SA 2OVRB 2OVPB 3SVIA 2VJ4A 4AKIA 3NDKA 3J27A 4QNCA 4M3UA 4DTXA 1XU5E 4FJ9A 3E4YA 3NCIA 3OGKB 3SUPA 2ATQA 3CFRA 4I6JB 2P5OA 2MZWB 3LZIA 3UIQA 2P1QB 3SPYA 3NE6A 1N1CA 3RMDA 3KD1E 3SQ1A 1IH7A 4ADNA 4FK4A 4DTMA 1XVFE 3SQ2A 4M45A 4M3TA 2JPNA 3LZJA 4FVMA 3SQ0A 4FJJA 1XVCE 4FJNA 4AI6A 4RNGA 2FW3A 1FZ6E 4KI6A 4RG8A 1FZ3E 1FZ0E 1FPOA 4FJKA 1FXXA 2P5GA 4DTJA 2OYQA 1XVGE 4KHNA 1XL3C 2B7MA 3RMAA 3TL8B 3QNOA 3CQ8A 1FZ7E 2B1EA 2OZMA 3UO2A 4HCCA 4HCBA 4M42A 2B8IA 4KHYA 3HGKE 1XVDE 3RWUA 3HP9A 4IT5A 3TAGA
chains in the Genus database with same CATH topology
3L8BA 4I9QA 3SCXA 3LD8A 1FZ2E 3QESA 1FZ1E 2DEBA 3QERA 4M3YA 3C95A 3QEPA 4KI4A 4M3RA 2VJ5A 1XVBE 5IZ7A 2VIXA 3V7DB 4FJIA 3L0MA 3N1EA 4FJMA 4DTUA 2HD0A 2DY4A 5H37A 4FJXA 4KHWA 3J2PA 2OVQB 1FZHE 1XMHE 4M3ZA 3TJYA 2RCUA 4M41A 3C6PB 3LDBA 3SQ4A 4QNDA 2PFTA 2JHAA 1WAFA 4FJGA 4J2AA 4FJ8A 4KHSA 2JHCA 4J2BA 3C94A 2OZSA 3OGLB 4E4BA 4FJ7A 2JH9A 3TAEA 1FZ8E 4ADOA 3SPZA 4JS5A 3QNNA 4EYWA 1FZ9E 4FK2A 3QEXA 4JRQA 4X5MA 3QEIA 4DTSA 2JH8A 1XU3E 3CFPA 4X5NA 3NGIA 3KD5E 4AKGA 1FYZE 3TAFA 4AKHA 4DU3A 4DTNA 1MTYG 4DTOA 2P1MB 3CFOA 3K2OA 4DU4A 4KHQA 3OGMB 1CLQA 2E32A 2MMBA 4EPHA 2H4TA 1WAJA 1XMFE 3HL8A 3N1BA 1FZIE 4KHUA 4DU1A 1FS1A 4EP9A 4FK0A 4JS4A 4DTRA 2FYOA 3RMBA 3RMCA 3QEWA 1IG9A 2P1NB 4M3WA 1XVEE 2DTUA 3LDSA 3MKSB 4FJHA 3TABA 3SUNA 1MMOG 4FJ5A 3SNNA 4E3SA 1Q9YA 1FZ5E 3E4WA 4RL5A 4J2DA 2E31A 3NAEA 2LF6A 2P1OB 2YB5A 3C6NB 2JHPA 3SUQA 3SUOA 2P1PB 5IREA 3QETA 3WSOA 3SI6A 4FJLA 1LDKE 1XMGE 3QEVA 1NEXB 3NHGA 1MHZG 3L1NA 1MHYG 4I9LA 3L2OB 5IBKB 4JRPA 4B08A 1FZ4E 2LF3A 3HGLA 3SJJA 4GAMC 1Q9XA 3S9HA 1P22A 3C6OB 2QXFA 2PFVA 4DTPA 4J2EA 4M3XA 2OVPB 2OVRB 3SVIA 2VJ4A 4AKIA 3NDKA 3J27A 4QNCA 4M3UA 4DTXA 1XU5E 4FJ9A 3E4YA 3NCIA 3OGKB 3SUPA 2ATQA 3CFRA 4I6JB 2P5OA 2MZWB 3LZIA 3UIQA 2P1QB 3SPYA 3NE6A 3RMDA 3KD1E 3SQ1A 1IH7A 4ADNA 4FK4A 4DTMA 1XVFE 3SQ2A 4M45A 4M3TA 2JPNA 3LZJA 4FVMA 3SQ0A 4FJJA 1XVCE 4FJNA 4AI6A 4RNGA 2FW3A 1FZ6E 4KI6A 4RG8A 1FZ3E 1FZ0E 4FJKA 1FXXA 2P5GA 4DTJA 2OYQA 1XVGE 4KHNA 1XL3C 2B7MA 3RMAA 3TL8B 3QNOA 3CQ8A 1FZ7E 2B1EA 2OZMA 4HCCA 4HCBA 4M42A 2B8IA 4KHYA 3HGKE 1XVDE 3RWUA 3HP9A 3TAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5N A;  4QNC A;  4QND A;  4RNG A;  4X5M A; 
#chains in the Genus database with same CATH topology
 3L8B A;  4I9Q A;  3SCX A;  3LD8 A;  1FZ2 E;  3QES A;  2MW2 A;  2RKH A;  1FZ1 E;  2DEB A;  3QER A;  4M3Y A;  3C95 A;  3QEP A;  4KI4 A;  4M3R A;  2VJ5 A;  1XVB E;  5IZ7 A;  2VIX A;  3V7D B;  4FJI A;  3L0M A;  3N1E A;  4FJM A;  4DTU A;  2HD0 A;  2DY4 A;  5H37 A;  4FJX A;  4KHW A;  3J2P A;  2OVQ B;  1FZH E;  1XMH E;  4M3Z A;  2JQT A;  3TJY A;  2RCU A;  4M41 A;  3C6P B;  3LDB A;  3SQ4 A;  4QND A;  2PFT A;  2JHA A;  1WAF A;  4FJG A;  4J2A A;  4FJ8 A;  4KHS A;  2JHC A;  4J2B A;  3C94 A;  2OZS A;  3OGL B;  4E4B A;  4FJ7 A;  2JH9 A;  3TAE A;  1FZ8 E;  4ADO A;  3SPZ A;  4JS5 A;  3QNN A;  4EYW A;  1FZ9 E;  3UO3 A;  3QEX A;  4FK2 A;  4JRQ A;  4X5M A;  3QEI A;  4DTS A;  2JH8 A;  1XU3 E;  3CFP A;  4X5N A;  3NGI A;  3KD5 E;  4AKG A;  1FYZ E;  3TAF A;  4AKH A;  4DU3 A;  4DTN A;  1MTY G;  4DTO A;  2P1M B;  3CFO A;  3K2O A;  4DU4 A;  4KHQ A;  3OGM B;  1CLQ A;  2E32 A;  2MMB A;  4EPH A;  2H4T A;  1WAJ A;  1XMF E;  3HL8 A;  3N1B A;  1FZI E;  4KHU A;  4DU1 A;  1FS1 A;  4EP9 A;  4FK0 A;  4JS4 A;  3BVO A;  4DTR A;  2FYO A;  3RMB A;  3RMC A;  3QEW A;  1IG9 A;  2P1N B;  4M3W A;  1XVE E;  2DTU A;  3LDS A;  3MKS B;  4FJH A;  3TAB A;  3SUN A;  1MMO G;  4FJ5 A;  3SNN A;  4E3S A;  1Q9Y A;  1FZ5 E;  3E4W A;  4RL5 A;  4J2D A;  2E31 A;  3NAE A;  2LF6 A;  2P1O B;  2YB5 A;  3C6N B;  2JHP A;  3SUQ A;  3SUO A;  1JW2 A;  2P1P B;  5IRE A;  3QET A;  3WSO A;  3SI6 A;  4FJL A;  1LDK E;  1XMG E;  3QEV A;  1NEX B;  3NHG A;  1MHZ G;  3L1N A;  1MHY G;  4I9L A;  3L2O B;  5IBK B;  4JRP A;  4B08 A;  1FZ4 E;  2LF3 A;  3HGL A;  3SJJ A;  4GAM C;  1Q9X A;  3S9H A;  1P22 A;  3C6O B;  2QXF A;  2PFV A;  4ICG C;  4DTP A;  4J2E A;  4M3X A;  2K5S A;  2OVR B;  2OVP B;  3SVI A;  2VJ4 A;  4AKI A;  3NDK A;  3J27 A;  4QNC A;  4M3U A;  4DTX A;  1XU5 E;  4FJ9 A;  3E4Y A;  3NCI A;  3OGK B;  3SUP A;  2ATQ A;  3CFR A;  4I6J B;  2P5O A;  2MZW B;  3LZI A;  3UIQ A;  2P1Q B;  3SPY A;  3NE6 A;  1N1C A;  3RMD A;  3KD1 E;  3SQ1 A;  1IH7 A;  4ADN A;  4FK4 A;  4DTM A;  1XVF E;  3SQ2 A;  4M45 A;  4M3T A;  2JPN A;  3LZJ A;  4FVM A;  3SQ0 A;  4FJJ A;  1XVC E;  4FJN A;  4AI6 A;  4RNG A;  2FW3 A;  1FZ6 E;  4KI6 A;  4RG8 A;  1FZ3 E;  1FZ0 E;  1FPO A;  4FJK A;  1FXX A;  2P5G A;  4DTJ A;  2OYQ A;  1XVG E;  4KHN A;  1XL3 C;  2B7M A;  3RMA A;  3TL8 B;  3QNO A;  3CQ8 A;  1FZ7 E;  2B1E A;  2OZM A;  3UO2 A;  4HCC A;  4HCB A;  4M42 A;  2B8I A;  4KHY A;  3HGK E;  1XVD E;  3RWU A;  3HP9 A;  4IT5 A;  3TAG A; 
#chains in the Genus database with same CATH homology
 3L8B A;  4I9Q A;  3SCX A;  3LD8 A;  1FZ2 E;  3QES A;  1FZ1 E;  2DEB A;  3QER A;  4M3Y A;  3C95 A;  3QEP A;  4KI4 A;  4M3R A;  2VJ5 A;  1XVB E;  5IZ7 A;  2VIX A;  3V7D B;  4FJI A;  3L0M A;  3N1E A;  4FJM A;  4DTU A;  2HD0 A;  2DY4 A;  5H37 A;  4FJX A;  4KHW A;  3J2P A;  2OVQ B;  1FZH E;  1XMH E;  4M3Z A;  3TJY A;  2RCU A;  4M41 A;  3C6P B;  3LDB A;  3SQ4 A;  4QND A;  2PFT A;  2JHA A;  1WAF A;  4FJG A;  4J2A A;  4FJ8 A;  4KHS A;  2JHC A;  4J2B A;  3C94 A;  2OZS A;  3OGL B;  4E4B A;  4FJ7 A;  2JH9 A;  3TAE A;  1FZ8 E;  4ADO A;  3SPZ A;  4JS5 A;  3QNN A;  4EYW A;  1FZ9 E;  4FK2 A;  3QEX A;  4JRQ A;  4X5M A;  3QEI A;  4DTS A;  2JH8 A;  1XU3 E;  3CFP A;  4X5N A;  3NGI A;  3KD5 E;  4AKG A;  1FYZ E;  3TAF A;  4AKH A;  4DU3 A;  4DTN A;  1MTY G;  4DTO A;  2P1M B;  3CFO A;  3K2O A;  4DU4 A;  4KHQ A;  3OGM B;  1CLQ A;  2E32 A;  2MMB A;  4EPH A;  2H4T A;  1WAJ A;  1XMF E;  3HL8 A;  3N1B A;  1FZI E;  4KHU A;  4DU1 A;  1FS1 A;  4EP9 A;  4FK0 A;  4JS4 A;  4DTR A;  2FYO A;  3RMB A;  3RMC A;  3QEW A;  1IG9 A;  2P1N B;  4M3W A;  1XVE E;  2DTU A;  3LDS A;  3MKS B;  4FJH A;  3TAB A;  3SUN A;  1MMO G;  4FJ5 A;  3SNN A;  4E3S A;  1Q9Y A;  1FZ5 E;  3E4W A;  4RL5 A;  4J2D A;  2E31 A;  3NAE A;  2LF6 A;  2P1O B;  2YB5 A;  3C6N B;  2JHP A;  3SUQ A;  3SUO A;  2P1P B;  5IRE A;  3QET A;  3WSO A;  3SI6 A;  4FJL A;  1LDK E;  1XMG E;  3QEV A;  1NEX B;  3NHG A;  1MHZ G;  3L1N A;  1MHY G;  4I9L A;  3L2O B;  5IBK B;  4JRP A;  4B08 A;  1FZ4 E;  2LF3 A;  3HGL A;  3SJJ A;  4GAM C;  1Q9X A;  3S9H A;  1P22 A;  3C6O B;  2QXF A;  2PFV A;  4DTP A;  4J2E A;  4M3X A;  2OVP B;  2OVR B;  3SVI A;  2VJ4 A;  4AKI A;  3NDK A;  3J27 A;  4QNC A;  4M3U A;  4DTX A;  1XU5 E;  4FJ9 A;  3E4Y A;  3NCI A;  3OGK B;  3SUP A;  2ATQ A;  3CFR A;  4I6J B;  2P5O A;  2MZW B;  3LZI A;  3UIQ A;  2P1Q B;  3SPY A;  3NE6 A;  3RMD A;  3KD1 E;  3SQ1 A;  1IH7 A;  4ADN A;  4FK4 A;  4DTM A;  1XVF E;  3SQ2 A;  4M45 A;  4M3T A;  2JPN A;  3LZJ A;  4FVM A;  3SQ0 A;  4FJJ A;  1XVC E;  4FJN A;  4AI6 A;  4RNG A;  2FW3 A;  1FZ6 E;  4KI6 A;  4RG8 A;  1FZ3 E;  1FZ0 E;  4FJK A;  1FXX A;  2P5G A;  4DTJ A;  2OYQ A;  1XVG E;  4KHN A;  1XL3 C;  2B7M A;  3RMA A;  3TL8 B;  3QNO A;  3CQ8 A;  1FZ7 E;  2B1E A;  2OZM A;  4HCC A;  4HCB A;  4M42 A;  2B8I A;  4KHY A;  3HGK E;  1XVD E;  3RWU A;  3HP9 A;  3TAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...