4QNCA

Crystal structure of a semisweet in an occluded state
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
MENLIGYVAAFLTTVSFLPQVLRVVMTKQTRDISRNMYIMFFLGVVLWFVYGILRSDLPIILANVVTLFFVTIILYYKLTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of bacterial homologues of SWEET transporters in two distinct conformations.
pubmed doi rcsb
source organism Leptospira biflexa serovar patoc
molecule tags Membrane protein
molecule keywords chemical transport protein
total genus 32
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4qncA00
4RNGA 4QNDA 4QNCA 4X5NA 4X5MA
chains in the Genus database with same CATH superfamily
3TJYA 3NGIA 3SCXA 2P1OB 2YB5A 2FYOA 2OVPB 3V7DB 3CFPA 1IH7A 4FJ7A 3TAEA 4J2BA 1MHYG 5IREA 4KHQA 4DU3A 1FZHE 3QNOA 4RL5A 3SUOA 1FZ2E 3L8BA 3HGLA 3TL8B 4FJ5A 2LF3A 4HCCA 1MMOG 4FJKA 2B1EA 4HCBA 3SQ2A 4KI4A 4JRQA 2RKHA 4DU4A 3S9HA 4FK4A 2E31A 3J27A 1Q9XA 1FPOA 3LD8A 4QNCA 2VJ4A 4JS4A 4KHSA 4I9LA 3RMBA 1IG9A 1XVEE 4B08A 2JPNA 3KD1E 1XU5E 2OVRB 2B7MA 2ATQA 2E32A 3QEIA 3E4YA 3SPZA 1FZ1E 1MHZG 4ADNA 1WAJA 4J2AA 4DU1A 1FZ5E 1FZ7E 2MMBA 3MKSB 2P1MB 2P1QB 3OGKB 4FJJA 4KHWA 4AKIA 2MZWB 2VJ5A 5IZ7A 3L1NA 4DTXA 3SUNA 1JW2A 3NDKA 4M3RA 3SQ1A 4DTPA 1P22A 4FVMA 4X5NA 1FXXA 1MTYG 3CFRA 2H4TA 2K5SA 3SQ0A 2OZMA 3QEPA 4FJHA 4IT5A 4RG8A 3QEWA 3NE6A 3TAFA 3SPYA 4FJGA 3N1EA 1FZ9E 3C6NB 3LDSA 3SJJA 4J2EA 4DTRA 1XVBE 4FJIA 1FZIE 2P1NB 3QEVA 2OZSA 3CFOA 3L2OB 2P5OA 4DTSA 1XVCE 3SQ4A 4I9QA 1CLQA 5IBKB 3OGLB 3QETA 4M42A 1XVDE 4M45A 4KI6A 1XMHE 4KHUA 4FJXA 2DEBA 2FW3A 3LZIA 1XVGE 2JHAA 3J2PA 2PFTA 3HGKE 4AKGA 4KHNA 3HL8A 4DTJA 1N1CA 3C6PB 1XL3C 2MW2A 1NEXB 1FZ3E 4E4BA 3C94A 1XU3E 2PFVA 2P5GA 3WSOA 4M3ZA 4E3SA 4DTMA 3C95A 4ICGC 4DTUA 1Q9YA 3QEXA 4I6JB 2JQTA 4EP9A 1FZ4E 2RCUA 3SVIA 3SI6A 3RMDA 4FK2A 4M41A 1FS1A 3CQ8A 4AI6A 3N1BA 3UO2A 3RWUA 3TAGA 4AKHA 1XMFE 2JHPA 1WAFA 2P1PB 1FZ0E 4RNGA 3SUPA 3RMAA 3SNNA 3SUQA 3QESA 1FZ6E 3NHGA 2DTUA 4DTNA 1XVFE 4FJLA 3UIQA 4EPHA 2JHCA 4FJ8A 4FJMA 2QXFA 3UO3A 3QNNA 4QNDA 3L0MA 3BVOA 2JH8A 3NAEA 2OYQA 1FZ8E 3C6OB 3E4WA 4DTOA 2B8IA 4X5MA 4M3TA 4EYWA 3KD5E 3NCIA 4ADOA 2HD0A 1FYZE 2VIXA 2OVQB 4M3WA 1LDKE 4KHYA 4JS5A 4FJNA 2DY4A 3OGMB 2JH9A 3LZJA 4JRPA 1XMGE 3HP9A 3LDBA 3QERA 3RMCA 4J2DA 4FJ9A 4GAMC 3K2OA 4M3XA 4M3UA 2LF6A 3TABA 5H37A 4M3YA 4FK0A
chains in the Genus database with same CATH topology
3TJYA 3NGIA 3SCXA 2P1OB 2YB5A 2FYOA 2OVPB 3V7DB 3CFPA 1IH7A 4FJ7A 3TAEA 4J2BA 1MHYG 5IREA 4KHQA 4DU3A 1FZHE 3QNOA 4RL5A 3SUOA 1FZ2E 3L8BA 3HGLA 3TL8B 4FJ5A 2LF3A 4HCCA 1MMOG 4FJKA 2B1EA 4HCBA 3SQ2A 4KI4A 4JRQA 4DU4A 3S9HA 4FK4A 2E31A 3J27A 1Q9XA 3LD8A 4QNCA 2VJ4A 4JS4A 4KHSA 4I9LA 3RMBA 1IG9A 1XVEE 4B08A 2JPNA 3KD1E 1XU5E 2OVRB 2B7MA 2ATQA 2E32A 3QEIA 3E4YA 3SPZA 1FZ1E 1MHZG 4ADNA 1WAJA 4J2AA 4DU1A 1FZ5E 1FZ7E 2MMBA 3MKSB 2P1MB 2P1QB 3OGKB 4FJJA 4KHWA 4AKIA 2MZWB 2VJ5A 5IZ7A 3L1NA 4DTXA 3SUNA 3NDKA 4M3RA 3SQ1A 4DTPA 1P22A 4FVMA 4X5NA 1FXXA 1MTYG 3CFRA 2H4TA 3SQ0A 2OZMA 3QEPA 4FJHA 4RG8A 3QEWA 3NE6A 3TAFA 3SPYA 4FJGA 3N1EA 1FZ9E 3C6NB 3LDSA 3SJJA 4J2EA 4DTRA 1XVBE 4FJIA 1FZIE 2P1NB 3QEVA 2OZSA 3CFOA 3L2OB 2P5OA 4DTSA 1XVCE 3SQ4A 4I9QA 1CLQA 5IBKB 3OGLB 3QETA 4M42A 1XVDE 4M45A 4KI6A 1XMHE 4KHUA 4FJXA 2DEBA 2FW3A 3LZIA 1XVGE 2JHAA 3J2PA 2PFTA 3HGKE 4AKGA 4KHNA 3HL8A 4DTJA 3C6PB 1XL3C 1NEXB 1FZ3E 4E4BA 3C94A 1XU3E 2PFVA 2P5GA 3WSOA 4M3ZA 4E3SA 4DTMA 3C95A 4DTUA 1Q9YA 3QEXA 4I6JB 4EP9A 1FZ4E 2RCUA 3SVIA 3SI6A 3RMDA 4FK2A 4M41A 1FS1A 3CQ8A 4AI6A 3N1BA 3RWUA 3TAGA 4AKHA 1XMFE 2JHPA 1WAFA 2P1PB 1FZ0E 4RNGA 3SUPA 3RMAA 3SNNA 3SUQA 3QESA 1FZ6E 3NHGA 2DTUA 4DTNA 1XVFE 4FJLA 3UIQA 4EPHA 2JHCA 4FJ8A 4FJMA 2QXFA 3QNNA 4QNDA 3L0MA 2JH8A 3NAEA 2OYQA 1FZ8E 3C6OB 3E4WA 4DTOA 2B8IA 4X5MA 4M3TA 4EYWA 3KD5E 3NCIA 4ADOA 2HD0A 1FYZE 2VIXA 2OVQB 4M3WA 1LDKE 4KHYA 4JS5A 4FJNA 2DY4A 3OGMB 2JH9A 3LZJA 4JRPA 1XMGE 3HP9A 3LDBA 3QERA 3RMCA 4J2DA 4FJ9A 4GAMC 3K2OA 4M3XA 4M3UA 2LF6A 3TABA 5H37A 4M3YA 4FK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNG A;  4QND A;  4QNC A;  4X5N A;  4X5M A; 
#chains in the Genus database with same CATH topology
 3TJY A;  3NGI A;  3SCX A;  2P1O B;  2YB5 A;  2FYO A;  2OVP B;  3V7D B;  3CFP A;  1IH7 A;  4FJ7 A;  3TAE A;  4J2B A;  1MHY G;  5IRE A;  4KHQ A;  4DU3 A;  1FZH E;  3QNO A;  4RL5 A;  3SUO A;  1FZ2 E;  3L8B A;  3HGL A;  3TL8 B;  4FJ5 A;  2LF3 A;  4HCC A;  1MMO G;  4FJK A;  2B1E A;  4HCB A;  3SQ2 A;  4KI4 A;  4JRQ A;  2RKH A;  4DU4 A;  3S9H A;  4FK4 A;  2E31 A;  3J27 A;  1Q9X A;  1FPO A;  3LD8 A;  4QNC A;  2VJ4 A;  4JS4 A;  4KHS A;  4I9L A;  3RMB A;  1IG9 A;  1XVE E;  4B08 A;  2JPN A;  3KD1 E;  1XU5 E;  2OVR B;  2B7M A;  2ATQ A;  2E32 A;  3QEI A;  3E4Y A;  3SPZ A;  1FZ1 E;  1MHZ G;  4ADN A;  1WAJ A;  4J2A A;  4DU1 A;  1FZ5 E;  1FZ7 E;  2MMB A;  3MKS B;  2P1M B;  2P1Q B;  3OGK B;  4FJJ A;  4KHW A;  4AKI A;  2MZW B;  2VJ5 A;  5IZ7 A;  3L1N A;  4DTX A;  3SUN A;  1JW2 A;  3NDK A;  4M3R A;  3SQ1 A;  4DTP A;  1P22 A;  4FVM A;  4X5N A;  1FXX A;  1MTY G;  3CFR A;  2H4T A;  2K5S A;  3SQ0 A;  2OZM A;  3QEP A;  4FJH A;  4IT5 A;  4RG8 A;  3QEW A;  3NE6 A;  3TAF A;  3SPY A;  4FJG A;  3N1E A;  1FZ9 E;  3C6N B;  3LDS A;  3SJJ A;  4J2E A;  4DTR A;  1XVB E;  4FJI A;  1FZI E;  2P1N B;  3QEV A;  2OZS A;  3CFO A;  3L2O B;  2P5O A;  4DTS A;  1XVC E;  3SQ4 A;  4I9Q A;  1CLQ A;  5IBK B;  3OGL B;  3QET A;  4M42 A;  1XVD E;  4M45 A;  4KI6 A;  1XMH E;  4KHU A;  4FJX A;  2DEB A;  2FW3 A;  3LZI A;  1XVG E;  2JHA A;  3J2P A;  2PFT A;  3HGK E;  4AKG A;  4KHN A;  3HL8 A;  4DTJ A;  1N1C A;  3C6P B;  1XL3 C;  2MW2 A;  1NEX B;  1FZ3 E;  4E4B A;  3C94 A;  1XU3 E;  2PFV A;  2P5G A;  3WSO A;  4M3Z A;  4E3S A;  4DTM A;  3C95 A;  4ICG C;  4DTU A;  1Q9Y A;  3QEX A;  4I6J B;  2JQT A;  4EP9 A;  1FZ4 E;  2RCU A;  3SVI A;  3SI6 A;  3RMD A;  4FK2 A;  4M41 A;  1FS1 A;  3CQ8 A;  4AI6 A;  3N1B A;  3UO2 A;  3RWU A;  3TAG A;  4AKH A;  1XMF E;  2JHP A;  1WAF A;  2P1P B;  1FZ0 E;  4RNG A;  3SUP A;  3RMA A;  3SNN A;  3SUQ A;  3QES A;  1FZ6 E;  3NHG A;  2DTU A;  4DTN A;  1XVF E;  4FJL A;  3UIQ A;  4EPH A;  2JHC A;  4FJ8 A;  4FJM A;  2QXF A;  3UO3 A;  3QNN A;  4QND A;  3L0M A;  3BVO A;  2JH8 A;  3NAE A;  2OYQ A;  1FZ8 E;  3C6O B;  3E4W A;  4DTO A;  2B8I A;  4X5M A;  4M3T A;  4EYW A;  3KD5 E;  3NCI A;  4ADO A;  2HD0 A;  1FYZ E;  2VIX A;  2OVQ B;  4M3W A;  1LDK E;  4KHY A;  4JS5 A;  4FJN A;  2DY4 A;  3OGM B;  2JH9 A;  3LZJ A;  4JRP A;  1XMG E;  3HP9 A;  3LDB A;  3QER A;  3RMC A;  4J2D A;  4FJ9 A;  4GAM C;  3K2O A;  4M3X A;  4M3U A;  2LF6 A;  3TAB A;  5H37 A;  4M3Y A;  4FK0 A; 
#chains in the Genus database with same CATH homology
 3TJY A;  3NGI A;  3SCX A;  2P1O B;  2YB5 A;  2FYO A;  2OVP B;  3V7D B;  3CFP A;  1IH7 A;  4FJ7 A;  3TAE A;  4J2B A;  1MHY G;  5IRE A;  4KHQ A;  4DU3 A;  1FZH E;  3QNO A;  4RL5 A;  3SUO A;  1FZ2 E;  3L8B A;  3HGL A;  3TL8 B;  4FJ5 A;  2LF3 A;  4HCC A;  1MMO G;  4FJK A;  2B1E A;  4HCB A;  3SQ2 A;  4KI4 A;  4JRQ A;  4DU4 A;  3S9H A;  4FK4 A;  2E31 A;  3J27 A;  1Q9X A;  3LD8 A;  4QNC A;  2VJ4 A;  4JS4 A;  4KHS A;  4I9L A;  3RMB A;  1IG9 A;  1XVE E;  4B08 A;  2JPN A;  3KD1 E;  1XU5 E;  2OVR B;  2B7M A;  2ATQ A;  2E32 A;  3QEI A;  3E4Y A;  3SPZ A;  1FZ1 E;  1MHZ G;  4ADN A;  1WAJ A;  4J2A A;  4DU1 A;  1FZ5 E;  1FZ7 E;  2MMB A;  3MKS B;  2P1M B;  2P1Q B;  3OGK B;  4FJJ A;  4KHW A;  4AKI A;  2MZW B;  2VJ5 A;  5IZ7 A;  3L1N A;  4DTX A;  3SUN A;  3NDK A;  4M3R A;  3SQ1 A;  4DTP A;  1P22 A;  4FVM A;  4X5N A;  1FXX A;  1MTY G;  3CFR A;  2H4T A;  3SQ0 A;  2OZM A;  3QEP A;  4FJH A;  4RG8 A;  3QEW A;  3NE6 A;  3TAF A;  3SPY A;  4FJG A;  3N1E A;  1FZ9 E;  3C6N B;  3LDS A;  3SJJ A;  4J2E A;  4DTR A;  1XVB E;  4FJI A;  1FZI E;  2P1N B;  3QEV A;  2OZS A;  3CFO A;  3L2O B;  2P5O A;  4DTS A;  1XVC E;  3SQ4 A;  4I9Q A;  1CLQ A;  5IBK B;  3OGL B;  3QET A;  4M42 A;  1XVD E;  4M45 A;  4KI6 A;  1XMH E;  4KHU A;  4FJX A;  2DEB A;  2FW3 A;  3LZI A;  1XVG E;  2JHA A;  3J2P A;  2PFT A;  3HGK E;  4AKG A;  4KHN A;  3HL8 A;  4DTJ A;  3C6P B;  1XL3 C;  1NEX B;  1FZ3 E;  4E4B A;  3C94 A;  1XU3 E;  2PFV A;  2P5G A;  3WSO A;  4M3Z A;  4E3S A;  4DTM A;  3C95 A;  4DTU A;  1Q9Y A;  3QEX A;  4I6J B;  4EP9 A;  1FZ4 E;  2RCU A;  3SVI A;  3SI6 A;  3RMD A;  4FK2 A;  4M41 A;  1FS1 A;  3CQ8 A;  4AI6 A;  3N1B A;  3RWU A;  3TAG A;  4AKH A;  1XMF E;  2JHP A;  1WAF A;  2P1P B;  1FZ0 E;  4RNG A;  3SUP A;  3RMA A;  3SNN A;  3SUQ A;  3QES A;  1FZ6 E;  3NHG A;  2DTU A;  4DTN A;  1XVF E;  4FJL A;  3UIQ A;  4EPH A;  2JHC A;  4FJ8 A;  4FJM A;  2QXF A;  3QNN A;  4QND A;  3L0M A;  2JH8 A;  3NAE A;  2OYQ A;  1FZ8 E;  3C6O B;  3E4W A;  4DTO A;  2B8I A;  4X5M A;  4M3T A;  4EYW A;  3KD5 E;  3NCI A;  4ADO A;  2HD0 A;  1FYZ E;  2VIX A;  2OVQ B;  4M3W A;  1LDK E;  4KHY A;  4JS5 A;  4FJN A;  2DY4 A;  3OGM B;  2JH9 A;  3LZJ A;  4JRP A;  1XMG E;  3HP9 A;  3LDB A;  3QER A;  3RMC A;  4J2D A;  4FJ9 A;  4GAM C;  3K2O A;  4M3X A;  4M3U A;  2LF6 A;  3TAB A;  5H37 A;  4M3Y A;  4FK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...