4QNCA

Crystal structure of a semisweet in an occluded state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial homologues of SWEET transporters in two distinct conformations.
pubmed doi rcsb
source organism Leptospira biflexa serovar patoc
molecule tags Membrane protein
molecule keywords chemical transport protein
total genus 32
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4qncA00
4RNGA 4X5MA 4QNCA 4X5NA 4QNDA
chains in the Genus database with same CATH superfamily
3N1BA 4FK2A 3CFPA 2RKHA 4I9LA 2JQTA 3QESA 3RWUA 4EPHA 4J2AA 1FZ4E 3SVIA 5IBKB 1IH7A 2OVPB 4I9QA 1XMFE 4JS4A 3SUNA 2HD0A 1FXXA 2OYQA 3C94A 4X5MA 4DTRA 2P5OA 3KD5E 4KI4A 1FZ8E 1FZHE 2MZWB 2E31A 2FW3A 1P22A 4FJ8A 5H37A 4DTPA 5IZ7A 1FYZE 3QETA 4QNCA 1FZ3E 1FPOA 3RMCA 3RMAA 2P5GA 4EP9A 4RG8A 3HP9A 4M41A 2VIXA 4J2EA 4DTUA 2JHCA 4RNGA 4M3RA 3SUQA 2OVRB 4KHSA 4M3YA 4J2BA 1JW2A 3HL8A 4DU3A 2DEBA 4FJXA 4KHNA 1FZ6E 2P1PB 2E32A 2OVQB 4IT5A 2DTUA 3SQ2A 2B1EA 4DTOA 4DTJA 3SJJA 4RL5A 1XU3E 4FK0A 4M3XA 3TAFA 4FJNA 4AKHA 5IREA 1CLQA 1N1CA 3OGMB 4FJLA 4DTXA 3SPYA 3TAGA 4AKIA 3CQ8A 4DU4A 1XVDE 1LDKE 3LZJA 2JH8A 1MMOG 3UIQA 1XU5E 3TABA 3C95A 3NE6A 3LDSA 3NAEA 4FJ5A 4FJ7A 4KHWA 3OGKB 4X5NA 4DTSA 2K5SA 3C6OB 1Q9YA 3C6PB 4FJ9A 4E4BA 2FYOA 2MMBA 3K2OA 4ICGC 3TL8B 3QERA 1IG9A 4M3WA 4EYWA 2P1MB 1FZ9E 1FZ5E 3RMBA 2H4TA 4KHQA 4FVMA 1MHZG 3SQ1A 1XL3C 1NEXB 3CFOA 4DTNA 4JRQA 3QNOA 3SCXA 4FJGA 3SNNA 2B8IA 2B7MA 1XVBE 3TJYA 3QEXA 3SPZA 3MKSB 4JRPA 3L1NA 1FZ1E 1XVFE 3SI6A 2OZMA 3L2OB 4GAMC 3QEVA 1MTYG 1FZIE 4M3TA 3J2PA 2QXFA 2PFTA 3HGLA 4FJKA 1WAFA 3RMDA 3E4WA 3L0MA 3NDKA 4E3SA 2JPNA 3QEPA 4KHYA 1FZ2E 3SUOA 3KD1E 4QNDA 3WSOA 3NCIA 3SQ4A 2VJ5A 3S9HA 2OZSA 1FS1A 3LDBA 4M45A 3NGIA 3LZIA 3QEIA 4DU1A 1XMGE 4HCBA 2P1OB 2MW2A 4DTMA 1FZ7E 1XVEE 2LF3A 3SUPA 4M42A 3J27A 4ADNA 4FJJA 1XMHE 3E4YA 4FK4A 4FJIA 3CFRA 4KHUA 2JH9A 4JS5A 4HCCA 2RCUA 1WAJA 1FZ0E 3BVOA 3L8BA 3C6NB 1XVCE 3N1EA 1Q9XA 3QNNA 4J2DA 4KI6A 3TAEA 3UO2A 3V7DB 2ATQA 2JHPA 4AKGA 3LD8A 4FJMA 3UO3A 4FJHA 2PFVA 3OGLB 4ADOA 1XVGE 2LF6A 3NHGA 4AI6A 4B08A 4M3ZA 4M3UA 2P1NB 2YB5A 3QEWA 2P1QB 1MHYG 3SQ0A 2VJ4A 4I6JB 2DY4A 3HGKE 2JHAA
chains in the Genus database with same CATH topology
3N1BA 4FK2A 3CFPA 4I9LA 3QESA 3RWUA 4J2DA 4EPHA 4J2AA 1FZ4E 3SVIA 5IBKB 1IH7A 2OVPB 4I9QA 1XMFE 4JS4A 3SUNA 2HD0A 1FXXA 2OYQA 3C94A 4X5MA 4DTRA 2P5OA 3KD5E 4KI4A 1FZ8E 1FZHE 2MZWB 2E31A 2FW3A 1P22A 4FJ8A 5H37A 4DTPA 5IZ7A 1FYZE 3QETA 4QNCA 1FZ3E 3RMCA 3RMAA 2P5GA 4EP9A 4RG8A 3HP9A 4M41A 2VIXA 4J2EA 4DTUA 2JHCA 4RNGA 4M3RA 3SUQA 2OVRB 4KHSA 4M3YA 4J2BA 3HL8A 4DU3A 2DEBA 4FJXA 4KHNA 1FZ6E 2P1PB 2E32A 2OVQB 2DTUA 3SQ2A 2B1EA 4DTOA 4DTJA 3SJJA 4RL5A 1XU3E 4FK0A 4M3XA 3TAFA 4FJNA 4AKHA 5IREA 1CLQA 4AKIA 3OGMB 4FJLA 4DTXA 3SPYA 3TAGA 3CQ8A 4DU4A 1XVDE 1LDKE 3LZJA 2JH8A 1MMOG 3UIQA 1XU5E 3TABA 3C95A 3NE6A 3LDSA 3NAEA 4FJ5A 4FJ7A 4KHWA 3OGKB 4X5NA 4DTSA 3C6OB 1Q9YA 3C6PB 4FJ9A 4E4BA 2FYOA 2MMBA 3K2OA 3QERA 3TL8B 1IG9A 4M3WA 4EYWA 2P1MB 1FZ9E 1FZ5E 3RMBA 2H4TA 4KHQA 4FVMA 1MHZG 3SQ1A 1XL3C 1NEXB 3CFOA 4DTNA 4JRQA 3QNOA 3SCXA 4FJGA 3SNNA 2B8IA 2B7MA 1XVBE 3TJYA 3QEXA 3SPZA 3MKSB 4JRPA 3L1NA 1FZ1E 1XVFE 3SI6A 2OZMA 3L2OB 4GAMC 3QEVA 1MTYG 1FZIE 4M3TA 3J2PA 2QXFA 2PFTA 3HGLA 4FJKA 1WAFA 3RMDA 3E4WA 3L0MA 3NDKA 4E3SA 2JPNA 3QEPA 4KHYA 1FZ2E 3SUOA 3KD1E 4QNDA 3WSOA 3NCIA 3SQ4A 2VJ5A 3S9HA 2OZSA 1FS1A 3LDBA 4M45A 3NGIA 3LZIA 3QEIA 4DU1A 1XMGE 4HCBA 2P1OB 4DTMA 4M42A 1FZ7E 1XVEE 2LF3A 3SUPA 3J27A 4ADNA 4FJJA 1XMHE 3E4YA 4FK4A 4FJIA 3CFRA 4KHUA 2JH9A 4JS5A 4HCCA 2RCUA 1WAJA 1FZ0E 3L8BA 3C6NB 1XVCE 3N1EA 1Q9XA 3QNNA 4KI6A 3TAEA 3V7DB 2ATQA 2JHPA 4AKGA 3LD8A 4FJMA 4FJHA 2PFVA 3OGLB 4ADOA 1XVGE 2LF6A 3NHGA 4AI6A 4B08A 4M3ZA 4M3UA 2P1NB 2YB5A 3QEWA 2P1QB 1MHYG 3SQ0A 2VJ4A 4I6JB 2DY4A 3HGKE 2JHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNG A;  4X5M A;  4QNC A;  4X5N A;  4QND A; 
#chains in the Genus database with same CATH topology
 3N1B A;  4FK2 A;  3CFP A;  2RKH A;  4I9L A;  2JQT A;  3QES A;  3RWU A;  4EPH A;  4J2A A;  1FZ4 E;  3SVI A;  5IBK B;  1IH7 A;  2OVP B;  4I9Q A;  1XMF E;  4JS4 A;  3SUN A;  2HD0 A;  1FXX A;  2OYQ A;  3C94 A;  4X5M A;  4DTR A;  2P5O A;  3KD5 E;  4KI4 A;  1FZ8 E;  1FZH E;  2MZW B;  2E31 A;  2FW3 A;  1P22 A;  4FJ8 A;  5H37 A;  4DTP A;  5IZ7 A;  1FYZ E;  3QET A;  4QNC A;  1FZ3 E;  1FPO A;  3RMC A;  3RMA A;  2P5G A;  4EP9 A;  4RG8 A;  3HP9 A;  4M41 A;  2VIX A;  4J2E A;  4DTU A;  2JHC A;  4RNG A;  4M3R A;  3SUQ A;  2OVR B;  4KHS A;  4M3Y A;  4J2B A;  1JW2 A;  3HL8 A;  4DU3 A;  2DEB A;  4FJX A;  4KHN A;  1FZ6 E;  2P1P B;  2E32 A;  2OVQ B;  4IT5 A;  2DTU A;  3SQ2 A;  2B1E A;  4DTO A;  4DTJ A;  3SJJ A;  4RL5 A;  1XU3 E;  4FK0 A;  4M3X A;  3TAF A;  4FJN A;  4AKH A;  5IRE A;  1CLQ A;  1N1C A;  3OGM B;  4FJL A;  4DTX A;  3SPY A;  3TAG A;  4AKI A;  3CQ8 A;  4DU4 A;  1XVD E;  1LDK E;  3LZJ A;  2JH8 A;  1MMO G;  3UIQ A;  1XU5 E;  3TAB A;  3C95 A;  3NE6 A;  3LDS A;  3NAE A;  4FJ5 A;  4FJ7 A;  4KHW A;  3OGK B;  4X5N A;  4DTS A;  2K5S A;  3C6O B;  1Q9Y A;  3C6P B;  4FJ9 A;  4E4B A;  2FYO A;  2MMB A;  3K2O A;  4ICG C;  3TL8 B;  3QER A;  1IG9 A;  4M3W A;  4EYW A;  2P1M B;  1FZ9 E;  1FZ5 E;  3RMB A;  2H4T A;  4KHQ A;  4FVM A;  1MHZ G;  3SQ1 A;  1XL3 C;  1NEX B;  3CFO A;  4DTN A;  4JRQ A;  3QNO A;  3SCX A;  4FJG A;  3SNN A;  2B8I A;  2B7M A;  1XVB E;  3TJY A;  3QEX A;  3SPZ A;  3MKS B;  4JRP A;  3L1N A;  1FZ1 E;  1XVF E;  3SI6 A;  2OZM A;  3L2O B;  4GAM C;  3QEV A;  1MTY G;  1FZI E;  4M3T A;  3J2P A;  2QXF A;  2PFT A;  3HGL A;  4FJK A;  1WAF A;  3RMD A;  3E4W A;  3L0M A;  3NDK A;  4E3S A;  2JPN A;  3QEP A;  4KHY A;  1FZ2 E;  3SUO A;  3KD1 E;  4QND A;  3WSO A;  3NCI A;  3SQ4 A;  2VJ5 A;  3S9H A;  2OZS A;  1FS1 A;  3LDB A;  4M45 A;  3NGI A;  3LZI A;  3QEI A;  4DU1 A;  1XMG E;  4HCB A;  2P1O B;  2MW2 A;  4DTM A;  1FZ7 E;  1XVE E;  2LF3 A;  3SUP A;  4M42 A;  3J27 A;  4ADN A;  4FJJ A;  1XMH E;  3E4Y A;  4FK4 A;  4FJI A;  3CFR A;  4KHU A;  2JH9 A;  4JS5 A;  4HCC A;  2RCU A;  1WAJ A;  1FZ0 E;  3BVO A;  3L8B A;  3C6N B;  1XVC E;  3N1E A;  1Q9X A;  3QNN A;  4J2D A;  4KI6 A;  3TAE A;  3UO2 A;  3V7D B;  2ATQ A;  2JHP A;  4AKG A;  3LD8 A;  4FJM A;  3UO3 A;  4FJH A;  2PFV A;  3OGL B;  4ADO A;  1XVG E;  2LF6 A;  3NHG A;  4AI6 A;  4B08 A;  4M3Z A;  4M3U A;  2P1N B;  2YB5 A;  3QEW A;  2P1Q B;  1MHY G;  3SQ0 A;  2VJ4 A;  4I6J B;  2DY4 A;  3HGK E;  2JHA A; 
#chains in the Genus database with same CATH homology
 3N1B A;  4FK2 A;  3CFP A;  4I9L A;  3QES A;  3RWU A;  4J2D A;  4EPH A;  4J2A A;  1FZ4 E;  3SVI A;  5IBK B;  1IH7 A;  2OVP B;  4I9Q A;  1XMF E;  4JS4 A;  3SUN A;  2HD0 A;  1FXX A;  2OYQ A;  3C94 A;  4X5M A;  4DTR A;  2P5O A;  3KD5 E;  4KI4 A;  1FZ8 E;  1FZH E;  2MZW B;  2E31 A;  2FW3 A;  1P22 A;  4FJ8 A;  5H37 A;  4DTP A;  5IZ7 A;  1FYZ E;  3QET A;  4QNC A;  1FZ3 E;  3RMC A;  3RMA A;  2P5G A;  4EP9 A;  4RG8 A;  3HP9 A;  4M41 A;  2VIX A;  4J2E A;  4DTU A;  2JHC A;  4RNG A;  4M3R A;  3SUQ A;  2OVR B;  4KHS A;  4M3Y A;  4J2B A;  3HL8 A;  4DU3 A;  2DEB A;  4FJX A;  4KHN A;  1FZ6 E;  2P1P B;  2E32 A;  2OVQ B;  2DTU A;  3SQ2 A;  2B1E A;  4DTO A;  4DTJ A;  3SJJ A;  4RL5 A;  1XU3 E;  4FK0 A;  4M3X A;  3TAF A;  4FJN A;  4AKH A;  5IRE A;  1CLQ A;  4AKI A;  3OGM B;  4FJL A;  4DTX A;  3SPY A;  3TAG A;  3CQ8 A;  4DU4 A;  1XVD E;  1LDK E;  3LZJ A;  2JH8 A;  1MMO G;  3UIQ A;  1XU5 E;  3TAB A;  3C95 A;  3NE6 A;  3LDS A;  3NAE A;  4FJ5 A;  4FJ7 A;  4KHW A;  3OGK B;  4X5N A;  4DTS A;  3C6O B;  1Q9Y A;  3C6P B;  4FJ9 A;  4E4B A;  2FYO A;  2MMB A;  3K2O A;  3QER A;  3TL8 B;  1IG9 A;  4M3W A;  4EYW A;  2P1M B;  1FZ9 E;  1FZ5 E;  3RMB A;  2H4T A;  4KHQ A;  4FVM A;  1MHZ G;  3SQ1 A;  1XL3 C;  1NEX B;  3CFO A;  4DTN A;  4JRQ A;  3QNO A;  3SCX A;  4FJG A;  3SNN A;  2B8I A;  2B7M A;  1XVB E;  3TJY A;  3QEX A;  3SPZ A;  3MKS B;  4JRP A;  3L1N A;  1FZ1 E;  1XVF E;  3SI6 A;  2OZM A;  3L2O B;  4GAM C;  3QEV A;  1MTY G;  1FZI E;  4M3T A;  3J2P A;  2QXF A;  2PFT A;  3HGL A;  4FJK A;  1WAF A;  3RMD A;  3E4W A;  3L0M A;  3NDK A;  4E3S A;  2JPN A;  3QEP A;  4KHY A;  1FZ2 E;  3SUO A;  3KD1 E;  4QND A;  3WSO A;  3NCI A;  3SQ4 A;  2VJ5 A;  3S9H A;  2OZS A;  1FS1 A;  3LDB A;  4M45 A;  3NGI A;  3LZI A;  3QEI A;  4DU1 A;  1XMG E;  4HCB A;  2P1O B;  4DTM A;  4M42 A;  1FZ7 E;  1XVE E;  2LF3 A;  3SUP A;  3J27 A;  4ADN A;  4FJJ A;  1XMH E;  3E4Y A;  4FK4 A;  4FJI A;  3CFR A;  4KHU A;  2JH9 A;  4JS5 A;  4HCC A;  2RCU A;  1WAJ A;  1FZ0 E;  3L8B A;  3C6N B;  1XVC E;  3N1E A;  1Q9X A;  3QNN A;  4KI6 A;  3TAE A;  3V7D B;  2ATQ A;  2JHP A;  4AKG A;  3LD8 A;  4FJM A;  4FJH A;  2PFV A;  3OGL B;  4ADO A;  1XVG E;  2LF6 A;  3NHG A;  4AI6 A;  4B08 A;  4M3Z A;  4M3U A;  2P1N B;  2YB5 A;  3QEW A;  2P1Q B;  1MHY G;  3SQ0 A;  2VJ4 A;  4I6J B;  2DY4 A;  3HGK E;  2JHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...