4QNCA

Crystal structure of a semisweet in an occluded state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
b'MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemical transport protein
publication title Structures of bacterial homologues of SWEET transporters in two distinct conformations.
pubmed doi rcsb
source organism Leptospira biflexa serovar patoc
molecule tags Membrane protein
total genus 32
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4qncA00
4RNGA 4X5NA 4X5MA 4QNDA 4QNCA
chains in the Genus database with same CATH superfamily
4EP9A 3QETA 1P22A 3SQ1A 3QEXA 4DTUA 3KD1E 4AKHA 2RKHA 2OVQB 1FZHE 4HCCA 2H4TA 2PFTA 4FJ7A 4ADOA 4M3ZA 2PFVA 1FZ9E 1FXXA 2JH8A 3SPZA 3UIQA 4FJJA 3WSOA 3L2OB 5IREA 1NEXB 3SI6A 3QNOA 1MMOG 3C6NB 4J2EA 4EPHA 1XVGE 5IBKB 4KI4A 2LF6A 2VIXA 4E4BA 2RCUA 1MTYG 3S9HA 3SUPA 2OZSA 3LD8A 1Q9XA 4J2DA 2FYOA 2P5GA 2DEBA 2YB5A 4AKGA 4M3UA 2OVRB 2FW3A 3C6PB 3RWUA 2JH9A 5IZ7A 4KI6A 1MHYG 4ICGC 4I9LA 3LZIA 3KD5E 1XVEE 2P1MB 4FK4A 4AI6A 1LDKE 1XVCE 1FZ7E 3HGLA 4FJHA 3OGKB 3LDSA 3E4YA 2JHAA 4RL5A 2B8IA 3QNNA 2P1PB 4M3WA 1FZ4E 4ADNA 4FJ9A 4QNCA 3RMBA 3QESA 3TABA 2E32A 3NDKA 4FJIA 2K5SA 4FK0A 4DTXA 2ATQA 4FJMA 3MKSB 2P1NB 1XVDE 1XU5E 3N1EA 4FJLA 4M45A 3HL8A 3RMDA 1FYZE 2LF3A 1FS1A 2E31A 1XMHE 5H37A 3N1BA 4X5MA 1XVFE 4DTPA 4IT5A 4JRPA 1Q9YA 4J2AA 3SVIA 4DTSA 2MZWB 4RNGA 4AKIA 4FVMA 3NAEA 1FZ3E 1FZ0E 1N1CA 4B08A 2JHPA 3TAEA 4KHYA 1FPOA 3NCIA 3LDBA 3SJJA 4M41A 4KHWA 2B7MA 2P5OA 1FZIE 3OGMB 4I9QA 1FZ5E 2P1OB 4DU3A 3QEWA 4FJ5A 3HGKE 4M3TA 2VJ5A 4JS4A 2MMBA 4KHQA 1XMGE 2P1QB 1FZ2E 3C94A 1WAJA 1XMFE 2MW2A 2VJ4A 1XL3C 3QERA 4FJNA 3SCXA 4E3SA 4DTJA 2OVPB 4DTOA 1FZ8E 3RMCA 3SQ2A 4DTRA 4KHSA 3UO2A 3L8BA 3C6OB 4GAMC 2JHCA 3TAGA 3LZJA 4JRQA 1WAFA 4KHNA 2JPNA 3SQ4A 2HD0A 4M42A 3CQ8A 3HP9A 3OGLB 3NGIA 3J27A 4M3XA 3SUOA 3J2PA 3SUNA 2OYQA 3NE6A 3QEPA 1IH7A 4FJKA 3SUQA 2QXFA 1XVBE 4QNDA 1MHZG 3NHGA 4JS5A 4EYWA 1FZ1E 2B1EA 3V7DB 4DU1A 3QEVA 4DTMA 2OZMA 4M3YA 4HCBA 3TL8B 1FZ6E 3L0MA 3L1NA 3TAFA 3C95A 1XU3E 3SQ0A 4FJGA 3RMAA 2DTUA 2JQTA 1JW2A 3K2OA 1IG9A 4RG8A 3SNNA 3QEIA 4DTNA 1CLQA 3BVOA 4FJXA 3E4WA 3TJYA 4I6JB 4FJ8A 2DY4A 3CFPA 4J2BA 3CFOA 4X5NA 3SPYA 3UO3A 3CFRA 4FK2A 4M3RA 4KHUA 4DU4A
chains in the Genus database with same CATH topology
4EP9A 3QETA 1P22A 3SQ1A 3QEXA 4DTUA 3KD1E 4AKHA 2OVQB 1FZHE 4HCCA 2H4TA 2PFTA 4FJ7A 4ADOA 4M3ZA 2PFVA 1FZ9E 1FXXA 2JH8A 3SPZA 3UIQA 4FJJA 3WSOA 3L2OB 5IREA 1NEXB 3SI6A 3QNOA 1MMOG 3C6NB 4J2EA 4EPHA 1XVGE 5IBKB 4KI4A 2LF6A 2VIXA 4E4BA 2RCUA 1MTYG 3S9HA 3SUPA 2OZSA 3LD8A 1Q9XA 4J2DA 2FYOA 2P5GA 2DEBA 2YB5A 4AKGA 4M3UA 2OVRB 3C6PB 2FW3A 3RWUA 2JH9A 5IZ7A 4KI6A 1MHYG 4I9LA 3LZIA 3KD5E 1XVEE 2P1MB 4FK4A 4AI6A 1LDKE 1XVCE 1FZ7E 3HGLA 4FJHA 3OGKB 3LDSA 3E4YA 2JHAA 4RL5A 2B8IA 3QNNA 2P1PB 4M3WA 1FZ4E 4ADNA 4FJ9A 4QNCA 3RMBA 3QESA 3TABA 2E32A 3NDKA 4FJIA 4FK0A 4DTXA 2ATQA 4FJMA 3MKSB 2P1NB 1XVDE 1XU5E 3N1EA 4FJLA 4M45A 3HL8A 3RMDA 1FYZE 2LF3A 1FS1A 2E31A 1XMHE 5H37A 3N1BA 4X5MA 1XVFE 4DTPA 4JRPA 1Q9YA 4J2AA 3SVIA 4DTSA 2MZWB 4RNGA 4AKIA 4FVMA 3NAEA 1FZ3E 1FZ0E 4B08A 3TAEA 2JHPA 4KHYA 3NCIA 3LDBA 3SJJA 4M41A 4KHWA 2B7MA 2P5OA 1FZIE 3OGMB 4I9QA 1FZ5E 2P1OB 4DU3A 3QEWA 4FJ5A 3HGKE 4M3TA 2VJ5A 4JS4A 2MMBA 4KHQA 1XMGE 2P1QB 1FZ2E 3C94A 1WAJA 1XMFE 2VJ4A 3QERA 1XL3C 4FJNA 3SCXA 4E3SA 4DTJA 2OVPB 4DTOA 1FZ8E 3RMCA 3SQ2A 4DTRA 4KHSA 3L8BA 3C6OB 4GAMC 2JHCA 3TAGA 3LZJA 4JRQA 1WAFA 4KHNA 2JPNA 3SQ4A 2HD0A 4M42A 3CQ8A 3HP9A 3OGLB 3NGIA 3J27A 4M3XA 3SUOA 3J2PA 3SUNA 2OYQA 3NE6A 3QEPA 1IH7A 4FJKA 3SUQA 2QXFA 1XVBE 4QNDA 1MHZG 3NHGA 4JS5A 4EYWA 1FZ1E 2B1EA 3V7DB 4DU1A 3QEVA 4DTMA 2OZMA 4M3YA 4HCBA 3TL8B 1FZ6E 3L0MA 3L1NA 3TAFA 3C95A 1XU3E 3SQ0A 4FJGA 3RMAA 2DTUA 3K2OA 1IG9A 4RG8A 3SNNA 3QEIA 4DTNA 1CLQA 4FJXA 3E4WA 3TJYA 4I6JB 4FJ8A 2DY4A 3CFPA 4J2BA 3CFOA 4X5NA 3SPYA 3CFRA 4FK2A 4M3RA 4KHUA 4DU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNG A;  4X5N A;  4X5M A;  4QND A;  4QNC A; 
#chains in the Genus database with same CATH topology
 4EP9 A;  3QET A;  1P22 A;  3SQ1 A;  3QEX A;  4DTU A;  3KD1 E;  4AKH A;  2RKH A;  2OVQ B;  1FZH E;  4HCC A;  2H4T A;  2PFT A;  4FJ7 A;  4ADO A;  4M3Z A;  2PFV A;  1FZ9 E;  1FXX A;  2JH8 A;  3SPZ A;  3UIQ A;  4FJJ A;  3WSO A;  3L2O B;  5IRE A;  1NEX B;  3SI6 A;  3QNO A;  1MMO G;  3C6N B;  4J2E A;  4EPH A;  1XVG E;  5IBK B;  4KI4 A;  2LF6 A;  2VIX A;  4E4B A;  2RCU A;  1MTY G;  3S9H A;  3SUP A;  2OZS A;  3LD8 A;  1Q9X A;  4J2D A;  2FYO A;  2P5G A;  2DEB A;  2YB5 A;  4AKG A;  4M3U A;  2OVR B;  2FW3 A;  3C6P B;  3RWU A;  2JH9 A;  5IZ7 A;  4KI6 A;  1MHY G;  4ICG C;  4I9L A;  3LZI A;  3KD5 E;  1XVE E;  2P1M B;  4FK4 A;  4AI6 A;  1LDK E;  1XVC E;  1FZ7 E;  3HGL A;  4FJH A;  3OGK B;  3LDS A;  3E4Y A;  2JHA A;  4RL5 A;  2B8I A;  3QNN A;  2P1P B;  4M3W A;  1FZ4 E;  4ADN A;  4FJ9 A;  4QNC A;  3RMB A;  3QES A;  3TAB A;  2E32 A;  3NDK A;  4FJI A;  2K5S A;  4FK0 A;  4DTX A;  2ATQ A;  4FJM A;  3MKS B;  2P1N B;  1XVD E;  1XU5 E;  3N1E A;  4FJL A;  4M45 A;  3HL8 A;  3RMD A;  1FYZ E;  2LF3 A;  1FS1 A;  2E31 A;  1XMH E;  5H37 A;  3N1B A;  4X5M A;  1XVF E;  4DTP A;  4IT5 A;  4JRP A;  1Q9Y A;  4J2A A;  3SVI A;  4DTS A;  2MZW B;  4RNG A;  4AKI A;  4FVM A;  3NAE A;  1FZ3 E;  1FZ0 E;  1N1C A;  4B08 A;  2JHP A;  3TAE A;  4KHY A;  1FPO A;  3NCI A;  3LDB A;  3SJJ A;  4M41 A;  4KHW A;  2B7M A;  2P5O A;  1FZI E;  3OGM B;  4I9Q A;  1FZ5 E;  2P1O B;  4DU3 A;  3QEW A;  4FJ5 A;  3HGK E;  4M3T A;  2VJ5 A;  4JS4 A;  2MMB A;  4KHQ A;  1XMG E;  2P1Q B;  1FZ2 E;  3C94 A;  1WAJ A;  1XMF E;  2MW2 A;  2VJ4 A;  1XL3 C;  3QER A;  4FJN A;  3SCX A;  4E3S A;  4DTJ A;  2OVP B;  4DTO A;  1FZ8 E;  3RMC A;  3SQ2 A;  4DTR A;  4KHS A;  3UO2 A;  3L8B A;  3C6O B;  4GAM C;  2JHC A;  3TAG A;  3LZJ A;  4JRQ A;  1WAF A;  4KHN A;  2JPN A;  3SQ4 A;  2HD0 A;  4M42 A;  3CQ8 A;  3HP9 A;  3OGL B;  3NGI A;  3J27 A;  4M3X A;  3SUO A;  3J2P A;  3SUN A;  2OYQ A;  3NE6 A;  3QEP A;  1IH7 A;  4FJK A;  3SUQ A;  2QXF A;  1XVB E;  4QND A;  1MHZ G;  3NHG A;  4JS5 A;  4EYW A;  1FZ1 E;  2B1E A;  3V7D B;  4DU1 A;  3QEV A;  4DTM A;  2OZM A;  4M3Y A;  4HCB A;  3TL8 B;  1FZ6 E;  3L0M A;  3L1N A;  3TAF A;  3C95 A;  1XU3 E;  3SQ0 A;  4FJG A;  3RMA A;  2DTU A;  2JQT A;  1JW2 A;  3K2O A;  1IG9 A;  4RG8 A;  3SNN A;  3QEI A;  4DTN A;  1CLQ A;  3BVO A;  4FJX A;  3E4W A;  3TJY A;  4I6J B;  4FJ8 A;  2DY4 A;  3CFP A;  4J2B A;  3CFO A;  4X5N A;  3SPY A;  3UO3 A;  3CFR A;  4FK2 A;  4M3R A;  4KHU A;  4DU4 A; 
#chains in the Genus database with same CATH homology
 4EP9 A;  3QET A;  1P22 A;  3SQ1 A;  3QEX A;  4DTU A;  3KD1 E;  4AKH A;  2OVQ B;  1FZH E;  4HCC A;  2H4T A;  2PFT A;  4FJ7 A;  4ADO A;  4M3Z A;  2PFV A;  1FZ9 E;  1FXX A;  2JH8 A;  3SPZ A;  3UIQ A;  4FJJ A;  3WSO A;  3L2O B;  5IRE A;  1NEX B;  3SI6 A;  3QNO A;  1MMO G;  3C6N B;  4J2E A;  4EPH A;  1XVG E;  5IBK B;  4KI4 A;  2LF6 A;  2VIX A;  4E4B A;  2RCU A;  1MTY G;  3S9H A;  3SUP A;  2OZS A;  3LD8 A;  1Q9X A;  4J2D A;  2FYO A;  2P5G A;  2DEB A;  2YB5 A;  4AKG A;  4M3U A;  2OVR B;  3C6P B;  2FW3 A;  3RWU A;  2JH9 A;  5IZ7 A;  4KI6 A;  1MHY G;  4I9L A;  3LZI A;  3KD5 E;  1XVE E;  2P1M B;  4FK4 A;  4AI6 A;  1LDK E;  1XVC E;  1FZ7 E;  3HGL A;  4FJH A;  3OGK B;  3LDS A;  3E4Y A;  2JHA A;  4RL5 A;  2B8I A;  3QNN A;  2P1P B;  4M3W A;  1FZ4 E;  4ADN A;  4FJ9 A;  4QNC A;  3RMB A;  3QES A;  3TAB A;  2E32 A;  3NDK A;  4FJI A;  4FK0 A;  4DTX A;  2ATQ A;  4FJM A;  3MKS B;  2P1N B;  1XVD E;  1XU5 E;  3N1E A;  4FJL A;  4M45 A;  3HL8 A;  3RMD A;  1FYZ E;  2LF3 A;  1FS1 A;  2E31 A;  1XMH E;  5H37 A;  3N1B A;  4X5M A;  1XVF E;  4DTP A;  4JRP A;  1Q9Y A;  4J2A A;  3SVI A;  4DTS A;  2MZW B;  4RNG A;  4AKI A;  4FVM A;  3NAE A;  1FZ3 E;  1FZ0 E;  4B08 A;  3TAE A;  2JHP A;  4KHY A;  3NCI A;  3LDB A;  3SJJ A;  4M41 A;  4KHW A;  2B7M A;  2P5O A;  1FZI E;  3OGM B;  4I9Q A;  1FZ5 E;  2P1O B;  4DU3 A;  3QEW A;  4FJ5 A;  3HGK E;  4M3T A;  2VJ5 A;  4JS4 A;  2MMB A;  4KHQ A;  1XMG E;  2P1Q B;  1FZ2 E;  3C94 A;  1WAJ A;  1XMF E;  2VJ4 A;  3QER A;  1XL3 C;  4FJN A;  3SCX A;  4E3S A;  4DTJ A;  2OVP B;  4DTO A;  1FZ8 E;  3RMC A;  3SQ2 A;  4DTR A;  4KHS A;  3L8B A;  3C6O B;  4GAM C;  2JHC A;  3TAG A;  3LZJ A;  4JRQ A;  1WAF A;  4KHN A;  2JPN A;  3SQ4 A;  2HD0 A;  4M42 A;  3CQ8 A;  3HP9 A;  3OGL B;  3NGI A;  3J27 A;  4M3X A;  3SUO A;  3J2P A;  3SUN A;  2OYQ A;  3NE6 A;  3QEP A;  1IH7 A;  4FJK A;  3SUQ A;  2QXF A;  1XVB E;  4QND A;  1MHZ G;  3NHG A;  4JS5 A;  4EYW A;  1FZ1 E;  2B1E A;  3V7D B;  4DU1 A;  3QEV A;  4DTM A;  2OZM A;  4M3Y A;  4HCB A;  3TL8 B;  1FZ6 E;  3L0M A;  3L1N A;  3TAF A;  3C95 A;  1XU3 E;  3SQ0 A;  4FJG A;  3RMA A;  2DTU A;  3K2O A;  1IG9 A;  4RG8 A;  3SNN A;  3QEI A;  4DTN A;  1CLQ A;  4FJX A;  3E4W A;  3TJY A;  4I6J B;  4FJ8 A;  2DY4 A;  3CFP A;  4J2B A;  3CFO A;  4X5N A;  3SPY A;  3CFR A;  4FK2 A;  4M3R A;  4KHU A;  4DU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...