3UO3A

Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
174
structure length
174
Chain Sequence
RRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords J-type co-chaperone JAC1, mitochondrial
total genus 64
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo3A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo3A02
2KQXA 1BQ0A 2N05A 2PF4E 2QSAA 2Y4TA 3APOA 2QWPB 2YUAA 3UO2A 2YS8A 2OCHA 1FPOA 4J7ZA 2RKHA 4J80A 1HDJA 2QWQB 1FAFA 2CTWA 1GH6A 2CTQA 3APQA 2QWRB 4IT5A 2DN9A 4RWUA 1IURA 3UO3A 2LO1A 1N4CA 2QWNB 1NZ6A 2LGWA 2GUZB 2L6LA 2GUZA 2QWOB 2CTPA 2Y4UA 2CUGA 2EJ7A 1XBLA 3UCSC 3BVOA 2DMXA 1BQZA 2M6YA 2N04A 2CTRA 1WJZA 3AG7A 1N1CA
chains in the Genus database with same CATH superfamily
4KHWA 4P2ZA 4DTPA 1YXBA 3ABTA 1N36O 5GW7A 2AZ0A 4DTNA 2HJDA 3B2EE 3F5WC 1WP8A 4J9ZB 4LF7O 5IYCO 3BEHA 3OM3B 1QR9A 1IURA 3DC5A 1AP6A 5KHGA 1FXKB 1FZ5E 3HKBB 1M5IA 3ABMC 2GTSA 3U10A 3E4WA 4EYWA 4M3TA 1YEWA 4J42A 3OFNG 1PL0A 5J9PC 2QJ1A 5EZYB 2ZDIA 3ZMSA 3E22B 3ZHQA 4DV1B 1J5EO 1MMOG 5BMVA 3J81N 3RYFB 3HKCA 2CK3G 5CA1A 4U3FH 4U7OA 5GONB 1EZVH 2QM8A 1LDKE 2Q68A 3CEIA 5C8YA 4YIOA 5EYPB 1QHTA 2ZXWB 4JTCB 3G6BA 4X88A 1AILA 3LZJA 4KHPB 4KHUA 4X66B 1Y6XA 1NTKH 2GV9A 3VQWA 5IY5C 3PN1A 1EM1A 3J2PA 1VP7A 1IBLB 4QGPA 1K4CC 1JJOA 1VF7A 4DV3B 4TUYB 1B3QA 3CFPA 2JHAA 3ZRWA 4IHJA 2BOCC 2JRIA 1Q81W 3O9OA 2ATKC 2HJFC 5FPRA 1WAFA 2EJRA 2RNBA 3RWRD 2JGDB 4DR6O 2CGOA 1PL4A 5JJEB 2LF3A 1DF4A 3OAAG 2Q7EA 3K9AA 1IH7A 1K34A 3CRCA 2W0FC 2JQTA 2CUGA 4XDLA 4X65B 2N04A 4TQFA 3S9HA 3ZHRA 5DN6G 3RYIA 1XL6A 1CEZA 3ZHSA 3ZMVA 1GH6A 4JS4A 2QWRB 2ZE7A 2VQFB 3SJBC 4RO2A 1R3JC 1MABG 1MZFA 1N0NA 3CB2A 1GM9A 4DUZO 5IYZB 1H38A 4UCSA 1CXZB 5JQGB 1FZ8E 5KAIZ 4MTXA 3G67A 4NTXA 4JRQA 1D5AA 1XQ8A 2E74B 3C90A 1J5EB 3FFQA 1EFRG 3CE2A 2LGQA 4BR6A 2YB5A 2Y4TA 1W0JG 2PFVA 5BY1A 1PD3A 4J2BA 1O9GA 2R9RB 5EYPA 4EP9A 3DXRB 5EBMC 4UCRA 1F51A 1WLEA 2Y0IA 4B08A 4J11A 4JI4B 1BZKA 4FJMA 1HNWO 5LP6B 1SA0A 1G6UA 4QE9A 1Y66A 2VS0A 3ZHVA 4O4HA 1GN6A 4FK5C 1KYOF 3M7MX 1KP2A 2WA4A 2XOKG 4AHCA 1S77D 4I5SA 3JARB 2LJ2A 4PV1B 5H2FZ 1L8DA 4DV3O 4KI4A 1AVMA 1KECA 4H37A 2XTAA 3JASA 2OZSA 2GUZA 1ORQC 1KUQA 2E5LB 2CTPA 3H1LH 4E2LA 1QCEA 3NXSA 2JGDA 1FYZE 1PM9A 2PF4E 3L71H 5KLVH 2XAGA 2B1GA 3SQ2A 4B7EA 3P3PA 3UT5A 3K5LA 3S3XA 1BT8A 4WFEA 4I9QA 5KHIA 3CSXA 4DV2O 4UUJC 3TCUA 5LGNA 1L0NH 2W0XA 2LO1A 4I50A 4X65O 4X5NA 1ZX3A 5CBFA 5H9CA 3UIQA 5KA6A 4Z1MG 1XVDE 1XDCA 3AK2A 2A7WA 2EILC 2WLLB 2KKWA 2Z0AA 2ZKOA 5EC2C 3W7XA 5B1NA 1Y76A 1OJHA 2XAQA 4B7KA 4MW8A 4HAMA 4I7ZB 5LHIA 5EBLC 1P7GA 1GM8A 4DR7B 3ETQA 1BGYH 4GT1A 1Y74A 3WB0A 3C6PB 3JSLA 1F4NA 4EB6B 5HFLA 1Q82W 4X1IB 2Q0OC 3TJTA 1YZBA 5J2TB 3G80A 2VQEB 3AEIA 4E4EA 5IDJA 2AHYA 4FK2A 2ARHA 5IWAO 3CMAV 1HNWB 3T4DA 5KMGA 3CC7V 2IJKA 1WPXA 1GRJA 5E79Z 3T1YB 3HKEA 5KUMA 2UXDO 1AROP 4C7UA 3LZIA 4EFEA 4QNDA 3CJHA 4AKGA 4WFBV 1QBZA 3JALA 4FJCC 1HNXB 4X64O 4FJ8A 3FB8C 4UB8Z 4IT5A 4GKKB 4J41A 2KB1A 1NBMG 1GM7A 3JAKB 1H2GA 4X1YA 4UXNA 1EN4A 3K57A 4KXRA 1YVWA 4DV2B 4B3RB 1U97A 2A0LA 1SZTA 2NR5A 5LHHA 3AG3B 3ICXA 2F23A 1TUBB 1XI1A 4O4IA 4JI2O 1W59A 1DF5A 2E75B 4DV4B 2RMKB 4FK0A 1E79G 2OWOA 1BHBA 4GKJB 4JF3A 1YDXA 5KA5A 3H9VA 3K08A 2H94A 3ZRXA 1JOYA 1K4DC 1U96A 2AGAA 3WB2A 2IU3A 2WLNA 1XU5E 1EN5A 2A3QA 4DR7O 3VBBA 5JJJB 5LOVA 3W7SA 1VQLV 4JRPA 5LYJA 4H0LB 2GBOA 4O4LA 3BABA 3OT7A 3QEWA 1NH2D 1Y4MA 5IT9N 4LFAB 5FNVB 1K33A 4G28B 3NDKA 4MVMA 5IWAB 1AR1B 5KHHA 2B7MA 2X7RB 3T1YO 1PNMA 1JMKC 5EC1C 3KCXA 3V7DB 3E8GA 4X8AA 4FJIA 5K1PA 3N1EA 4AQYB 2DY4A 4N21A 1VF6A 2AW9A 2ZDIC 3E8HA 3BA8A 4PA6A 5H6RA 2FL4A 5LHGA 3ZMUA 1D5NA 1Z2GA 3IGAC 3IAYA 1I0HA 1TAEA 3ABUA 5KHJA 4PA4A 1JCHA 3CC2V 5K1XA 1HNXO 1QLEB 3WG7B 3AG1B 1BE3H 3RYCA 1VEWA 3B4SA 1VQNV 2WA3A 2V4DA 3B8NA 2DTUA 4D7TA 1FS1A 3OEHG 1NQTA 1F7YA 3MDSA 2Q69A 5LA6B 2QWOB 4B3RO 4R6ZA 2FKXA 4OX9B 1G1XB 4JI2B 2MMBA 4X1IA 1R73A 3UQ8A 3HKDA 1GKFA 2V7QG 4DV4O 3TABA 2V1DA 3A0BZ 2F4VO 3ABLC 3P32A 5FNVA 3SPYA 4FJ5A 4GKJO 2UXXA 3EXAA 2CTQA 3STLC 1JVMA 2JJ2G 3BCCH 3BAAA 2ATQA 4R50A 1SQBH 4RQFA 4TSFG 2K9PA 4NKGB 4NYKA 2B8IA 2HR3A 5LXTA 3ASNB 3Q4HA 2CTRA 3E4YA 3H01A 4DK1A 2CH7A 2EIJC 4CH6A 1JJ2U 2UXCB 3CJHB 4JAAA 4M42A 2FB5A 4U3JA 2P4KA 3CQ8A 3QTCA 2ZXWC 2LF6A 2Z5UA 4IIJA 1FXKC 1B6QA 4HCBA 4UCVA 4LCUC 3ASOB 1HNZB 3W7UA 3L73H 2XAFA 4FFKA 5BR8B 1IBKB 2M6YA 2PZSA 1WJZA 4AI6A 3K0DA 4JI3B 3SUNA 1VQMV 1P84F 1TGOA 1YTFD 5CMUA 5JVDB 3RGBA 1FZ7E 1XEQA 2P5GA 4O4IB 3LNMB 1XNRO 5EBWC 1RFYA 5JJNB 2JDIG 3VQXA 1QVGU 1EZJA 2IU0A 5LMNB 1KQSU 3CX5F 4MT8A 3LDBA 4DTUA 4LC1A 2BTOA 2YC0A 5IREA 5JQGA 4TWKA 2HFEC 3L1NA 3Q4HB 3T1HO 1MMMA 3C3TA 1MZEA 3QO8A 4K0KB 4PA3A 1QLEC 3WG7C 2F1MA 3U11A 4XBFA 2XUMA 1FZHE 3SCXA 3K06A 3LUTB 2O57A 3I56V 3ZRVA 3CMEV 1A32A 2KQXA 3CD6V 4IHJB 3APOA 3LDEA 2EILB 3CCEV 2BOBC 1US6A 1COWG 1N32O 4E3SA 4J2EA 4DR2B 4LF4B 2EULA 4B3SB 4ABMA 3NAEA 3CCUV 4JI1B 2YSUB 3RN4A 1N4CA 2ZE6A 1GK9A 2CDYA 4CH3A 4H33A 1N0JA 1V54B 4O4JB 3PJSK 4JI0B 2UXCO 1SS3A 4JYCA 2OTLV 3RMAA 4PELA 1RM1C 3JARA 1H2SB 4I55B 3SYOA 3VOUA 2VWJA 3RYCB 4GCZA 4QIWF 4ADOA 3SYCA 4G27B 1NS1A 2Y0PA 4H13B 4DYLA 5KUKA 1HNZO 4X1KB 2P1NB 2FTKA 1PKXA 3A8TA 2P06A 1XMFE 1K8AW 3C3SA 2LQTA 2YEVA 1SC5B 2R9IA 2GDSA 3DGEA 4GLXA 1BQ0A 4P9OA 1M9NA 1JX9A 5CB4A 1XNRB 4OGQB 1RM1B 3CXCU 1XVBE 3SPZA 1FZ1E 4BWAA 3P3NA 1NEXB 4NB5A 1TA8A 1IG9A 3SPIA 2XHBA 5LMNO 2RJZA 1GO3F 1RP3B 3EVKA 4K8ZA 2NNUA 3N2KA 2B1IA 3OR7C 2WWWA 3ZCCA 2QXFA 3WFVA 4K3AA 1PP9H 1BSMA 4B3TO 4W4KA 2JVDA 2QR4A 5B3SC 1M1KW 3NE6A 5LOVB 1S3JA 3FKSG 3ZBHA 2EIKB 1B04A 1OZ0A 3LDCA 2CH7B 4DXWA 3HPLC 4UCOA 2PGGA 4DU1A 2IJJA 3L9DA 3CPWU 1S5HC 2OYQA 2ZE8A 2WPDG 4PI0A 2ZM6B 3C95A 1VQ8V 1XHZA 4TV9A 2OT5A 1M56B 4DUYO 4UCTA 3E86A 5A9GA 2UXBB 4Z2WA 3ZMZA 1GN3A 3OMIB 1HP8A 4LWSB 2WLIA 3FB6C 3N1BA 3E22A 2DN9A 3SJQC 1MG1A 2Q5ZA 4I4TA 4PDRA 1FZ3E 4P9PA 2WLHA 3ZN0A 4LR3A 2MW2B 2RQ6A 1HWYA 4DR4B 2YS8A 2ZIMA 3SQ1A 1OV9A 4CH4A 2R70A 4MW3A 4FJ9A 4DV6O 3LDDA 5B66Z 5L3FA 2ADQB 4JYBA 4WBNA 5CBHA 1XMQB 4O4HB 3K0GA 1MA1A 1LUVA 1WPBA 2QEXV 3JATB 1IXBA 4OXSA 4L8JA 4D6TH 4LF6O 1FZ0E 3AG4C 4X20B 2MZWB 4CH5A 3L2OB 4GZRB 4X62B 1Q8IA 1VF6C 1Q7YW 3E89A 2P67A 5KMGB 3NGIA 2Q4PA 4B3TB 3ASOC 1K97A 1M56C 4HZ3A 2A06H 1FD9A 2VJ4A 4LFBO 3CCQV 2K5SA 1AI5A 3ABLB 3X2QC 1DK1A 3TJYA 4RQEA 1FJGB 3KZIZ 1Z5VA 3CP1A 1IBMB 3JSNA 5LBQA 5L3CA 1SZXA 3OTOB 1SQXH 2FW3A 3ZMTA 1Q6IA 5CA0B 1MHYG 3ABKC 3BHPA 2Q7GA 4OPAA 2FMLA 4X1KA 4DUYB 4K8XA 2IM9A 1SF9A 2WLMA 5LL6Y 3MAQA 3SYAA 1I5XA 1Y76B 2UXBO 3OGMB 4LF8B 1RPOA 2Y4UA 3CRMA 3X2QB 5TISZ 3UT5B 2JGUA 1DTOA 4DV0O 5EZYA 1KU9A 4Q6GA 2G38A 2N74A 5D5PA 3L8BA 2QDOA 2XAJA 4JI8B 4K35A 1HR0B 1XL3C 2UXNA 4LBEC 1Y67A 1PPJH 1EN6A 2OIEA 3E35A 4KFMA 4LFCB 4FK4A 2NLJC 3SYPA 2JEXA 5ITZB 1S5JA 2OTJV 1QQCA 1WAZA 3CRQA 1ROPA 4TOIA 4LF5O 1N33O 1Z5WA 1VIBA 5IYBO 5J2UB 4DV7B 4JV5O 2XNDG 4JAVA 4FJXA 4LF6B 3R65A 3SQ0A 3E2EA 2DJVA 1WB7A 3C6NB 2AZ2A 3BPZA 3BVOA 1NU1H 2R9AA 2Q67A 3R66A 1JPXA 1NVPB 4F4LA 2X0LA 4MVRA 5CN0A 3E8FA 1NH2B 3L70H 2LW1A 2PYJA 5FPOA 2F43G 5IJ0A 4O2BB 5IJ0B 4O4JA 4TV8B 5KX5A 2L6LA 4UV9A 5A2QN 2F95B 1VQ5V 1FJGO 4LH6A 4YY3B 3TAGA 1P49A 1IBMO 2CAZC 1XBLA 4QPJA 4R7CA 3TL8B 1XL4A 1FXKA 4DK0A 2WLKA 4J7ZA 1YCIA 3AK3A 1LR1A 4JZGA 4KHSA 3KKYA 2AHZA 4KHYA 4KHPO 5IYZA 1XMOB 1XILA 3K5MA 4NXMB 4GAMC 1VQ7V 3K5NA 4KP4A 4DTXA 4ZHQB 4DU3A 5J2UA 5B1OA 3BY6A 1S5LZ 1X59A 4BW9A 4IL6Z 4WFGA 3AK1A 1XVFE 2UUBB 3A0RA 1JQ0A 1FPOA 4FLUA 1HR0O 1XOUA 1F23A 4X89A 2Q0AA 3OGCC 1YHQV 4NTYA 2ZR3A 5IBKB 5F2VO 4A5UB 4QE7A 2E3CA 3L74H 4DR6B 3ZS8C 1N8RW 4DW0A 1M90W 5EIBC 2HP8A 4FLXA 4UB6Z 2E32A 3SQ4A 4FZ1A 2JS3A 3QEXA 4FFBA 2H3OA 4JV5B 3H1IH 3QERA 1SERA 1FFTB 1XNQO 1JW2A 4DU4A 1AP5A 3JALB 1FYJA 1PV0A 4X5MA 4CBCA 4MVQA 1Q3EA 2VQFO 1WA8A 3TGUH 2DMXA 1GMGA 2D2CB 3MHSC 3AG7A 1QR8A 4DUZB 1URFA 3ETEA 2IJIA 2DOSA 3RVYA 3F7YC 5JVDA 3J7AU 2ZE5A 4OPHA 3VQVA 2QGNA 2QTSA 1AJQA 2BTQB 1L0LH 5B1BB 2YXLA 3D3IA 2OVRB 4AKIA 4ZI7A 1NR7A 4MVOA 3RBZA 1OCRC 1QNMA 4DW1A 3GWKC 1FKAO 4IYHA 2W6IG 1Q6UA 4DRXB 2QM4A 2LP7A 4DRXA 1BCCH 1NTMH 1G4YB 1WB8A 4JI6B 3RVZA 1UPGA 5B1AB 3TAEA 3F5TA 1EBOA 1SETA 2E5LO 3J27A 3CRRA 1WA8B 4FJHA 1OCOC 2Q6AA 4JTDB 4QNCA 2VRZA 3FD9A 1MHZG 4LWSA 1YJWV 3E8BA 4KHQA 2PI4A 3SI6A 3OTFA 1N36B 3HKCB 2RCUA 2P4VA 2OIGA 4FMTA 4JS5A 2QWPB 4D7SA 1ENVA 2HKOA 3RYIB 2YUAA 4M3UA 2F66C 2BTQA 3JD4A 1HDJA 4EKWA 4RUFA 4PI2A 1HW7A 4DTJA 5JCOA 2QKSA 3FB7C 5H6QA 1K73W 1IZ3A 1AR5A 4WBNB 1ZL8A 2QE7G 5FL7G 1BHAA 3RYFA 4RL5A 2AXTZ 5KHKA 4M3RA 3OE7G 4DR3O 2HVJC 4FLZA 2YXHA 3QESA 1V54C 4PDLA 4JYYA 3DSQA 2EZOA 4UVBA 2JHCA 4I6JB 3EHBB 3JAMN 3SUOA 3JD1A 3GWOA 3QNNA 3RYHB 1FXVA 2P22C 3FYIB 4YJ2B 2A9HA 3FYEB 3JATA 4YJ2A 1FZ2E 2YIBA 2QKAA 3RFRA 2E76B 4FM1A 1O9HA 4J9YB 3JASB 3STZC 4IGGA 4M3WA 4GKKO 3IC7A 5D5QA 2BCCH 1T5EA 1FXXA 4DR1O 4B3MB 4ZBMA 1K9MW 1S76D 3QF7A 2WLIB 3CCMV 2X6CA 3K59A 1AB3A 5KAFZ 1L1FA 3OW2U 4TV8A 5KX5B 1KB9F 3JCZA 3K79A 4I55A 5DECA 3H1KH 2XAHA 5H37A 5JWPA 4FIPC 4I0XB 1Q6HA 4FJNA 3UCSC 4GUNA 3CHXA 3EFFK 1OCZB 3AG2B 3HGKE 3QNEA 3QEIA 2ZNJA 3CWBH 4FLTA 4ZOLB 2EIMB 1ZLZA 2YIAA 4I9LA 4HCCA 1MOFA 5LP6A 2D3OW 3QNOA 3TXSA 2UUCB 4DTSA 2ZD9A 5LMUO 5IY5B 1Y74B 1VQ6V 3QEVA 2EJ7A 4UFZA 2VJ5A 4DR3B 4HNAA 4JASA 4AILC 4DTMA 1H8HG 3WB1A 2VWKA 3HP9A 2B9ZA 5FLXN 4CC6A 4JI4O 1N34O 3THOA 3K9SA 2ADPA 5EK0A 2MK3A 3ZIAG 1H2MA 1V55B 3HKEB 1KD1W 3W7TA 2Y69B 4AQYO 4HBNA 2FYOA 1VQPV 1H2LA 3SYQA 4FJLA 1AI7A 3JD2A 2P1OB 2OCCC 2K1EA 4I50B 4TT3G 3GVMA 5JCOC 2R72A 3RT3C 4J80A 1FS0G 4PDMA 1DLBA 4PJ0Z 4GX0A 3A0HZ 1IXMA 3MHHC 1OHHG 4P30A 2DW4A 2WLLA 1MNGA 3W7WA 2CE4A 1K5SA 4NTWA 4WFFA 4DR5O 4DR1B 4FVMA 3QG5A 2LGWA 4B3MO 3MD0A 3BA9A 1IX9A 4NXNO 2Z3YA 3ZHUA 1Q9XA 3IFXA 3M99B 1SQPH 4F6RB 4J7JA 3JCUZ 4MVUA 2DWEC 3CS5A 3HB3B 2QKCA 3OD4A 3LSQA 4LP8A 2IW5A 3RMDA 2F93B 3BRCA 1QVFU 4JZ2A 2EINB 1TVKA 3B77A 4DTRA 2GTAA 4ADNA 4JI5B 2PFTA 3D8CA 1SKVA 3ETDA 2UUCO 3ETGA 4F6EA 1VQKV 3HR0A 3OGLB 3E83A 3ABKB 4GX5A 4PA9A 5LMUB 1I08A 2P90A 3APQA 4JTAB 3MKSB 1AJPA 3NR7A 2P1QB 4M41A 4MTFA 1XHXA 3HKDB 3QVNA 1MSWD 3F7VC 1J95A 4XDKA 1M57B 1GTOA 2YXYA 3RWUA 4BIOA 2VQEO 2OZMA 3M8AA 4MTOA 1YTFB 1N34B 4AI8A 4W4LA 2YIBD 4YXWG 1ZSPA 2E31A 1M93A 1IBKO 2ZT9B 3D3QA 2UXDB 2A79B 4JI3O 3HL8A 3IC9A 4Z1VA 2ZQMA 4FLYA 5L3DA 4UVAA 3UM7A 2NN4A 4F6RA 3K2OA 4O2BA 1KC8W 4MVZA 3JAWB 1YITV 2ZIOA 3OUFA 1TUBA 1BQZA 4TQDA 4MSWC 4X64B 2EX3A 2MW2A 5IE9A 1TVKB 4RNGA 4DR5B 2LW7A 5B1AC 2JHPA 1AI6A 1YJ9V 2DYRC 2UU9B 3OR6C 4NXNB 2W6JG 2H4TA 4WCEV 5DM6V 1VQ9V 4FZ0A 4DTOA 2BSKA 4CS2A 3SUQA 4DV5O 3OUSA 3QO7A 3T1HB 3FB5C 3K04A 1ZL8B 4WFAV 3OGIB 4QJFB 4K0KO 3WU2Z 5B5EZ 1PNKA 5IZ7A 3AG3C 1KBHA 2RN9A 1S0VA 4N23A 1GN4A 2QA4V 1IVSA 3NHGA 1Q5OA 1F4MA 1M57C 4JGSA 5LGTA 3OGKB 1JFFA 4JI5O 1FXHA 4XDJA 1THZA 3G6EV 4RAIA 5JH7A 4DR2O 4LF4O 2ZNIA 4JPRA 2HG5C 3ZEDA 1R3IC 4UVCA 4YHHO 1W0KG 4BIUA 4FJJA 5CBGA 4JI1O 2JIZG 2EBOA 3C94A 4UV8A 4E4BA 2WLJA 4FFBB 2M7WA 2XASA 4JI0O 2C2AA 4HYOA 5LGUA 3JAWA 1XU3E 4M3YA 2P5OA 3QO5A 3ML0A 2ODMA 1FAFA 3I55V 4KUMA 1WN7A 4LFAO 3ZHTA 3RW0A 4U3JB 1V9PA 4KL1A 2HHHO 3T4ZA 2EIKC 2ZCEA 3T1CA 3UKMA 3NCIA 5B1BC 4X9QA 1JA8A 4FPPA 3SPHA 3GB7C 1W2BU 1ZTEA 3SR2C 1CPYA 2WAMA 2YIDA 2ITDC 3L0MA 1AI4A 1I94B 3DTUB 5BXZA 1K92A 2YEVB 4H44B 2JPNA 5H5NA 2CTWA 4MS2A 2OVQB 1KKCA 1VQOV 1H2NA 1Q86W 3ZJZA 5C8YB 2QWNB 5L3EA 2QM7A 5GONA 1Q90D 4FM0A 4I4TB 1XMHE 3KD5E 3G71V 3DC6A 1LNQA 1XMGE 4FJ7A 4PHZA 4ZI7B 2JEUA 2YI9A 2UU9O 3CFOA 3N2KB 2QSAA 1B06A 2OCCB 3S3WA 1LUWA 5L3GA 4DV5B 2P7TC 4CC5A 3OMAB 1VF5B 2Q7HA 1KKDA 2DQ3A 3UO3A 4OX9O 1I5YA 1NKDA 5DEDA 2PY5A 2PI5A 4TUYA 2F4VB 4LF9O 1N1CA 1R3KC 3RMBA 2HD0A 4CS4A 1UJWB 3CYOA 2ZM6O 4RG8A 3FAVA 4PDVA 3LDSA 3L72H 5JH7B 1SA0B 1R3LC 1OCOB 4YHHB 2DYSC 3CRAA 3QEPA 5GTHZ 3G4SV 3SDLA 1PNLA 2YDEA 4JAUA 3H1JH 2GHYA 3JYCA 2EIJB 2HHHB 1SRYA 4RUEA 2JH8A 3SJAC 1TUEB 4MVSA 2DQ0A 4WF9V 1S72V 1R6NA 1CLQA 4J2AA 1GN2A 5BZBA 1G8MA 4YJ3B 3VQYA 4RWUA 1SQGA 1NR1A 2VIXA 5BR8O 1OCRB 2LFRA 1XVEE 4J7KA 4ICGA 2H8PC 1H2KA 2Q9LA 1I94O 1D2DA 3RMCA 3IJ4A 5AG2A 3AG1C 4CS3A 3CCRV 5CB4B 4DO2A 3SJCC 4LNUB 2RCVA 2GSMB 4X20A 3QETA 4ASUG 2ETNA 5E1AC 4X62O 2ILMA 4J10A 1ZUQA 3SGIA 4GX1A 1IDSA 3TXQA 3C6OB 1P22A 2IJHA 1VARA 4LFBB 1NT2B 3RYHA 3CCJV 3CC4V 2PUSA 3N27A 3I5DA 4KI6A 1SESA 1XREA 3TAFA 4JYAB 3JD0A 1CP9A 5IJ9A 2B1EA 4KHNA 2DYRB 4LF9B 1H8EG 2JS5A 3KCYA 4FLVA 2GUZB 3OTOO 4R8CA 3D36A 2Y69C 2X6BA 1N32B 5GTIZ 1VQ4V 4YJ3A 1YI2V 3SNNA 1ZWIC 4B3SO 1QLNA 3TK1A 4AKHA 4LF8O 1E1QG 1K7DA 1OCCB 1FZ6E 2ZR2A 3KD1E 3SPGA 4JI7B 4DV0B 1FZIE 1WP7A 1Q43A 4FM2A 2ZINA 4BAYA 3LSSA 3T2MA 3SPCA 3D36C 3U0ZA 3DXRA 2JH9A 4X1YB 3UO2A 5EIBD 1YSCA 4LFCO 2RKHA 4ZOLA 1FFXA 1NI8A 3FX7A 2P1PB 2YI8A 3B8MA 2X6AA 4DV7O 2Y48A 3ASNC 1FZ4E 1X4TA 4O4LB 5B3SB 1RSOB 2ITCC 4M3ZA 4G2KA 3CCVV 1RSOA 1R6KA 3OMNB 3ZN1A 4EB6A 1NVPD 1UFIA 4LH7A 3SJJA 4MTGA 3HGLA 2OCHA 2EINC 4CZZA 1OCCC 3FAVB 3K03A 3AG4B 1QU7A 4TV9B 1NJIW 2KG7A 2YICA 1NZ6A 3N2GA 3N2GB 5LXTB 3SPJA 2BE3A 1R1BA 2PTMA 3H1HH 4YIPA 1MSDA 4GX2A 4JYAO 4ICGC 4YY3O 5IJ9B 2HVKC 5C93A 1K5QA 2P6JA 4FJKA 2UUAO 4PD4F 2DE0X 1OCZC 3ZX6A 3HKBA 4IIJB 4O2AA 3ZRSA 2JK5C 3LSUA 3JAKA 4J2DA 4BIZA 2Q73A 2JJ1G 2B5UA 1BMFG 2P1MB 5LA6A 2XT9A 5L3BA 4U7NA 1XMOO 4NXMO 1I7FA 4IYIA 2RDCA 1XVGE 4JI7O 4ZHQA 3K3WA 1BL8A 4EEQA 1AJNA 5CA1B 2LFSA 4LNUA 1NTZH 4WFHA 2L35A 2UUBO 2IBZH 2EZPA 3BFRA 4EPHA 3CXHF 1P4RA 4QPKA 4FJGA 1M4UA 1R6TA 3O65A 4DR4O 1XVCE 4BW5A 3CCLV 1SQVH 4DV6B 1FZ9E 1BS3A 3LNNA 3KG2A 4UCUA 2HEPA 1SQQH 1KP3A 3OEEG 1XMQO 5HFMA 3CFRA 2QWQB 1GAXA 2CGNA 3A2FA 1YF2A 2EIMC 1ZAUA 4FLWA 3LD8A 1XNQB 1E1RG 4LF7B 1YIJV 2FYUH 3WSOA 5J2TA 3ZRWB 5CA0A 1KMIZ 4O2AB 2DWDC 1YJNV 4ZIBA 3JD3A 3J80N 1MTYG 1WNSA 4PA7A 1JR9A 4DV1O 5BMVB 1VMGA 1RPRA 1SQFA 3ABMB 2UUAB 4I0XA 2N05A 2Q8VA 5IYDO 2IH1C 5LP6C 3K58A 1Q9YA 3B40A 1FFXB 3L75H 4X66O 2BSKB 3SVIA 3CCSV 2WSSG 3SUPA 3AG2C 4EFBA 3B09A 1P7BA 5LYJB 1IBLO 3P30A 1XUQA 2PYLA 4Q20A 2KSDA 2HLDG 2QTOA 4M3XA 4HNAB 4JI8O 4NR1A 4JI6O 4QNHB 4GYCB 2IH3C 2DYSB 2DEBA 2OVPB 3TETA 1AR4A 1JFFB 3K5OA 5ITZA 1V55C 1K3EA 2KG7B 4LF5B 1N33B 4ZKIA 1DGSA 4L87A 4NVPA 5CA3A 4I9WA 1WAJA 4M45A
chains in the Genus database with same CATH topology
2KQXA 1BQ0A 2N05A 2PF4E 2QSAA 2Y4TA 3APOA 2QWPB 2YUAA 3UO2A 2YS8A 2OCHA 1FPOA 4J7ZA 2RKHA 4J80A 1HDJA 2QWQB 1FAFA 2CTWA 1GH6A 2CTQA 3APQA 2QWRB 4IT5A 2DN9A 4RWUA 1IURA 3UO3A 2LO1A 1N4CA 2QWNB 1NZ6A 2LGWA 2GUZB 2L6LA 2GUZA 2QWOB 2CTPA 2Y4UA 2CUGA 2EJ7A 1XBLA 3UCSC 3BVOA 2DMXA 1BQZA 2M6YA 2N04A 2CTRA 1WJZA 3AG7A 1N1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQX A;  1BQ0 A;  2N05 A;  2PF4 E;  2QSA A;  2Y4T A;  3APO A;  2QWP B;  2YUA A;  3UO2 A;  2YS8 A;  2OCH A;  1FPO A;  4J7Z A;  2RKH A;  4J80 A;  1HDJ A;  2QWQ B;  1FAF A;  2CTW A;  1GH6 A;  2CTQ A;  3APQ A;  2QWR B;  4IT5 A;  2DN9 A;  4RWU A;  1IUR A;  3UO3 A;  2LO1 A;  1N4C A;  2QWN B;  1NZ6 A;  2LGW A;  2GUZ B;  2L6L A;  2GUZ A;  2QWO B;  2CTP A;  2Y4U A;  2CUG A;  2EJ7 A;  1XBL A;  3UCS C;  3BVO A;  2DMX A;  1BQZ A;  2M6Y A;  2N04 A;  2CTR A;  1WJZ A;  3AG7 A;  1N1C A; 
#chains in the Genus database with same CATH topology
 4KHW A;  4P2Z A;  4DTP A;  1YXB A;  3ABT A;  1N36 O;  5GW7 A;  2AZ0 A;  4DTN A;  2HJD A;  3B2E E;  3F5W C;  1WP8 A;  4J9Z B;  4LF7 O;  5IYC O;  3BEH A;  3OM3 B;  1QR9 A;  1IUR A;  3DC5 A;  1AP6 A;  5KHG A;  1FXK B;  1FZ5 E;  3HKB B;  1M5I A;  3ABM C;  2GTS A;  3U10 A;  3E4W A;  4EYW A;  4M3T A;  1YEW A;  4J42 A;  3OFN G;  1PL0 A;  5J9P C;  2QJ1 A;  5EZY B;  2ZDI A;  3ZMS A;  3E22 B;  3ZHQ A;  4DV1 B;  1J5E O;  1MMO G;  5BMV A;  3J81 N;  3RYF B;  3HKC A;  2CK3 G;  5CA1 A;  4U3F H;  4U7O A;  5GON B;  1EZV H;  2QM8 A;  1LDK E;  2Q68 A;  3CEI A;  5C8Y A;  4YIO A;  5EYP B;  1QHT A;  2ZXW B;  4JTC B;  3G6B A;  4X88 A;  1AIL A;  3LZJ A;  4KHP B;  4KHU A;  4X66 B;  1Y6X A;  1NTK H;  2GV9 A;  3VQW A;  5IY5 C;  3PN1 A;  1EM1 A;  3J2P A;  1VP7 A;  1IBL B;  4QGP A;  1K4C C;  1JJO A;  1VF7 A;  4DV3 B;  4TUY B;  1B3Q A;  3CFP A;  2JHA A;  3ZRW A;  4IHJ A;  2BOC C;  2JRI A;  1Q81 W;  3O9O A;  2ATK C;  2HJF C;  5FPR A;  1WAF A;  2EJR A;  2RNB A;  3RWR D;  2JGD B;  4DR6 O;  2CGO A;  1PL4 A;  5JJE B;  2LF3 A;  1DF4 A;  3OAA G;  2Q7E A;  3K9A A;  1IH7 A;  1K34 A;  3CRC A;  2W0F C;  2JQT A;  2CUG A;  4XDL A;  4X65 B;  2N04 A;  4TQF A;  3S9H A;  3ZHR A;  5DN6 G;  3RYI A;  1XL6 A;  1CEZ A;  3ZHS A;  3ZMV A;  1GH6 A;  4JS4 A;  2QWR B;  2ZE7 A;  2VQF B;  3SJB C;  4RO2 A;  1R3J C;  1MAB G;  1MZF A;  1N0N A;  3CB2 A;  1GM9 A;  4DUZ O;  5IYZ B;  1H38 A;  4UCS A;  1CXZ B;  5JQG B;  1FZ8 E;  5KAI Z;  4MTX A;  3G67 A;  4NTX A;  4JRQ A;  1D5A A;  1XQ8 A;  2E74 B;  3C90 A;  1J5E B;  3FFQ A;  1EFR G;  3CE2 A;  2LGQ A;  4BR6 A;  2YB5 A;  2Y4T A;  1W0J G;  2PFV A;  5BY1 A;  1PD3 A;  4J2B A;  1O9G A;  2R9R B;  5EYP A;  4EP9 A;  3DXR B;  5EBM C;  4UCR A;  1F51 A;  1WLE A;  2Y0I A;  4B08 A;  4J11 A;  4JI4 B;  1BZK A;  4FJM A;  1HNW O;  5LP6 B;  1SA0 A;  1G6U A;  4QE9 A;  1Y66 A;  2VS0 A;  3ZHV A;  4O4H A;  1GN6 A;  4FK5 C;  1KYO F;  3M7M X;  1KP2 A;  2WA4 A;  2XOK G;  4AHC A;  1S77 D;  4I5S A;  3JAR B;  2LJ2 A;  4PV1 B;  5H2F Z;  1L8D A;  4DV3 O;  4KI4 A;  1AVM A;  1KEC A;  4H37 A;  2XTA A;  3JAS A;  2OZS A;  2GUZ A;  1ORQ C;  1KUQ A;  2E5L B;  2CTP A;  3H1L H;  4E2L A;  1QCE A;  3NXS A;  2JGD A;  1FYZ E;  1PM9 A;  2PF4 E;  3L71 H;  5KLV H;  2XAG A;  2B1G A;  3SQ2 A;  4B7E A;  3P3P A;  3UT5 A;  3K5L A;  3S3X A;  1BT8 A;  4WFE A;  4I9Q A;  5KHI A;  3CSX A;  4DV2 O;  4UUJ C;  3TCU A;  5LGN A;  1L0N H;  2W0X A;  2LO1 A;  4I50 A;  4X65 O;  4X5N A;  1ZX3 A;  5CBF A;  5H9C A;  3UIQ A;  5KA6 A;  4Z1M G;  1XVD E;  1XDC A;  3AK2 A;  2A7W A;  2EIL C;  2WLL B;  2KKW A;  2Z0A A;  2ZKO A;  5EC2 C;  3W7X A;  5B1N A;  1Y76 A;  1OJH A;  2XAQ A;  4B7K A;  4MW8 A;  4HAM A;  4I7Z B;  5LHI A;  5EBL C;  1P7G A;  1GM8 A;  4DR7 B;  3ETQ A;  1BGY H;  4GT1 A;  1Y74 A;  3WB0 A;  3C6P B;  3JSL A;  1F4N A;  4EB6 B;  5HFL A;  1Q82 W;  4X1I B;  2Q0O C;  3TJT A;  1YZB A;  5J2T B;  3G80 A;  2VQE B;  3AEI A;  4E4E A;  5IDJ A;  2AHY A;  4FK2 A;  2ARH A;  5IWA O;  3CMA V;  1HNW B;  3T4D A;  5KMG A;  3CC7 V;  2IJK A;  1WPX A;  1GRJ A;  5E79 Z;  3T1Y B;  3HKE A;  5KUM A;  2UXD O;  1ARO P;  4C7U A;  3LZI A;  4EFE A;  4QND A;  3CJH A;  4AKG A;  4WFB V;  1QBZ A;  3JAL A;  4FJC C;  1HNX B;  4X64 O;  4FJ8 A;  3FB8 C;  4UB8 Z;  4IT5 A;  4GKK B;  4J41 A;  2KB1 A;  1NBM G;  1GM7 A;  3JAK B;  1H2G A;  4X1Y A;  4UXN A;  1EN4 A;  3K57 A;  4KXR A;  1YVW A;  4DV2 B;  4B3R B;  1U97 A;  2A0L A;  1SZT A;  2NR5 A;  5LHH A;  3AG3 B;  3ICX A;  2F23 A;  1TUB B;  1XI1 A;  4O4I A;  4JI2 O;  1W59 A;  1DF5 A;  2E75 B;  4DV4 B;  2RMK B;  4FK0 A;  1E79 G;  2OWO A;  1BHB A;  4GKJ B;  4JF3 A;  1YDX A;  5KA5 A;  3H9V A;  3K08 A;  2H94 A;  3ZRX A;  1JOY A;  1K4D C;  1U96 A;  2AGA A;  3WB2 A;  2IU3 A;  2WLN A;  1XU5 E;  1EN5 A;  2A3Q A;  4DR7 O;  3VBB A;  5JJJ B;  5LOV A;  3W7S A;  1VQL V;  4JRP A;  5LYJ A;  4H0L B;  2GBO A;  4O4L A;  3BAB A;  3OT7 A;  3QEW A;  1NH2 D;  1Y4M A;  5IT9 N;  4LFA B;  5FNV B;  1K33 A;  4G28 B;  3NDK A;  4MVM A;  5IWA B;  1AR1 B;  5KHH A;  2B7M A;  2X7R B;  3T1Y O;  1PNM A;  1JMK C;  5EC1 C;  3KCX A;  3V7D B;  3E8G A;  4X8A A;  4FJI A;  5K1P A;  3N1E A;  4AQY B;  2DY4 A;  4N21 A;  1VF6 A;  2AW9 A;  2ZDI C;  3E8H A;  3BA8 A;  4PA6 A;  5H6R A;  2FL4 A;  5LHG A;  3ZMU A;  1D5N A;  1Z2G A;  3IGA C;  3IAY A;  1I0H A;  1TAE A;  3ABU A;  5KHJ A;  4PA4 A;  1JCH A;  3CC2 V;  5K1X A;  1HNX O;  1QLE B;  3WG7 B;  3AG1 B;  1BE3 H;  3RYC A;  1VEW A;  3B4S A;  1VQN V;  2WA3 A;  2V4D A;  3B8N A;  2DTU A;  4D7T A;  1FS1 A;  3OEH G;  1NQT A;  1F7Y A;  3MDS A;  2Q69 A;  5LA6 B;  2QWO B;  4B3R O;  4R6Z A;  2FKX A;  4OX9 B;  1G1X B;  4JI2 B;  2MMB A;  4X1I A;  1R73 A;  3UQ8 A;  3HKD A;  1GKF A;  2V7Q G;  4DV4 O;  3TAB A;  2V1D A;  3A0B Z;  2F4V O;  3ABL C;  3P32 A;  5FNV A;  3SPY A;  4FJ5 A;  4GKJ O;  2UXX A;  3EXA A;  2CTQ A;  3STL C;  1JVM A;  2JJ2 G;  3BCC H;  3BAA A;  2ATQ A;  4R50 A;  1SQB H;  4RQF A;  4TSF G;  2K9P A;  4NKG B;  4NYK A;  2B8I A;  2HR3 A;  5LXT A;  3ASN B;  3Q4H A;  2CTR A;  3E4Y A;  3H01 A;  4DK1 A;  2CH7 A;  2EIJ C;  4CH6 A;  1JJ2 U;  2UXC B;  3CJH B;  4JAA A;  4M42 A;  2FB5 A;  4U3J A;  2P4K A;  3CQ8 A;  3QTC A;  2ZXW C;  2LF6 A;  2Z5U A;  4IIJ A;  1FXK C;  1B6Q A;  4HCB A;  4UCV A;  4LCU C;  3ASO B;  1HNZ B;  3W7U A;  3L73 H;  2XAF A;  4FFK A;  5BR8 B;  1IBK B;  2M6Y A;  2PZS A;  1WJZ A;  4AI6 A;  3K0D A;  4JI3 B;  3SUN A;  1VQM V;  1P84 F;  1TGO A;  1YTF D;  5CMU A;  5JVD B;  3RGB A;  1FZ7 E;  1XEQ A;  2P5G A;  4O4I B;  3LNM B;  1XNR O;  5EBW C;  1RFY A;  5JJN B;  2JDI G;  3VQX A;  1QVG U;  1EZJ A;  2IU0 A;  5LMN B;  1KQS U;  3CX5 F;  4MT8 A;  3LDB A;  4DTU A;  4LC1 A;  2BTO A;  2YC0 A;  5IRE A;  5JQG A;  4TWK A;  2HFE C;  3L1N A;  3Q4H B;  3T1H O;  1MMM A;  3C3T A;  1MZE A;  3QO8 A;  4K0K B;  4PA3 A;  1QLE C;  3WG7 C;  2F1M A;  3U11 A;  4XBF A;  2XUM A;  1FZH E;  3SCX A;  3K06 A;  3LUT B;  2O57 A;  3I56 V;  3ZRV A;  3CME V;  1A32 A;  2KQX A;  3CD6 V;  4IHJ B;  3APO A;  3LDE A;  2EIL B;  3CCE V;  2BOB C;  1US6 A;  1COW G;  1N32 O;  4E3S A;  4J2E A;  4DR2 B;  4LF4 B;  2EUL A;  4B3S B;  4ABM A;  3NAE A;  3CCU V;  4JI1 B;  2YSU B;  3RN4 A;  1N4C A;  2ZE6 A;  1GK9 A;  2CDY A;  4CH3 A;  4H33 A;  1N0J A;  1V54 B;  4O4J B;  3PJS K;  4JI0 B;  2UXC O;  1SS3 A;  4JYC A;  2OTL V;  3RMA A;  4PEL A;  1RM1 C;  3JAR A;  1H2S B;  4I55 B;  3SYO A;  3VOU A;  2VWJ A;  3RYC B;  4GCZ A;  4QIW F;  4ADO A;  3SYC A;  4G27 B;  1NS1 A;  2Y0P A;  4H13 B;  4DYL A;  5KUK A;  1HNZ O;  4X1K B;  2P1N B;  2FTK A;  1PKX A;  3A8T A;  2P06 A;  1XMF E;  1K8A W;  3C3S A;  2LQT A;  2YEV A;  1SC5 B;  2R9I A;  2GDS A;  3DGE A;  4GLX A;  1BQ0 A;  4P9O A;  1M9N A;  1JX9 A;  5CB4 A;  1XNR B;  4OGQ B;  1RM1 B;  3CXC U;  1XVB E;  3SPZ A;  1FZ1 E;  4BWA A;  3P3N A;  1NEX B;  4NB5 A;  1TA8 A;  1IG9 A;  3SPI A;  2XHB A;  5LMN O;  2RJZ A;  1GO3 F;  1RP3 B;  3EVK A;  4K8Z A;  2NNU A;  3N2K A;  2B1I A;  3OR7 C;  2WWW A;  3ZCC A;  2QXF A;  3WFV A;  4K3A A;  1PP9 H;  1BSM A;  4B3T O;  4W4K A;  2JVD A;  2QR4 A;  5B3S C;  1M1K W;  3NE6 A;  5LOV B;  1S3J A;  3FKS G;  3ZBH A;  2EIK B;  1B04 A;  1OZ0 A;  3LDC A;  2CH7 B;  4DXW A;  3HPL C;  4UCO A;  2PGG A;  4DU1 A;  2IJJ A;  3L9D A;  3CPW U;  1S5H C;  2OYQ A;  2ZE8 A;  2WPD G;  4PI0 A;  2ZM6 B;  3C95 A;  1VQ8 V;  1XHZ A;  4TV9 A;  2OT5 A;  1M56 B;  4DUY O;  4UCT A;  3E86 A;  5A9G A;  2UXB B;  4Z2W A;  3ZMZ A;  1GN3 A;  3OMI B;  1HP8 A;  4LWS B;  2WLI A;  3FB6 C;  3N1B A;  3E22 A;  2DN9 A;  3SJQ C;  1MG1 A;  2Q5Z A;  4I4T A;  4PDR A;  1FZ3 E;  4P9P A;  2WLH A;  3ZN0 A;  4LR3 A;  2MW2 B;  2RQ6 A;  1HWY A;  4DR4 B;  2YS8 A;  2ZIM A;  3SQ1 A;  1OV9 A;  4CH4 A;  2R70 A;  4MW3 A;  4FJ9 A;  4DV6 O;  3LDD A;  5B66 Z;  5L3F A;  2ADQ B;  4JYB A;  4WBN A;  5CBH A;  1XMQ B;  4O4H B;  3K0G A;  1MA1 A;  1LUV A;  1WPB A;  2QEX V;  3JAT B;  1IXB A;  4OXS A;  4L8J A;  4D6T H;  4LF6 O;  1FZ0 E;  3AG4 C;  4X20 B;  2MZW B;  4CH5 A;  3L2O B;  4GZR B;  4X62 B;  1Q8I A;  1VF6 C;  1Q7Y W;  3E89 A;  2P67 A;  5KMG B;  3NGI A;  2Q4P A;  4B3T B;  3ASO C;  1K97 A;  1M56 C;  4HZ3 A;  2A06 H;  1FD9 A;  2VJ4 A;  4LFB O;  3CCQ V;  2K5S A;  1AI5 A;  3ABL B;  3X2Q C;  1DK1 A;  3TJY A;  4RQE A;  1FJG B;  3KZI Z;  1Z5V A;  3CP1 A;  1IBM B;  3JSN A;  5LBQ A;  5L3C A;  1SZX A;  3OTO B;  1SQX H;  2FW3 A;  3ZMT A;  1Q6I A;  5CA0 B;  1MHY G;  3ABK C;  3BHP A;  2Q7G A;  4OPA A;  2FML A;  4X1K A;  4DUY B;  4K8X A;  2IM9 A;  1SF9 A;  2WLM A;  5LL6 Y;  3MAQ A;  3SYA A;  1I5X A;  1Y76 B;  2UXB O;  3OGM B;  4LF8 B;  1RPO A;  2Y4U A;  3CRM A;  3X2Q B;  5TIS Z;  3UT5 B;  2JGU A;  1DTO A;  4DV0 O;  5EZY A;  1KU9 A;  4Q6G A;  2G38 A;  2N74 A;  5D5P A;  3L8B A;  2QDO A;  2XAJ A;  4JI8 B;  4K35 A;  1HR0 B;  1XL3 C;  2UXN A;  4LBE C;  1Y67 A;  1PPJ H;  1EN6 A;  2OIE A;  3E35 A;  4KFM A;  4LFC B;  4FK4 A;  2NLJ C;  3SYP A;  2JEX A;  5ITZ B;  1S5J A;  2OTJ V;  1QQC A;  1WAZ A;  3CRQ A;  1ROP A;  4TOI A;  4LF5 O;  1N33 O;  1Z5W A;  1VIB A;  5IYB O;  5J2U B;  4DV7 B;  4JV5 O;  2XND G;  4JAV A;  4FJX A;  4LF6 B;  3R65 A;  3SQ0 A;  3E2E A;  2DJV A;  1WB7 A;  3C6N B;  2AZ2 A;  3BPZ A;  3BVO A;  1NU1 H;  2R9A A;  2Q67 A;  3R66 A;  1JPX A;  1NVP B;  4F4L A;  2X0L A;  4MVR A;  5CN0 A;  3E8F A;  1NH2 B;  3L70 H;  2LW1 A;  2PYJ A;  5FPO A;  2F43 G;  5IJ0 A;  4O2B B;  5IJ0 B;  4O4J A;  4TV8 B;  5KX5 A;  2L6L A;  4UV9 A;  5A2Q N;  2F95 B;  1VQ5 V;  1FJG O;  4LH6 A;  4YY3 B;  3TAG A;  1P49 A;  1IBM O;  2CAZ C;  1XBL A;  4QPJ A;  4R7C A;  3TL8 B;  1XL4 A;  1FXK A;  4DK0 A;  2WLK A;  4J7Z A;  1YCI A;  3AK3 A;  1LR1 A;  4JZG A;  4KHS A;  3KKY A;  2AHZ A;  4KHY A;  4KHP O;  5IYZ A;  1XMO B;  1XIL A;  3K5M A;  4NXM B;  4GAM C;  1VQ7 V;  3K5N A;  4KP4 A;  4DTX A;  4ZHQ B;  4DU3 A;  5J2U A;  5B1O A;  3BY6 A;  1S5L Z;  1X59 A;  4BW9 A;  4IL6 Z;  4WFG A;  3AK1 A;  1XVF E;  2UUB B;  3A0R A;  1JQ0 A;  1FPO A;  4FLU A;  1HR0 O;  1XOU A;  1F23 A;  4X89 A;  2Q0A A;  3OGC C;  1YHQ V;  4NTY A;  2ZR3 A;  5IBK B;  5F2V O;  4A5U B;  4QE7 A;  2E3C A;  3L74 H;  4DR6 B;  3ZS8 C;  1N8R W;  4DW0 A;  1M90 W;  5EIB C;  2HP8 A;  4FLX A;  4UB6 Z;  2E32 A;  3SQ4 A;  4FZ1 A;  2JS3 A;  3QEX A;  4FFB A;  2H3O A;  4JV5 B;  3H1I H;  3QER A;  1SER A;  1FFT B;  1XNQ O;  1JW2 A;  4DU4 A;  1AP5 A;  3JAL B;  1FYJ A;  1PV0 A;  4X5M A;  4CBC A;  4MVQ A;  1Q3E A;  2VQF O;  1WA8 A;  3TGU H;  2DMX A;  1GMG A;  2D2C B;  3MHS C;  3AG7 A;  1QR8 A;  4DUZ B;  1URF A;  3ETE A;  2IJI A;  2DOS A;  3RVY A;  3F7Y C;  5JVD A;  3J7A U;  2ZE5 A;  4OPH A;  3VQV A;  2QGN A;  2QTS A;  1AJQ A;  2BTQ B;  1L0L H;  5B1B B;  2YXL A;  3D3I A;  2OVR B;  4AKI A;  4ZI7 A;  1NR7 A;  4MVO A;  3RBZ A;  1OCR C;  1QNM A;  4DW1 A;  3GWK C;  1FKA O;  4IYH A;  2W6I G;  1Q6U A;  4DRX B;  2QM4 A;  2LP7 A;  4DRX A;  1BCC H;  1NTM H;  1G4Y B;  1WB8 A;  4JI6 B;  3RVZ A;  1UPG A;  5B1A B;  3TAE A;  3F5T A;  1EBO A;  1SET A;  2E5L O;  3J27 A;  3CRR A;  1WA8 B;  4FJH A;  1OCO C;  2Q6A A;  4JTD B;  4QNC A;  2VRZ A;  3FD9 A;  1MHZ G;  4LWS A;  1YJW V;  3E8B A;  4KHQ A;  2PI4 A;  3SI6 A;  3OTF A;  1N36 B;  3HKC B;  2RCU A;  2P4V A;  2OIG A;  4FMT A;  4JS5 A;  2QWP B;  4D7S A;  1ENV A;  2HKO A;  3RYI B;  2YUA A;  4M3U A;  2F66 C;  2BTQ A;  3JD4 A;  1HDJ A;  4EKW A;  4RUF A;  4PI2 A;  1HW7 A;  4DTJ A;  5JCO A;  2QKS A;  3FB7 C;  5H6Q A;  1K73 W;  1IZ3 A;  1AR5 A;  4WBN B;  1ZL8 A;  2QE7 G;  5FL7 G;  1BHA A;  3RYF A;  4RL5 A;  2AXT Z;  5KHK A;  4M3R A;  3OE7 G;  4DR3 O;  2HVJ C;  4FLZ A;  2YXH A;  3QES A;  1V54 C;  4PDL A;  4JYY A;  3DSQ A;  2EZO A;  4UVB A;  2JHC A;  4I6J B;  3EHB B;  3JAM N;  3SUO A;  3JD1 A;  3GWO A;  3QNN A;  3RYH B;  1FXV A;  2P22 C;  3FYI B;  4YJ2 B;  2A9H A;  3FYE B;  3JAT A;  4YJ2 A;  1FZ2 E;  2YIB A;  2QKA A;  3RFR A;  2E76 B;  4FM1 A;  1O9H A;  4J9Y B;  3JAS B;  3STZ C;  4IGG A;  4M3W A;  4GKK O;  3IC7 A;  5D5Q A;  2BCC H;  1T5E A;  1FXX A;  4DR1 O;  4B3M B;  4ZBM A;  1K9M W;  1S76 D;  3QF7 A;  2WLI B;  3CCM V;  2X6C A;  3K59 A;  1AB3 A;  5KAF Z;  1L1F A;  3OW2 U;  4TV8 A;  5KX5 B;  1KB9 F;  3JCZ A;  3K79 A;  4I55 A;  5DEC A;  3H1K H;  2XAH A;  5H37 A;  5JWP A;  4FIP C;  4I0X B;  1Q6H A;  4FJN A;  3UCS C;  4GUN A;  3CHX A;  3EFF K;  1OCZ B;  3AG2 B;  3HGK E;  3QNE A;  3QEI A;  2ZNJ A;  3CWB H;  4FLT A;  4ZOL B;  2EIM B;  1ZLZ A;  2YIA A;  4I9L A;  4HCC A;  1MOF A;  5LP6 A;  2D3O W;  3QNO A;  3TXS A;  2UUC B;  4DTS A;  2ZD9 A;  5LMU O;  5IY5 B;  1Y74 B;  1VQ6 V;  3QEV A;  2EJ7 A;  4UFZ A;  2VJ5 A;  4DR3 B;  4HNA A;  4JAS A;  4AIL C;  4DTM A;  1H8H G;  3WB1 A;  2VWK A;  3HP9 A;  2B9Z A;  5FLX N;  4CC6 A;  4JI4 O;  1N34 O;  3THO A;  3K9S A;  2ADP A;  5EK0 A;  2MK3 A;  3ZIA G;  1H2M A;  1V55 B;  3HKE B;  1KD1 W;  3W7T A;  2Y69 B;  4AQY O;  4HBN A;  2FYO A;  1VQP V;  1H2L A;  3SYQ A;  4FJL A;  1AI7 A;  3JD2 A;  2P1O B;  2OCC C;  2K1E A;  4I50 B;  4TT3 G;  3GVM A;  5JCO C;  2R72 A;  3RT3 C;  4J80 A;  1FS0 G;  4PDM A;  1DLB A;  4PJ0 Z;  4GX0 A;  3A0H Z;  1IXM A;  3MHH C;  1OHH G;  4P30 A;  2DW4 A;  2WLL A;  1MNG A;  3W7W A;  2CE4 A;  1K5S A;  4NTW A;  4WFF A;  4DR5 O;  4DR1 B;  4FVM A;  3QG5 A;  2LGW A;  4B3M O;  3MD0 A;  3BA9 A;  1IX9 A;  4NXN O;  2Z3Y A;  3ZHU A;  1Q9X A;  3IFX A;  3M99 B;  1SQP H;  4F6R B;  4J7J A;  3JCU Z;  4MVU A;  2DWE C;  3CS5 A;  3HB3 B;  2QKC A;  3OD4 A;  3LSQ A;  4LP8 A;  2IW5 A;  3RMD A;  2F93 B;  3BRC A;  1QVF U;  4JZ2 A;  2EIN B;  1TVK A;  3B77 A;  4DTR A;  2GTA A;  4ADN A;  4JI5 B;  2PFT A;  3D8C A;  1SKV A;  3ETD A;  2UUC O;  3ETG A;  4F6E A;  1VQK V;  3HR0 A;  3OGL B;  3E83 A;  3ABK B;  4GX5 A;  4PA9 A;  5LMU B;  1I08 A;  2P90 A;  3APQ A;  4JTA B;  3MKS B;  1AJP A;  3NR7 A;  2P1Q B;  4M41 A;  4MTF A;  1XHX A;  3HKD B;  3QVN A;  1MSW D;  3F7V C;  1J95 A;  4XDK A;  1M57 B;  1GTO A;  2YXY A;  3RWU A;  4BIO A;  2VQE O;  2OZM A;  3M8A A;  4MTO A;  1YTF B;  1N34 B;  4AI8 A;  4W4L A;  2YIB D;  4YXW G;  1ZSP A;  2E31 A;  1M93 A;  1IBK O;  2ZT9 B;  3D3Q A;  2UXD B;  2A79 B;  4JI3 O;  3HL8 A;  3IC9 A;  4Z1V A;  2ZQM A;  4FLY A;  5L3D A;  4UVA A;  3UM7 A;  2NN4 A;  4F6R A;  3K2O A;  4O2B A;  1KC8 W;  4MVZ A;  3JAW B;  1YIT V;  2ZIO A;  3OUF A;  1TUB A;  1BQZ A;  4TQD A;  4MSW C;  4X64 B;  2EX3 A;  2MW2 A;  5IE9 A;  1TVK B;  4RNG A;  4DR5 B;  2LW7 A;  5B1A C;  2JHP A;  1AI6 A;  1YJ9 V;  2DYR C;  2UU9 B;  3OR6 C;  4NXN B;  2W6J G;  2H4T A;  4WCE V;  5DM6 V;  1VQ9 V;  4FZ0 A;  4DTO A;  2BSK A;  4CS2 A;  3SUQ A;  4DV5 O;  3OUS A;  3QO7 A;  3T1H B;  3FB5 C;  3K04 A;  1ZL8 B;  4WFA V;  3OGI B;  4QJF B;  4K0K O;  3WU2 Z;  5B5E Z;  1PNK A;  5IZ7 A;  3AG3 C;  1KBH A;  2RN9 A;  1S0V A;  4N23 A;  1GN4 A;  2QA4 V;  1IVS A;  3NHG A;  1Q5O A;  1F4M A;  1M57 C;  4JGS A;  5LGT A;  3OGK B;  1JFF A;  4JI5 O;  1FXH A;  4XDJ A;  1THZ A;  3G6E V;  4RAI A;  5JH7 A;  4DR2 O;  4LF4 O;  2ZNI A;  4JPR A;  2HG5 C;  3ZED A;  1R3I C;  4UVC A;  4YHH O;  1W0K G;  4BIU A;  4FJJ A;  5CBG A;  4JI1 O;  2JIZ G;  2EBO A;  3C94 A;  4UV8 A;  4E4B A;  2WLJ A;  4FFB B;  2M7W A;  2XAS A;  4JI0 O;  2C2A A;  4HYO A;  5LGU A;  3JAW A;  1XU3 E;  4M3Y A;  2P5O A;  3QO5 A;  3ML0 A;  2ODM A;  1FAF A;  3I55 V;  4KUM A;  1WN7 A;  4LFA O;  3ZHT A;  3RW0 A;  4U3J B;  1V9P A;  4KL1 A;  2HHH O;  3T4Z A;  2EIK C;  2ZCE A;  3T1C A;  3UKM A;  3NCI A;  5B1B C;  4X9Q A;  1JA8 A;  4FPP A;  3SPH A;  3GB7 C;  1W2B U;  1ZTE A;  3SR2 C;  1CPY A;  2WAM A;  2YID A;  2ITD C;  3L0M A;  1AI4 A;  1I94 B;  3DTU B;  5BXZ A;  1K92 A;  2YEV B;  4H44 B;  2JPN A;  5H5N A;  2CTW A;  4MS2 A;  2OVQ B;  1KKC A;  1VQO V;  1H2N A;  1Q86 W;  3ZJZ A;  5C8Y B;  2QWN B;  5L3E A;  2QM7 A;  5GON A;  1Q90 D;  4FM0 A;  4I4T B;  1XMH E;  3KD5 E;  3G71 V;  3DC6 A;  1LNQ A;  1XMG E;  4FJ7 A;  4PHZ A;  4ZI7 B;  2JEU A;  2YI9 A;  2UU9 O;  3CFO A;  3N2K B;  2QSA A;  1B06 A;  2OCC B;  3S3W A;  1LUW A;  5L3G A;  4DV5 B;  2P7T C;  4CC5 A;  3OMA B;  1VF5 B;  2Q7H A;  1KKD A;  2DQ3 A;  3UO3 A;  4OX9 O;  1I5Y A;  1NKD A;  5DED A;  2PY5 A;  2PI5 A;  4TUY A;  2F4V B;  4LF9 O;  1N1C A;  1R3K C;  3RMB A;  2HD0 A;  4CS4 A;  1UJW B;  3CYO A;  2ZM6 O;  4RG8 A;  3FAV A;  4PDV A;  3LDS A;  3L72 H;  5JH7 B;  1SA0 B;  1R3L C;  1OCO B;  4YHH B;  2DYS C;  3CRA A;  3QEP A;  5GTH Z;  3G4S V;  3SDL A;  1PNL A;  2YDE A;  4JAU A;  3H1J H;  2GHY A;  3JYC A;  2EIJ B;  2HHH B;  1SRY A;  4RUE A;  2JH8 A;  3SJA C;  1TUE B;  4MVS A;  2DQ0 A;  4WF9 V;  1S72 V;  1R6N A;  1CLQ A;  4J2A A;  1GN2 A;  5BZB A;  1G8M A;  4YJ3 B;  3VQY A;  4RWU A;  1SQG A;  1NR1 A;  2VIX A;  5BR8 O;  1OCR B;  2LFR A;  1XVE E;  4J7K A;  4ICG A;  2H8P C;  1H2K A;  2Q9L A;  1I94 O;  1D2D A;  3RMC A;  3IJ4 A;  5AG2 A;  3AG1 C;  4CS3 A;  3CCR V;  5CB4 B;  4DO2 A;  3SJC C;  4LNU B;  2RCV A;  2GSM B;  4X20 A;  3QET A;  4ASU G;  2ETN A;  5E1A C;  4X62 O;  2ILM A;  4J10 A;  1ZUQ A;  3SGI A;  4GX1 A;  1IDS A;  3TXQ A;  3C6O B;  1P22 A;  2IJH A;  1VAR A;  4LFB B;  1NT2 B;  3RYH A;  3CCJ V;  3CC4 V;  2PUS A;  3N27 A;  3I5D A;  4KI6 A;  1SES A;  1XRE A;  3TAF A;  4JYA B;  3JD0 A;  1CP9 A;  5IJ9 A;  2B1E A;  4KHN A;  2DYR B;  4LF9 B;  1H8E G;  2JS5 A;  3KCY A;  4FLV A;  2GUZ B;  3OTO O;  4R8C A;  3D36 A;  2Y69 C;  2X6B A;  1N32 B;  5GTI Z;  1VQ4 V;  4YJ3 A;  1YI2 V;  3SNN A;  1ZWI C;  4B3S O;  1QLN A;  3TK1 A;  4AKH A;  4LF8 O;  1E1Q G;  1K7D A;  1OCC B;  1FZ6 E;  2ZR2 A;  3KD1 E;  3SPG A;  4JI7 B;  4DV0 B;  1FZI E;  1WP7 A;  1Q43 A;  4FM2 A;  2ZIN A;  4BAY A;  3LSS A;  3T2M A;  3SPC A;  3D36 C;  3U0Z A;  3DXR A;  2JH9 A;  4X1Y B;  3UO2 A;  5EIB D;  1YSC A;  4LFC O;  2RKH A;  4ZOL A;  1FFX A;  1NI8 A;  3FX7 A;  2P1P B;  2YI8 A;  3B8M A;  2X6A A;  4DV7 O;  2Y48 A;  3ASN C;  1FZ4 E;  1X4T A;  4O4L B;  5B3S B;  1RSO B;  2ITC C;  4M3Z A;  4G2K A;  3CCV V;  1RSO A;  1R6K A;  3OMN B;  3ZN1 A;  4EB6 A;  1NVP D;  1UFI A;  4LH7 A;  3SJJ A;  4MTG A;  3HGL A;  2OCH A;  2EIN C;  4CZZ A;  1OCC C;  3FAV B;  3K03 A;  3AG4 B;  1QU7 A;  4TV9 B;  1NJI W;  2KG7 A;  2YIC A;  1NZ6 A;  3N2G A;  3N2G B;  5LXT B;  3SPJ A;  2BE3 A;  1R1B A;  2PTM A;  3H1H H;  4YIP A;  1MSD A;  4GX2 A;  4JYA O;  4ICG C;  4YY3 O;  5IJ9 B;  2HVK C;  5C93 A;  1K5Q A;  2P6J A;  4FJK A;  2UUA O;  4PD4 F;  2DE0 X;  1OCZ C;  3ZX6 A;  3HKB A;  4IIJ B;  4O2A A;  3ZRS A;  2JK5 C;  3LSU A;  3JAK A;  4J2D A;  4BIZ A;  2Q73 A;  2JJ1 G;  2B5U A;  1BMF G;  2P1M B;  5LA6 A;  2XT9 A;  5L3B A;  4U7N A;  1XMO O;  4NXM O;  1I7F A;  4IYI A;  2RDC A;  1XVG E;  4JI7 O;  4ZHQ A;  3K3W A;  1BL8 A;  4EEQ A;  1AJN A;  5CA1 B;  2LFS A;  4LNU A;  1NTZ H;  4WFH A;  2L35 A;  2UUB O;  2IBZ H;  2EZP A;  3BFR A;  4EPH A;  3CXH F;  1P4R A;  4QPK A;  4FJG A;  1M4U A;  1R6T A;  3O65 A;  4DR4 O;  1XVC E;  4BW5 A;  3CCL V;  1SQV H;  4DV6 B;  1FZ9 E;  1BS3 A;  3LNN A;  3KG2 A;  4UCU A;  2HEP A;  1SQQ H;  1KP3 A;  3OEE G;  1XMQ O;  5HFM A;  3CFR A;  2QWQ B;  1GAX A;  2CGN A;  3A2F A;  1YF2 A;  2EIM C;  1ZAU A;  4FLW A;  3LD8 A;  1XNQ B;  1E1R G;  4LF7 B;  1YIJ V;  2FYU H;  3WSO A;  5J2T A;  3ZRW B;  5CA0 A;  1KMI Z;  4O2A B;  2DWD C;  1YJN V;  4ZIB A;  3JD3 A;  3J80 N;  1MTY G;  1WNS A;  4PA7 A;  1JR9 A;  4DV1 O;  5BMV B;  1VMG A;  1RPR A;  1SQF A;  3ABM B;  2UUA B;  4I0X A;  2N05 A;  2Q8V A;  5IYD O;  2IH1 C;  5LP6 C;  3K58 A;  1Q9Y A;  3B40 A;  1FFX B;  3L75 H;  4X66 O;  2BSK B;  3SVI A;  3CCS V;  2WSS G;  3SUP A;  3AG2 C;  4EFB A;  3B09 A;  1P7B A;  5LYJ B;  1IBL O;  3P30 A;  1XUQ A;  2PYL A;  4Q20 A;  2KSD A;  2HLD G;  2QTO A;  4M3X A;  4HNA B;  4JI8 O;  4NR1 A;  4JI6 O;  4QNH B;  4GYC B;  2IH3 C;  2DYS B;  2DEB A;  2OVP B;  3TET A;  1AR4 A;  1JFF B;  3K5O A;  5ITZ A;  1V55 C;  1K3E A;  2KG7 B;  4LF5 B;  1N33 B;  4ZKI A;  1DGS A;  4L87 A;  4NVP A;  5CA3 A;  4I9W A;  1WAJ A;  4M45 A; 
#chains in the Genus database with same CATH homology
 2KQX A;  1BQ0 A;  2N05 A;  2PF4 E;  2QSA A;  2Y4T A;  3APO A;  2QWP B;  2YUA A;  3UO2 A;  2YS8 A;  2OCH A;  1FPO A;  4J7Z A;  2RKH A;  4J80 A;  1HDJ A;  2QWQ B;  1FAF A;  2CTW A;  1GH6 A;  2CTQ A;  3APQ A;  2QWR B;  4IT5 A;  2DN9 A;  4RWU A;  1IUR A;  3UO3 A;  2LO1 A;  1N4C A;  2QWN B;  1NZ6 A;  2LGW A;  2GUZ B;  2L6L A;  2GUZ A;  2QWO B;  2CTP A;  2Y4U A;  2CUG A;  2EJ7 A;  1XBL A;  3UCS C;  3BVO A;  2DMX A;  1BQZ A;  2M6Y A;  2N04 A;  2CTR A;  1WJZ A;  3AG7 A;  1N1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...