4RNGA

Crystal structure of a bacterial homologue of sweet transporters
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
DLNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIPVILANLISLILIFLIIFMKIRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MtN3/saliva family
publication title Crystal structure of a bacterial homologue of SWEET transporters.
pubmed doi rcsb
source organism Thermodesulfovibrio yellowstonii
molecule tags Sugar binding protein
total genus 34
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4rngA00
4X5NA 4RNGA 4X5MA 4QNCA 4QNDA
chains in the Genus database with same CATH superfamily
3LDBA 4M45A 1IG9A 4J2EA 1XVFE 4J2BA 1N1CA 3LZJA 4KI4A 4KHWA 4DTNA 1NEXB 3J27A 5IBKB 1WAJA 2RKHA 3CFOA 1FZ6E 1FS1A 3L2OB 4FK2A 2JH8A 4JS4A 2FYOA 2YB5A 1FZ4E 4ADNA 4J2DA 4KHUA 1XVCE 4M3XA 3C6PB 1FXXA 2P1QB 2E31A 1XMHE 4JS5A 4DTPA 3RWUA 3NHGA 2FW3A 3SCXA 4KI6A 2B8IA 1XMGE 2PFVA 4EYWA 4I9QA 4RL5A 1JW2A 4AKIA 3LD8A 1XU5E 1FZ1E 4DTJA 4KHQA 3C94A 2JHAA 4FJMA 4FJ7A 3QNNA 3SI6A 2P1OB 3L0MA 3OGMB 4HCCA 1FZ7E 4X5NA 3TJYA 1WAFA 3UO3A 3N1BA 2MZWB 3QEPA 4HCBA 2HD0A 4X5MA 3MKSB 4QNDA 2RCUA 3SVIA 3CFPA 3N1EA 2P1NB 3OGLB 4ADOA 4I9LA 4M41A 2JH9A 1FZ8E 4DU4A 2K5SA 4M3UA 4M3TA 4DTSA 2B1EA 3QEVA 4FJJA 2E32A 2PFTA 3WSOA 2OVPB 2JPNA 3HGKE 2QXFA 2OYQA 1FZ0E 4FJGA 4FJNA 3TABA 4FK4A 1XL3C 5H37A 3QEXA 3UO2A 3KD5E 3C95A 4FJLA 4DTXA 1FZHE 2P5OA 2OZMA 4DTMA 4DU1A 3BVOA 3NGIA 4DTOA 3TAGA 4FJ8A 2DY4A 1XU3E 4M3WA 3HGLA 2JHPA 4FVMA 4GAMC 3RMBA 3TAFA 4I6JB 2DTUA 1FZ5E 3E4WA 2ATQA 1P22A 4ICGC 3OGKB 3SQ1A 2B7MA 1LDKE 3HL8A 1XVGE 3K2OA 1FPOA 2P1MB 1MMOG 3QEWA 2P5GA 4AKGA 3SPZA 4KHYA 1XVBE 3KD1E 2JQTA 3SNNA 4FJIA 1FZ9E 3SUQA 3SUPA 3V7DB 4DTUA 4FK0A 3QETA 3SUNA 1MHYG 4M3RA 1CLQA 1MHZG 1FYZE 2OVQB 3SPYA 4KHNA 4AKHA 3E4YA 2DEBA 4FJ5A 3LDSA 3TL8B 3SQ4A 3RMDA 1Q9YA 2MMBA 2VIXA 3L8BA 3SQ2A 4E4BA 2OZSA 1MTYG 1XVDE 3HP9A 2LF6A 3RMCA 1FZIE 4RG8A 4B08A 3QNOA 3UIQA 1FZ3E 4M42A 3J2PA 4FJHA 4M3ZA 3CQ8A 3C6OB 5IZ7A 4EPHA 4JRQA 3QEIA 2MW2A 4DTRA 4FJKA 4KHSA 1Q9XA 2OVRB 3NCIA 4JRPA 2JHCA 3RMAA 1FZ2E 4RNGA 4DU3A 1XMFE 3NDKA 3SUOA 3QESA 2H4TA 2LF3A 4QNCA 3NAEA 3LZIA 3NE6A 4E3SA 3SJJA 1IH7A 4IT5A 3L1NA 3SQ0A 1XVEE 4AI6A 4J2AA 5IREA 3QERA 3TAEA 4FJXA 4M3YA 2VJ5A 2VJ4A 3S9HA 3C6NB 2P1PB 4EP9A 4FJ9A 3CFRA
chains in the Genus database with same CATH topology
3LDBA 4M45A 1IG9A 4J2EA 1XVFE 4J2BA 4KI4A 3LZJA 4KHWA 4DTNA 1NEXB 3J27A 5IBKB 1WAJA 3CFOA 1FZ6E 1FS1A 3L2OB 4FK2A 2JH8A 4JS4A 2FYOA 2YB5A 1FZ4E 4ADNA 4J2DA 4KHUA 1XVCE 4M3XA 3C6PB 1FXXA 2P1QB 2E31A 1XMHE 4JS5A 4DTPA 3RWUA 3NHGA 2FW3A 3SCXA 4KI6A 2B8IA 1XMGE 2PFVA 4EYWA 4I9QA 4RL5A 4AKIA 3LD8A 1XU5E 1FZ1E 4DTJA 4KHQA 3C94A 2JHAA 4FJMA 4FJ7A 3QNNA 3SI6A 2P1OB 3L0MA 3OGMB 4HCCA 1FZ7E 4X5NA 3TJYA 1WAFA 3N1BA 2MZWB 3QEPA 4HCBA 2HD0A 4X5MA 3MKSB 4QNDA 2RCUA 3SVIA 3CFPA 3N1EA 2P1NB 3OGLB 4ADOA 4I9LA 4M41A 2JH9A 1FZ8E 4DU4A 4M3TA 4M3UA 4DTSA 2B1EA 3QEVA 4FJJA 2E32A 2PFTA 3WSOA 2OVPB 2JPNA 3HGKE 2QXFA 2OYQA 1FZ0E 4FJGA 4FJNA 3TABA 4FK4A 1XL3C 5H37A 3QEXA 3KD5E 3C95A 4FJLA 4DTXA 1FZHE 2P5OA 2OZMA 4DTMA 4DU1A 3NGIA 4DTOA 3TAGA 2DY4A 4FJ8A 1XU3E 4M3WA 3HGLA 2JHPA 4FVMA 4GAMC 3RMBA 3TAFA 4I6JB 2DTUA 1FZ5E 3E4WA 2ATQA 1P22A 3OGKB 3SQ1A 2B7MA 1LDKE 3HL8A 1XVGE 3K2OA 2P1MB 1MMOG 3QEWA 2P5GA 4AKGA 3SPZA 4KHYA 1XVBE 3KD1E 3SNNA 4FJIA 1FZ9E 3SUQA 3SUPA 3V7DB 4DTUA 4FK0A 3QETA 3SUNA 1MHYG 4M3RA 1CLQA 1MHZG 1FYZE 2OVQB 3SPYA 4KHNA 4AKHA 3E4YA 2DEBA 4FJ5A 3LDSA 3TL8B 3SQ4A 3RMDA 1Q9YA 2MMBA 2VIXA 3L8BA 3SQ2A 4E4BA 2OZSA 1MTYG 1XVDE 3HP9A 2LF6A 3RMCA 1FZIE 4RG8A 4B08A 3QNOA 3UIQA 1FZ3E 4M42A 3J2PA 4FJHA 4M3ZA 3CQ8A 3C6OB 5IZ7A 4EPHA 4JRQA 3QEIA 4DTRA 4FJKA 4KHSA 1Q9XA 2OVRB 3NCIA 4JRPA 2JHCA 3RMAA 1FZ2E 4RNGA 4DU3A 1XMFE 3NDKA 3SUOA 3QESA 2H4TA 2LF3A 4QNCA 3NAEA 3LZIA 3NE6A 4E3SA 3SJJA 1IH7A 3L1NA 3SQ0A 1XVEE 4AI6A 4J2AA 5IREA 3QERA 3TAEA 4FJXA 4M3YA 2VJ5A 2VJ4A 3S9HA 3C6NB 2P1PB 4EP9A 4FJ9A 3CFRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X5N A;  4RNG A;  4X5M A;  4QNC A;  4QND A; 
#chains in the Genus database with same CATH topology
 3LDB A;  4M45 A;  1IG9 A;  4J2E A;  1XVF E;  4J2B A;  1N1C A;  3LZJ A;  4KI4 A;  4KHW A;  4DTN A;  1NEX B;  3J27 A;  5IBK B;  1WAJ A;  2RKH A;  3CFO A;  1FZ6 E;  1FS1 A;  3L2O B;  4FK2 A;  2JH8 A;  4JS4 A;  2FYO A;  2YB5 A;  1FZ4 E;  4ADN A;  4J2D A;  4KHU A;  1XVC E;  4M3X A;  3C6P B;  1FXX A;  2P1Q B;  2E31 A;  1XMH E;  4JS5 A;  4DTP A;  3RWU A;  3NHG A;  2FW3 A;  3SCX A;  4KI6 A;  2B8I A;  1XMG E;  2PFV A;  4EYW A;  4I9Q A;  4RL5 A;  1JW2 A;  4AKI A;  3LD8 A;  1XU5 E;  1FZ1 E;  4DTJ A;  4KHQ A;  3C94 A;  2JHA A;  4FJM A;  4FJ7 A;  3QNN A;  3SI6 A;  2P1O B;  3L0M A;  3OGM B;  4HCC A;  1FZ7 E;  4X5N A;  3TJY A;  1WAF A;  3UO3 A;  3N1B A;  2MZW B;  3QEP A;  4HCB A;  2HD0 A;  4X5M A;  3MKS B;  4QND A;  2RCU A;  3SVI A;  3CFP A;  3N1E A;  2P1N B;  3OGL B;  4ADO A;  4I9L A;  4M41 A;  2JH9 A;  1FZ8 E;  4DU4 A;  2K5S A;  4M3U A;  4M3T A;  4DTS A;  2B1E A;  3QEV A;  4FJJ A;  2E32 A;  2PFT A;  3WSO A;  2OVP B;  2JPN A;  3HGK E;  2QXF A;  2OYQ A;  1FZ0 E;  4FJG A;  4FJN A;  3TAB A;  4FK4 A;  1XL3 C;  5H37 A;  3QEX A;  3UO2 A;  3KD5 E;  3C95 A;  4FJL A;  4DTX A;  1FZH E;  2P5O A;  2OZM A;  4DTM A;  4DU1 A;  3BVO A;  3NGI A;  4DTO A;  3TAG A;  4FJ8 A;  2DY4 A;  1XU3 E;  4M3W A;  3HGL A;  2JHP A;  4FVM A;  4GAM C;  3RMB A;  3TAF A;  4I6J B;  2DTU A;  1FZ5 E;  3E4W A;  2ATQ A;  1P22 A;  4ICG C;  3OGK B;  3SQ1 A;  2B7M A;  1LDK E;  3HL8 A;  1XVG E;  3K2O A;  1FPO A;  2P1M B;  1MMO G;  3QEW A;  2P5G A;  4AKG A;  3SPZ A;  4KHY A;  1XVB E;  3KD1 E;  2JQT A;  3SNN A;  4FJI A;  1FZ9 E;  3SUQ A;  3SUP A;  3V7D B;  4DTU A;  4FK0 A;  3QET A;  3SUN A;  1MHY G;  4M3R A;  1CLQ A;  1MHZ G;  1FYZ E;  2OVQ B;  3SPY A;  4KHN A;  4AKH A;  3E4Y A;  2DEB A;  4FJ5 A;  3LDS A;  3TL8 B;  3SQ4 A;  3RMD A;  1Q9Y A;  2MMB A;  2VIX A;  3L8B A;  3SQ2 A;  4E4B A;  2OZS A;  1MTY G;  1XVD E;  3HP9 A;  2LF6 A;  3RMC A;  1FZI E;  4RG8 A;  4B08 A;  3QNO A;  3UIQ A;  1FZ3 E;  4M42 A;  3J2P A;  4FJH A;  4M3Z A;  3CQ8 A;  3C6O B;  5IZ7 A;  4EPH A;  4JRQ A;  3QEI A;  2MW2 A;  4DTR A;  4FJK A;  4KHS A;  1Q9X A;  2OVR B;  3NCI A;  4JRP A;  2JHC A;  3RMA A;  1FZ2 E;  4RNG A;  4DU3 A;  1XMF E;  3NDK A;  3SUO A;  3QES A;  2H4T A;  2LF3 A;  4QNC A;  3NAE A;  3LZI A;  3NE6 A;  4E3S A;  3SJJ A;  1IH7 A;  4IT5 A;  3L1N A;  3SQ0 A;  1XVE E;  4AI6 A;  4J2A A;  5IRE A;  3QER A;  3TAE A;  4FJX A;  4M3Y A;  2VJ5 A;  2VJ4 A;  3S9H A;  3C6N B;  2P1P B;  4EP9 A;  4FJ9 A;  3CFR A; 
#chains in the Genus database with same CATH homology
 3LDB A;  4M45 A;  1IG9 A;  4J2E A;  1XVF E;  4J2B A;  4KI4 A;  3LZJ A;  4KHW A;  4DTN A;  1NEX B;  3J27 A;  5IBK B;  1WAJ A;  3CFO A;  1FZ6 E;  1FS1 A;  3L2O B;  4FK2 A;  2JH8 A;  4JS4 A;  2FYO A;  2YB5 A;  1FZ4 E;  4ADN A;  4J2D A;  4KHU A;  1XVC E;  4M3X A;  3C6P B;  1FXX A;  2P1Q B;  2E31 A;  1XMH E;  4JS5 A;  4DTP A;  3RWU A;  3NHG A;  2FW3 A;  3SCX A;  4KI6 A;  2B8I A;  1XMG E;  2PFV A;  4EYW A;  4I9Q A;  4RL5 A;  4AKI A;  3LD8 A;  1XU5 E;  1FZ1 E;  4DTJ A;  4KHQ A;  3C94 A;  2JHA A;  4FJM A;  4FJ7 A;  3QNN A;  3SI6 A;  2P1O B;  3L0M A;  3OGM B;  4HCC A;  1FZ7 E;  4X5N A;  3TJY A;  1WAF A;  3N1B A;  2MZW B;  3QEP A;  4HCB A;  2HD0 A;  4X5M A;  3MKS B;  4QND A;  2RCU A;  3SVI A;  3CFP A;  3N1E A;  2P1N B;  3OGL B;  4ADO A;  4I9L A;  4M41 A;  2JH9 A;  1FZ8 E;  4DU4 A;  4M3T A;  4M3U A;  4DTS A;  2B1E A;  3QEV A;  4FJJ A;  2E32 A;  2PFT A;  3WSO A;  2OVP B;  2JPN A;  3HGK E;  2QXF A;  2OYQ A;  1FZ0 E;  4FJG A;  4FJN A;  3TAB A;  4FK4 A;  1XL3 C;  5H37 A;  3QEX A;  3KD5 E;  3C95 A;  4FJL A;  4DTX A;  1FZH E;  2P5O A;  2OZM A;  4DTM A;  4DU1 A;  3NGI A;  4DTO A;  3TAG A;  2DY4 A;  4FJ8 A;  1XU3 E;  4M3W A;  3HGL A;  2JHP A;  4FVM A;  4GAM C;  3RMB A;  3TAF A;  4I6J B;  2DTU A;  1FZ5 E;  3E4W A;  2ATQ A;  1P22 A;  3OGK B;  3SQ1 A;  2B7M A;  1LDK E;  3HL8 A;  1XVG E;  3K2O A;  2P1M B;  1MMO G;  3QEW A;  2P5G A;  4AKG A;  3SPZ A;  4KHY A;  1XVB E;  3KD1 E;  3SNN A;  4FJI A;  1FZ9 E;  3SUQ A;  3SUP A;  3V7D B;  4DTU A;  4FK0 A;  3QET A;  3SUN A;  1MHY G;  4M3R A;  1CLQ A;  1MHZ G;  1FYZ E;  2OVQ B;  3SPY A;  4KHN A;  4AKH A;  3E4Y A;  2DEB A;  4FJ5 A;  3LDS A;  3TL8 B;  3SQ4 A;  3RMD A;  1Q9Y A;  2MMB A;  2VIX A;  3L8B A;  3SQ2 A;  4E4B A;  2OZS A;  1MTY G;  1XVD E;  3HP9 A;  2LF6 A;  3RMC A;  1FZI E;  4RG8 A;  4B08 A;  3QNO A;  3UIQ A;  1FZ3 E;  4M42 A;  3J2P A;  4FJH A;  4M3Z A;  3CQ8 A;  3C6O B;  5IZ7 A;  4EPH A;  4JRQ A;  3QEI A;  4DTR A;  4FJK A;  4KHS A;  1Q9X A;  2OVR B;  3NCI A;  4JRP A;  2JHC A;  3RMA A;  1FZ2 E;  4RNG A;  4DU3 A;  1XMF E;  3NDK A;  3SUO A;  3QES A;  2H4T A;  2LF3 A;  4QNC A;  3NAE A;  3LZI A;  3NE6 A;  4E3S A;  3SJJ A;  1IH7 A;  3L1N A;  3SQ0 A;  1XVE E;  4AI6 A;  4J2A A;  5IRE A;  3QER A;  3TAE A;  4FJX A;  4M3Y A;  2VJ5 A;  2VJ4 A;  3S9H A;  3C6N B;  2P1P B;  4EP9 A;  4FJ9 A;  3CFR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...