4RNGA

Crystal structure of a bacterial homologue of sweet transporters
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
82
structure length
82
Chain Sequence
DLNNLIGIIAGAITTSALIPQALKIYKTKSARDVSLAMFIFMAIGITLWFFYGVLIKEIPVILANLISLILIFLIIFMKIRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords MtN3/saliva family
publication title Crystal structure of a bacterial homologue of SWEET transporters.
pubmed doi rcsb
source organism Thermodesulfovibrio yellowstonii
total genus 34
structure length 82
sequence length 82
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04193 PQ-loop PQ loop repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.290 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 4rngA00
4QNDA 4RNGA 4X5MA 4X5NA 4QNCA
chains in the Genus database with same CATH superfamily
3K2OA 2P5OA 3QEVA 1XU3E 4FJ8A 4FJKA 4M3XA 4IT5A 4QNDA 4DTMA 3UO2A 4RNGA 4DTJA 3C6OB 2B7MA 2LF6A 3SPYA 1XMFE 4GAMC 4FJXA 3NHGA 3QNNA 4ADOA 2K5SA 3SUQA 4E4BA 3QERA 2MMBA 2OVPB 1IH7A 3RMDA 4FJGA 3J2PA 4DTPA 2B1EA 3QEWA 3CFRA 1FZ4E 4I9LA 3LZJA 4JS4A 4FJ5A 2JPNA 4FVMA 4X5NA 4M3ZA 4J2BA 2B8IA 1IG9A 4KI4A 4DTUA 4E3SA 2OZSA 4I6JB 4KHNA 3L1NA 4DU4A 2JQTA 3SI6A 2JH8A 3TAGA 2P1NB 3TJYA 5IREA 4DTXA 3TABA 3TAEA 4FJJA 4FK0A 3QEIA 3NAEA 2JHPA 4J2AA 2E32A 4FK4A 3NDKA 4DTSA 4AKHA 2VJ5A 3UIQA 1XVFE 4I9QA 3OGKB 4FK2A 4M3WA 4AKIA 3E4WA 4M3UA 4DTOA 3E4YA 1NEXB 3NGIA 3HGKE 1FZ7E 1XVGE 3V7DB 2OVQB 4FJLA 3SUOA 4M42A 3C95A 4KHYA 4DU3A 4RG8A 1XVBE 1FZ5E 2RCUA 4FJHA 3NCIA 4AI6A 2RKHA 5IZ7A 4JRQA 1P22A 4KHUA 3RMBA 4M3TA 3CFOA 2P1PB 3BVOA 1FZ1E 3LDSA 3N1EA 3N1BA 2H4TA 2PFVA 1CLQA 3OGMB 4EPHA 3SQ2A 2FYOA 2JH9A 4HCBA 3OGLB 4X5MA 1WAFA 1N1CA 4KHQA 1FZ0E 3QNOA 4FJIA 3QESA 4JRPA 3CFPA 2DEBA 1XVCE 1FZ6E 3SCXA 2DY4A 4DTRA 3TL8B 3L0MA 4M3YA 3NE6A 3SJJA 3SQ4A 2DTUA 1FZ8E 3C94A 1XU5E 4DTNA 4EP9A 2P1QB 1XMHE 3LZIA 4KHWA 2YB5A 1XVDE 3SPZA 4J2DA 1JW2A 4EYWA 3CQ8A 3TAFA 2VJ4A 3LD8A 3SUPA 3QETA 4J2EA 3QEXA 4KI6A 1FZHE 3KD5E 2QXFA 4FJ7A 1FXXA 1Q9XA 4M3RA 4JS5A 2LF3A 3LDBA 4AKGA 3RMCA 3L2OB 1XMGE 4KHSA 3SUNA 2FW3A 1FZIE 3J27A 4HCCA 4FJMA 3MKSB 2HD0A 4M45A 1FYZE 1MHZG 1FZ3E 3RMAA 3SQ1A 1MMOG 4RL5A 4B08A 1FS1A 2OVRB 3C6PB 3SNNA 2MW2A 2OZMA 2ATQA 4ICGC 1MHYG 1FPOA 1LDKE 4QNCA 2MZWB 2PFTA 3HL8A 2JHCA 1WAJA 5IBKB 1MTYG 1FZ9E 2P1OB 3SVIA 1Q9YA 2P5GA 4FJNA 3S9HA 3QEPA 1FZ2E 4M41A 4ADNA 3HP9A 3UO3A 2OYQA 5H37A 3SQ0A 3RWUA 2VIXA 2JHAA 1XL3C 2E31A 3WSOA 3HGLA 3L8BA 4FJ9A 3KD1E 2P1MB 1XVEE 4DU1A 3C6NB
chains in the Genus database with same CATH topology
3K2OA 2P5OA 3QEVA 1XU3E 4FJ8A 4FJKA 4M3XA 4QNDA 4DTMA 4RNGA 4DTJA 3C6OB 2B7MA 2LF6A 3SPYA 1XMFE 4GAMC 4FJXA 3NHGA 3QNNA 4ADOA 3SUQA 4E4BA 3QERA 2MMBA 2OVPB 1IH7A 3RMDA 4FJGA 3J2PA 4DTPA 2B1EA 3QEWA 3CFRA 1FZ4E 4I9LA 3LZJA 4JS4A 4FJ5A 2JPNA 4FVMA 4X5NA 4M3ZA 4J2BA 2B8IA 1IG9A 4KI4A 4DTUA 4E3SA 2OZSA 4I6JB 4KHNA 3L1NA 4DU4A 3SI6A 2JH8A 3TAGA 2P1NB 3TJYA 5IREA 4DTXA 3TABA 3TAEA 4FJJA 4FK0A 3QEIA 3NAEA 2JHPA 4J2AA 2E32A 4FK4A 3NDKA 4DTSA 4AKHA 2VJ5A 3UIQA 1XVFE 4I9QA 3OGKB 4FK2A 4M3WA 4AKIA 3E4WA 4M3UA 4DTOA 3E4YA 1NEXB 3NGIA 3HGKE 1FZ7E 1XVGE 3V7DB 2OVQB 4FJLA 3SUOA 4M42A 3C95A 4KHYA 4DU3A 4RG8A 1XVBE 1FZ5E 2RCUA 4FJHA 3NCIA 4AI6A 5IZ7A 4JRQA 1P22A 4KHUA 3RMBA 4M3TA 3CFOA 2P1PB 1FZ1E 3LDSA 3N1EA 3N1BA 2H4TA 2PFVA 1CLQA 3OGMB 4EPHA 3SQ2A 2FYOA 2JH9A 4HCBA 3OGLB 4X5MA 1WAFA 4KHQA 1FZ0E 3QNOA 4FJIA 3QESA 4JRPA 3CFPA 2DEBA 1XVCE 1FZ6E 3SCXA 2DY4A 4DTRA 3TL8B 3L0MA 4M3YA 3NE6A 3SJJA 3SQ4A 2DTUA 1FZ8E 3C94A 1XU5E 4DTNA 4EP9A 2P1QB 1XMHE 3LZIA 4KHWA 2YB5A 1XVDE 3SPZA 4J2DA 4EYWA 3CQ8A 3TAFA 2VJ4A 3LD8A 3SUPA 3QETA 4J2EA 3QEXA 4KI6A 1FZHE 3KD5E 2QXFA 4FJ7A 1FXXA 1Q9XA 4M3RA 4JS5A 2LF3A 3LDBA 4AKGA 3RMCA 3L2OB 1XMGE 4KHSA 3SUNA 2FW3A 1FZIE 3J27A 4HCCA 4FJMA 3MKSB 2HD0A 4M45A 1FYZE 1MHZG 1FZ3E 3RMAA 3SQ1A 1MMOG 4RL5A 4B08A 1FS1A 2OVRB 3C6PB 3SNNA 2OZMA 2ATQA 1MHYG 1LDKE 4QNCA 2MZWB 2PFTA 3HL8A 2JHCA 1WAJA 5IBKB 1MTYG 1FZ9E 2P1OB 3SVIA 1Q9YA 2P5GA 4FJNA 3S9HA 3QEPA 1FZ2E 4M41A 4ADNA 3HP9A 2OYQA 5H37A 3SQ0A 3RWUA 2VIXA 2JHAA 1XL3C 2E31A 3WSOA 3HGLA 3L8BA 4FJ9A 3KD1E 2P1MB 1XVEE 4DU1A 3C6NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QND A;  4RNG A;  4X5M A;  4X5N A;  4QNC A; 
#chains in the Genus database with same CATH topology
 3K2O A;  2P5O A;  3QEV A;  1XU3 E;  4FJ8 A;  4FJK A;  4M3X A;  4IT5 A;  4QND A;  4DTM A;  3UO2 A;  4RNG A;  4DTJ A;  3C6O B;  2B7M A;  2LF6 A;  3SPY A;  1XMF E;  4GAM C;  4FJX A;  3NHG A;  3QNN A;  4ADO A;  2K5S A;  3SUQ A;  4E4B A;  3QER A;  2MMB A;  2OVP B;  1IH7 A;  3RMD A;  4FJG A;  3J2P A;  4DTP A;  2B1E A;  3QEW A;  3CFR A;  1FZ4 E;  4I9L A;  3LZJ A;  4JS4 A;  4FJ5 A;  2JPN A;  4FVM A;  4X5N A;  4M3Z A;  4J2B A;  2B8I A;  1IG9 A;  4KI4 A;  4DTU A;  4E3S A;  2OZS A;  4I6J B;  4KHN A;  3L1N A;  4DU4 A;  2JQT A;  3SI6 A;  2JH8 A;  3TAG A;  2P1N B;  3TJY A;  5IRE A;  4DTX A;  3TAB A;  3TAE A;  4FJJ A;  4FK0 A;  3QEI A;  3NAE A;  2JHP A;  4J2A A;  2E32 A;  4FK4 A;  3NDK A;  4DTS A;  4AKH A;  2VJ5 A;  3UIQ A;  1XVF E;  4I9Q A;  3OGK B;  4FK2 A;  4M3W A;  4AKI A;  3E4W A;  4M3U A;  4DTO A;  3E4Y A;  1NEX B;  3NGI A;  3HGK E;  1FZ7 E;  1XVG E;  3V7D B;  2OVQ B;  4FJL A;  3SUO A;  4M42 A;  3C95 A;  4KHY A;  4DU3 A;  4RG8 A;  1XVB E;  1FZ5 E;  2RCU A;  4FJH A;  3NCI A;  4AI6 A;  2RKH A;  5IZ7 A;  4JRQ A;  1P22 A;  4KHU A;  3RMB A;  4M3T A;  3CFO A;  2P1P B;  3BVO A;  1FZ1 E;  3LDS A;  3N1E A;  3N1B A;  2H4T A;  2PFV A;  1CLQ A;  3OGM B;  4EPH A;  3SQ2 A;  2FYO A;  2JH9 A;  4HCB A;  3OGL B;  4X5M A;  1WAF A;  1N1C A;  4KHQ A;  1FZ0 E;  3QNO A;  4FJI A;  3QES A;  4JRP A;  3CFP A;  2DEB A;  1XVC E;  1FZ6 E;  3SCX A;  2DY4 A;  4DTR A;  3TL8 B;  3L0M A;  4M3Y A;  3NE6 A;  3SJJ A;  3SQ4 A;  2DTU A;  1FZ8 E;  3C94 A;  1XU5 E;  4DTN A;  4EP9 A;  2P1Q B;  1XMH E;  3LZI A;  4KHW A;  2YB5 A;  1XVD E;  3SPZ A;  4J2D A;  1JW2 A;  4EYW A;  3CQ8 A;  3TAF A;  2VJ4 A;  3LD8 A;  3SUP A;  3QET A;  4J2E A;  3QEX A;  4KI6 A;  1FZH E;  3KD5 E;  2QXF A;  4FJ7 A;  1FXX A;  1Q9X A;  4M3R A;  4JS5 A;  2LF3 A;  3LDB A;  4AKG A;  3RMC A;  3L2O B;  1XMG E;  4KHS A;  3SUN A;  2FW3 A;  1FZI E;  3J27 A;  4HCC A;  4FJM A;  3MKS B;  2HD0 A;  4M45 A;  1FYZ E;  1MHZ G;  1FZ3 E;  3RMA A;  3SQ1 A;  1MMO G;  4RL5 A;  4B08 A;  1FS1 A;  2OVR B;  3C6P B;  3SNN A;  2MW2 A;  2OZM A;  2ATQ A;  4ICG C;  1MHY G;  1FPO A;  1LDK E;  4QNC A;  2MZW B;  2PFT A;  3HL8 A;  2JHC A;  1WAJ A;  5IBK B;  1MTY G;  1FZ9 E;  2P1O B;  3SVI A;  1Q9Y A;  2P5G A;  4FJN A;  3S9H A;  3QEP A;  1FZ2 E;  4M41 A;  4ADN A;  3HP9 A;  3UO3 A;  2OYQ A;  5H37 A;  3SQ0 A;  3RWU A;  2VIX A;  2JHA A;  1XL3 C;  2E31 A;  3WSO A;  3HGL A;  3L8B A;  4FJ9 A;  3KD1 E;  2P1M B;  1XVE E;  4DU1 A;  3C6N B; 
#chains in the Genus database with same CATH homology
 3K2O A;  2P5O A;  3QEV A;  1XU3 E;  4FJ8 A;  4FJK A;  4M3X A;  4QND A;  4DTM A;  4RNG A;  4DTJ A;  3C6O B;  2B7M A;  2LF6 A;  3SPY A;  1XMF E;  4GAM C;  4FJX A;  3NHG A;  3QNN A;  4ADO A;  3SUQ A;  4E4B A;  3QER A;  2MMB A;  2OVP B;  1IH7 A;  3RMD A;  4FJG A;  3J2P A;  4DTP A;  2B1E A;  3QEW A;  3CFR A;  1FZ4 E;  4I9L A;  3LZJ A;  4JS4 A;  4FJ5 A;  2JPN A;  4FVM A;  4X5N A;  4M3Z A;  4J2B A;  2B8I A;  1IG9 A;  4KI4 A;  4DTU A;  4E3S A;  2OZS A;  4I6J B;  4KHN A;  3L1N A;  4DU4 A;  3SI6 A;  2JH8 A;  3TAG A;  2P1N B;  3TJY A;  5IRE A;  4DTX A;  3TAB A;  3TAE A;  4FJJ A;  4FK0 A;  3QEI A;  3NAE A;  2JHP A;  4J2A A;  2E32 A;  4FK4 A;  3NDK A;  4DTS A;  4AKH A;  2VJ5 A;  3UIQ A;  1XVF E;  4I9Q A;  3OGK B;  4FK2 A;  4M3W A;  4AKI A;  3E4W A;  4M3U A;  4DTO A;  3E4Y A;  1NEX B;  3NGI A;  3HGK E;  1FZ7 E;  1XVG E;  3V7D B;  2OVQ B;  4FJL A;  3SUO A;  4M42 A;  3C95 A;  4KHY A;  4DU3 A;  4RG8 A;  1XVB E;  1FZ5 E;  2RCU A;  4FJH A;  3NCI A;  4AI6 A;  5IZ7 A;  4JRQ A;  1P22 A;  4KHU A;  3RMB A;  4M3T A;  3CFO A;  2P1P B;  1FZ1 E;  3LDS A;  3N1E A;  3N1B A;  2H4T A;  2PFV A;  1CLQ A;  3OGM B;  4EPH A;  3SQ2 A;  2FYO A;  2JH9 A;  4HCB A;  3OGL B;  4X5M A;  1WAF A;  4KHQ A;  1FZ0 E;  3QNO A;  4FJI A;  3QES A;  4JRP A;  3CFP A;  2DEB A;  1XVC E;  1FZ6 E;  3SCX A;  2DY4 A;  4DTR A;  3TL8 B;  3L0M A;  4M3Y A;  3NE6 A;  3SJJ A;  3SQ4 A;  2DTU A;  1FZ8 E;  3C94 A;  1XU5 E;  4DTN A;  4EP9 A;  2P1Q B;  1XMH E;  3LZI A;  4KHW A;  2YB5 A;  1XVD E;  3SPZ A;  4J2D A;  4EYW A;  3CQ8 A;  3TAF A;  2VJ4 A;  3LD8 A;  3SUP A;  3QET A;  4J2E A;  3QEX A;  4KI6 A;  1FZH E;  3KD5 E;  2QXF A;  4FJ7 A;  1FXX A;  1Q9X A;  4M3R A;  4JS5 A;  2LF3 A;  3LDB A;  4AKG A;  3RMC A;  3L2O B;  1XMG E;  4KHS A;  3SUN A;  2FW3 A;  1FZI E;  3J27 A;  4HCC A;  4FJM A;  3MKS B;  2HD0 A;  4M45 A;  1FYZ E;  1MHZ G;  1FZ3 E;  3RMA A;  3SQ1 A;  1MMO G;  4RL5 A;  4B08 A;  1FS1 A;  2OVR B;  3C6P B;  3SNN A;  2OZM A;  2ATQ A;  1MHY G;  1LDK E;  4QNC A;  2MZW B;  2PFT A;  3HL8 A;  2JHC A;  1WAJ A;  5IBK B;  1MTY G;  1FZ9 E;  2P1O B;  3SVI A;  1Q9Y A;  2P5G A;  4FJN A;  3S9H A;  3QEP A;  1FZ2 E;  4M41 A;  4ADN A;  3HP9 A;  2OYQ A;  5H37 A;  3SQ0 A;  3RWU A;  2VIX A;  2JHA A;  1XL3 C;  2E31 A;  3WSO A;  3HGL A;  3L8B A;  4FJ9 A;  3KD1 E;  2P1M B;  1XVE E;  4DU1 A;  3C6N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...