3UO3A

Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
174
structure length
174
Chain Sequence
RRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
molecule keywords J-type co-chaperone JAC1, mitochondrial
total genus 64
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo3A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo3A02
2CTWA 2CUGA 2QWNB 3APQA 1NZ6A 2PF4E 2QWQB 1IURA 2EJ7A 3UCSC 1BQZA 1XBLA 1N1CA 2QWOB 3UO3A 2M6YA 2QWPB 2OCHA 2GUZA 1GH6A 2Y4TA 3AG7A 2KQXA 2N05A 2LO1A 4IT5A 3BVOA 4RWUA 1FAFA 2CTQA 2LGWA 2YS8A 1HDJA 2DMXA 2GUZB 2L6LA 2QSAA 2QWRB 4J80A 1N4CA 2YUAA 4J7ZA 2N04A 1FPOA 3UO2A 2CTRA 2RKHA 3APOA 2CTPA 2DN9A 1WJZA 1BQ0A 2Y4UA
chains in the Genus database with same CATH superfamily
4DV6B 4DW1A 5KLVH 1H2KA 3KD1E 3FFQA 3ZRSA 2LF3A 3UO3A 2YXLA 1PNMA 3DXRA 2LGQA 2JRIA 5ITZB 2FL4A 1AB3A 4J10A 1DTOA 4K0KB 1GO3F 2YUAA 2WA3A 4BIOA 3IGAC 2OIEA 2ZE6A 3ZMSA 1Q5OA 4FK0A 3ZBHA 1R3LC 2QWNB 2LP7A 3DGEA 3O9OA 4WF9V 4O4JB 4CH3A 1VF7A 3W7TA 4DV4O 4O4LB 4R7CA 3CJHA 2E31A 4M41A 5JJEB 4LF7B 3SQ2A 3HR0A 1YTFB 5H6RA 1LR1A 2F4VO 3CE2A 2KB1A 4J7ZA 2D2CB 2UUAO 2ZXWB 2K9PA 3K5LA 1IBKB 1S5JA 4JZGA 2QXFA 2YI8A 5L3GA 1QR8A 2UXNA 3OUFA 3VBBA 2UUCO 3SVIA 3VQWA 1P7GA 1WA8A 1CEZA 3SQ4A 4JI7B 3ZHTA 4UFZA 4O4IA 2A3QA 4LR3A 2F66C 2QR4A 1D2DA 1SA0B 1FFXA 1JR9A 1WPBA 2C2AA 3JSNA 4PHZA 2VS0A 3CRRA 3C6OB 4I7ZB 1IXMA 1SQVH 4JTAB 5IYBO 4KP4A 4B3RO 3JD2A 3JALA 3CCJV 3SUOA 4N23A 3L0MA 2LGWA 1G8MA 1A32A 4FFBA 3ETEA 5CA1A 1KU9A 1FZ4E 2P06A 2QTOA 4FMTA 4MTOA 4M3WA 5EZYA 2ARHA 1CLQA 2JS3A 4NTWA 4F6RB 1XVBE 2HD0A 2CTWA 2WLIB 4YXWG 2GV9A 4DR2O 1N33B 1WAJA 3OEEG 4JRQA 1XU3E 3K9AA 4QJFB 2EIJB 4KHQA 1EM1A 1EFRG 4FZ1A 5EBWC 1SQFA 1EN4A 4GKJO 5KX5B 4AILC 4DUYO 4UXNA 4WFEA 1BSMA 1XVDE 1FXKB 4JYBA 2JGDB 2PUSA 1KKCA 3M8AA 4L8JA 3HPLC 3T1YB 4AKIA 3EFFK 1XMQB 1IZ3A 2AHYA 3BHPA 4LF8O 4X64O 2HHHB 1VMGA 4IHJA 4YHHB 2WLIA 4DK1A 5BXZA 1JFFB 1JQ0A 4TUYA 4JYYA 2XUMA 5EK0A 5CBGA 4IIJA 4ZBMA 3LDSA 3L1NA 2Q5ZA 2FB5A 4X1YA 4JV5B 2WWWA 2R9AA 3ABMC 3ABLC 2CH7A 5BR8O 1H2SB 2QWQB 3LNNA 1HNZB 4FM1A 4UB8Z 3VQXA 3TETA 2WAMA 2Q67A 1E1QG 2QWRB 3SPGA 1F4MA 4MVRA 1YVWA 2WLKA 1GN3A 4Q6GA 1HNWB 1XMFE 4MW8A 4WBNA 5L3DA 1CPYA 4DR4B 1MNGA 1Z2GA 3A8TA 5C93A 1XNQB 3TAGA 1PNKA 4X8AA 4BR6A 4DV1B 4P2ZA 3JD3A 1XVGE 4JI6O 4KFMA 3K5MA 2DW4A 4GYCB 4X20B 5LA6A 3S3XA 1BHBA 3N1EA 3B2EE 4DV7B 2YIBD 1J5EO 1B04A 1H2MA 5ITZA 2ATQA 3D3IA 1OHHG 1JFFA 1OCCC 3STZC 4U3JA 2HP8A 2X7RB 3E86A 1Q9YA 2EILB 3FB8C 2OYQA 5IBKB 4FPPA 4NKGB 3THOA 4QGPA 3L9DA 2MMBA 4NXMO 1URFA 4G2KA 3T4ZA 2JGUA 5EC2C 4XBFA 4D7TA 5KHIA 1PL0A 3BAAA 2W6JG 3CEIA 1FYZE 2W0FC 1I94B 1XNQO 4D6TH 4DYLA 4QNHB 1WPXA 5DM6V 4X5NA 4OX9O 3ZHRA 4GKKB 2PI4A 3K5NA 1FZ0E 4RUFA 1YZBA 4DTXA 2IJHA 3L72H 3CPWU 1XQ8A 3APQA 3K79A 1K3EA 3QERA 2D3OW 3OGCC 3S9HA 1VQLV 2VIXA 2F43G 4DTSA 5KMGB 3LNMB 3TL8B 2OTLV 3QNNA 2LQTA 2FMLA 1QHTA 3H01A 4WFAV 3E89A 5IY5B 3QO7A 2Q7EA 3OW2U 4O2AB 4FJMA 3T1HB 3OMAB 5KHHA 4BAYA 2OZSA 3SPZA 5KHGA 4EPHA 4I9LA 4WFFA 2OCCB 3ZMVA 4FLZA 1WB8A 3K59A 3CRAA 5DECA 2YB5A 5LA6B 4H13B 3I56V 1PV0A 3T1YO 1KP2A 3J7AU 4I0XA 5K1PA 5CMUA 4O4LA 3N2GA 4LFAO 1KC8W 4QNDA 3TK1A 3LZJA 5KHKA 3K3WA 4GX0A 3RYIA 1AR1B 4X65O 3P3NA 3ZN1A 3ZMTA 2W0XA 2VQFO 2ZCEA 2IH1C 3BY6A 1FZ3E 3F7VC 3W7UA 3WB0A 1HW7A 1N32B 2Y0IA 3SJBC 4GT1A 4IYIA 4EP9A 4DO2A 4O2BA 3E4YA 3HP9A 4JZ2A 3FYIB 4ZKIA 1N0JA 4NTXA 2IJKA 1VF6A 3CRQA 3HKEB 2FW3A 4LF8B 2B1IA 3CWBH 1Q7YW 2HJFC 3OD4A 4JI2O 5FNVB 2DMXA 2QSAA 1D5NA 3CRMA 1K34A 2N04A 2RQ6A 1RFYA 5KA6A 1I5XA 4FJ5A 2DYSB 3ASNC 3Q4HB 2P1QB 4ZI7B 4TWKA 2UXDO 2A06H 2M7WA 5B3SC 3AG1B 4HCCA 4J41A 2M6YA 3JD1A 3ETQA 2QM7A 2Y4TA 1BT8A 3KCXA 1W59A 4E2LA 4DTNA 4JI1O 3PN1A 3LD8A 4J2DA 2MZWB 5F2VO 2ZE5A 1FZHE 2XTAA 1CP9A 3T1CA 3TABA 4JAVA 4ZHQB 2JDIG 3JASA 1YI2V 3SDLA 5KX5A 3E22A 4B08A 5J2TA 4O4HB 3OAAG 4HAMA 3CC7V 4X65B 3K03A 4MVMA 3L70H 4E4EA 4BW5A 2HVKC 5KMGA 5KAFZ 3K9SA 4IYHA 2IH3C 2CH7B 2DYRC 2F93B 2Y0PA 4MVZA 1SC5B 4TV8B 4PD4F 2PYLA 1XREA 2QM8A 1BQZA 5LP6C 3BPZA 3ZRWA 1MABG 4EKWA 3CMEV 1RP3B 3SYQA 4I55B 3ZRVA 3OUSA 1F7YA 4FZ0A 3BA8A 3OFNG 4B7EA 4J2EA 1AP5A 3JCUZ 1XL6A 2IJJA 4JYAB 4GKKO 3J27A 4PA7A 1FFXB 4JI3O 3UKMA 4RG8A 1FZ7E 4ZHQA 1TVKB 3K0DA 4GKJB 2P5GA 3PJSK 3ABMB 1XVCE 2QWPB 4X5MA 4JRPA 1SKVA 4DXWA 2JQTA 1KYOF 1KP3A 2Z3YA 3NCIA 4DK0A 4CC6A 3E8BA 4PDRA 4NYKA 4LF5B 4DR1O 3RVZA 4UV8A 4AI8A 4PDLA 3A2FA 4TQFA 1QVGU 4MT8A 4WBNB 3U10A 2Y69C 3CS5A 4NXMB 4KI4A 2QTSA 2GUZA 1SA0A 4LFBO 4CH6A 4F6EA 1G6UA 3J81N 1YJWV 2EULA 3CFOA 2EINC 4DR6O 3CP1A 1XL3C 3TXQA 3RFRA 4X1KA 1SF9A 2GTSA 1JJOA 4J2AA 1GM8A 3FKSG 1JA8A 3K08A 1SRYA 4J9YB 1P7BA 1QLNA 1J95A 4PJ0Z 4X66B 1AJQA 2H3OA 1NTZH 4Z1MG 4H33A 4M3ZA 1OZ0A 3TJYA 4GX2A 2IW5A 1FZIE 4ADNA 5C8YA 1ENVA 5EYPA 4FK2A 4ZI7A 3WU2Z 1WP8A 4MTFA 4FJ7A 1R3KC 1NTMH 3AG2C 1W0JG 2ZQMA 1SQGA 4DR5O 1VQ4V 5B66Z 4TOIA 1HNZO 2XAFA 2VRZA 1RM1B 4DV4B 3A0RA 4I0XB 1M57B 1K4CC 2B5UA 2A0LA 4UV9A 3J2PA 4YHHO 1BZKA 1H2NA 4FM2A 4FJXA 3UIQA 4OXSA 3ZHVA 2UXCB 3JARA 2WLLB 3NDKA 2Q4PA 1KB9F 1TUBA 5CA1B 4FIPC 2ZR3A 1J5EB 2ZIMA 3QETA 1GN6A 4OPHA 4FLYA 5H6QA 1XMQO 3OEHG 4E4BA 3BCCH 2V7QG 5JVDB 1PKXA 2VQEO 3AK1A 2JHPA 4JI8O 3CB2A 4UVBA 5LMNB 5JCOA 2ZT9B 2GHYA 3E8HA 5EIBD 2BTQA 3NGIA 3B4SA 1XBLA 2P1NB 2EIKC 2E5LO 3N2KA 3ZRXA 2EZPA 2NR5A 2NNUA 2UXXA 4Z1VA 1YHQV 1HR0B 1Y67A 1ZL8A 4Z2WA 1YSCA 4PDVA 4WCEV 2IJIA 2ZDIA 3B40A 3HKDA 5B1OA 1S76D 2WLNA 1Q81W 2YIDA 1YJNV 3HKEA 4LF9O 3BABA 3CCEV 3ZHSA 4UCVA 3BA9A 4CH5A 4LBEC 3G71V 4W4LA 1M90W 4JI6B 2A9HA 2LW7A 5H9CA 2EZOA 3SYOA 3X2QB 3L8BA 5J9PC 1KMIZ 1Q6HA 1R6TA 2VWJA 3A0BZ 3HL8A 4NR1A 3F7YC 2HHHO 2P90A 5LMUB 2NN4A 1D5AA 4E3SA 4EEQA 1GH6A 2WLJA 1NEXB 1JPXA 3P32A 1VQ9V 3OTFA 3QG5A 1OCZB 1P84F 3NR7A 4RQFA 2YEVA 3NE6A 1GK9A 3Q4HA 4GZRB 2CTPA 2E3CA 2QJ1A 4JTCB 4UVAA 3JAKA 3UCSC 3QEWA 4DV3B 2RCVA 4TV8A 1GTOA 2KG7A 4CH4A 2F23A 2EBOA 2UXBO 4K8XA 1FXHA 4WFBV 4KHPB 2AHZA 1OCCB 3CJHB 4B3RB 1WAFA 2K5SA 4IIJB 2EINB 4L87A 5EIBC 3LDBA 1FZ5E 3SYAA 3JAKB 1SESA 4JI0O 1SETA 1GRJA 2R9RB 1UPGA 3J80N 1BE3H 3QEPA 1VQMV 3LDCA 1IH7A 4LF9B 4CS4A 3JATA 3BEHA 1SERA 1LUWA 3HKBB 4DTMA 1VQKV 3C6PB 2L6LA 2JEXA 1N32O 4AKGA 1N33O 3QNEA 3SYCA 1Y6XA 1NR7A 4DV1O 2RDCA 1ZWIC 3U0ZA 2ZM6O 3WB1A 3DSQA 1WB7A 1S5LZ 2Q0AA 2X0LA 4J11A 4JPRA 4LFAB 1Z5WA 2DWEC 1X59A 5EZYB 1I7FA 5JH7A 2EJRA 3W7SA 5CB4A 2VQFB 3RYFB 4RL5A 4M3TA 3ZS8C 1I0HA 1YXBA 1ZUQA 5IT9N 5DN6G 2E5LB 4M42A 2RKHA 3APOA 2Q69A 1ZTEA 3FAVB 4PDMA 2GBOA 4GCZA 4F4LA 1S0VA 2ZXWC 1IXBA 4O4JA 2N05A 3KCYA 3IC7A 1XNRB 4X62O 2K1EA 1E79G 3OR6C 3RYIB 4H44B 3B8NA 2WSSG 3FB6C 1YITV 1K8AW 2Z0AA 4PV1B 1M56C 1UJWB 2ILMA 1XI1A 4FVMA 4YY3B 3GB7C 4JI0B 3CCVV 4DU1A 1QU7A 4M3YA 1B6QA 3LDDA 3CFRA 4ICGC 1QLEB 3JAWB 3R65A 1KD1W 3D36A 1M1KW 1NU1H 1DF5A 2JPNA 1K73W 4IT5A 2YXHA 3SQ0A 4DTJA 4KHSA 3E4WA 1FZ2E 1AJPA 5JH7B 4DR3O 2WLLA 2BOBC 5B5EZ 5IZ7A 4X88A 5J2UB 2HJDA 3SJAC 5IREA 4MVQA 4FLXA 2E74B 3H9VA 3CYOA 1K97A 4X20A 3STLC 3SQ1A 3W7WA 1JCHA 2UUBB 1NVPB 1S77D 2UXCO 2YC0A 1N4CA 2P1PB 2X6BA 3AEIA 3W7XA 4EYWA 3CFPA 4B3TO 3R66A 1XMOB 2CGNA 4YJ2B 3FYEB 4MTGA 4UVCA 3OMNB 1MMOG 4HCBA 2OCHA 4GX1A 1JMKC 3E83A 1HP8A 2DEBA 1MHYG 3CRCA 3QTCA 4ADOA 5EC1C 1HR0O 4OPAA 1FS0G 4I4TA 1V54B 1O9HA 1BS3A 3HB3B 2QKAA 4DV5O 1MOFA 4QNCA 4TUYB 4AI6A 2YEVB 1BCCH 1PP9H 4X9QA 5LHIA 4DR7B 2UXBB 3CCLV 3CSXA 2DYRB 4LF7O 1FKAO 4FJGA 2L35A 4J80A 4JAAA 5LBQA 1H8EG 5GW7A 2BE3A 1ZX3A 4CC5A 2V1DA 3FB7C 3HKBA 1L0LH 4DTPA 2ZE7A 4H0LB 4MS2A 5CBHA 2DOSA 1QBZA 4GUNA 2A7WA 3G6EV 1BL8A 3TCUA 1PNLA 5JCOC 1FS1A 4DU4A 3C3TA 5GONA 4DR1B 2JS5A 3ABTA 5IWAO 4DV6O 5CA0B 1AILA 2JVDA 1TVKA 4B3SB 1WP7A 2Q7GA 3HKDB 3G67A 5LHHA 2MK3A 2JK5C 3ASNB 5JQGA 5IDJA 1SZTA 1QQCA 3ABKC 4CZZA 1IBLB 5LP6B 2ZNJA 4HBNA 1FZ6E 2Q7HA 3P3PA 5H5NA 2XAHA 4JI3B 4CS2A 3S3WA 3OGMB 1RPRA 1F23A 1XILA 2ZD9A 3SPJA 3L2OB 2HR3A 1H2LA 4KHUA 1FZ9E 2P7TC 1BQ0A 4GX5A 4JAUA 4TV9A 4ZOLA 3OT7A 5D5PA 1NTKH 4RNGA 3RMBA 4U7NA 1YIJV 1VQ5V 1PL4A 5CBFA 2AZ0A 3L73H 1XNRO 4I50A 3H1KH 1HDJA 2XAQA 2UXDB 1LDKE 5J2UA 2FKXA 3KG2A 1K92A 5D5QA 3DTUB 3K06A 4LFCO 4FJIA 4FJCC 1H8HG 4JI7O 2W6IG 1H2GA 4K8ZA 1EZJA 4X1IA 4LP8A 1MHZG 3CMAV 4P9PA 3RMAA 1EZVH 1NQTA 1L0NH 1BHAA 2RCUA 3C6NB 2QGNA 5IWAB 3H1LH 1M93A 1EBOA 4M45A 3OTOB 5EBLC 2WA4A 2Z5UA 2DJVA 4LF6B 3T2MA 2Y4UA 4O4IB 2B7MA 4FM0A 2P22C 2PF4E 3L71H 2XNDG 5L3BA 4X89A 1ROPA 3UM7A 4DTUA 1IBLO 5A2QN 2JH8A 2YI9A 2ZIOA 3SNNA 3RN4A 2E32A 2VJ5A 3IFXA 2GSMB 3SUNA 1S3JA 1RSOA 1NZ6A 4PI0A 4R6ZA 4R50A 3SR2C 1GN2A 4J7JA 2YIBA 2KQXA 5LYJA 2HFEC 1Y66A 5KHJA 1FXKA 1FD9A 4DV2B 1XUQA 3MAQA 3RGBA 1IVSA 3ZJZA 1YTFD 2QKCA 3AG2B 4XDLA 1G4YB 1IBMO 2PYJA 3C94A 3K57A 2CGOA 3SI6A 3RWUA 3DXRB 5LP6A 2UUCB 1M57C 4JASA 3DC5A 4KHNA 4PA9A 1SQQH 4RO2A 4UCOA 5FNVA 3UQ8A 5IYDO 3UO2A 2EIMC 4LNUB 5KA5A 4FJJA 3OM3B 1FJGB 3D36C 4NVPA 1OJHA 1NH2D 1W0KG 4PA4A 3G80A 4N21A 2Q9LA 2ADQB 4EB6A 1NI8A 1AR5A 1TAEA 3K0GA 3RW0A 1VF5B 4DR6B 2YDEA 1XU5E 1N36O 3FD9A 4BIZA 3CD6V 5H2FZ 5J2TB 4UCSA 3KZIZ 2XASA 5CB4B 1KQSU 1XEQA 3ZHUA 1DGSA 1L8DA 5IY5C 2QA4V 1QCEA 3BRCA 2OVRB 2Q73A 1WJZA 2MW2A 4DW0A 1N34B 3WFVA 1XDCA 3KKYA 3GWKC 4G27B 3K04A 3M7MX 2QKSA 3RMDA 5DEDA 1JJ2U 4FK5C 3SUPA 2ZNIA 4EFBA 3SCXA 4U3JB 4DR2B 5IJ0B 4X1YB 3JATB 2BCCH 2ETNA 3JAMN 3ETDA 2HG5C 1HNWO 5L3FA 1AI4A 1IURA 3F5TA 2WPDG 1I94O 1GM9A 4HNAB 4QE7A 3QO5A 1ORQC 2R70A 2BOCC 3EXAA 1KUQA 1VF6C 1XMHE 3ML0A 2Y48A 3RVYA 2YIAA 1VQOV 4U7OA 3LSQA 1Q3EA 4X62B 4I55A 3ZMZA 3P30A 2JJ2G 2DY4A 4UCRA 3AG3C 4CS3A 4O2BB 1XOUA 2B1GA 1K33A 5LOVA 3LSUA 2GTAA 2DN9A 1W2BU 2V4DA 2PFTA 1B3QA 2OTJV 5LMUO 2ATKC 2P6JA 5IJ0A 3ZX6A 5C8YB 5BR8B 4FJLA 1KECA 4I9WA 1Q9XA 3ZIAG 3E2EA 2LF6A 4U3FH 3ZRWB 3QF7A 3IJ4A 1RPOA 1IBMB 3CC2V 1Q82W 5LHGA 1H38A 1X4TA 2JH9A 4DV0B 4JI4B 4KHYA 4HNAA 4HZ3A 1DK1A 4TSFG 4W4KA 3JCZA 5CA0A 1PD3A 1XVFE 3SPCA 2PZSA 4JF3A 4LH6A 2EILC 5KUMA 1WAZA 2A79B 4TV9B 2NLJC 2GUZB 5AG2A 1ZL8B 3VQYA 4EFEA 3M99B 3C95A 1E1RG 4UUJC 3ZEDA 3JYCA 1T5EA 4UCUA 2OVQB 1SQXH 1US6A 3ASOC 1QNMA 2AGAA 5KAIZ 5JVDA 4DR3B 3OGIB 3SJCC 5CN0A 3QNOA 2BTQB 3OE7G 1PPJH 1TA8A 1F51A 2P1MB 3ABUA 1HNXB 1MZFA 1U97A 4G28B 3OTOO 4MW3A 4EB6B 3N1BA 3N2GB 1HNXO 2DE0X 3B09A 4NB5A 4FLUA 2XAGA 2GDSA 4J2BA 1MG1A 4FK4A 3MHSC 2R72A 2XHBA 5JWPA 2FYOA 4DR7O 1FAFA 1G1XB 1P4RA 5CA3A 4JI5O 2N74A 3ETGA 3F5WC 5GONB 2CE4A 3T4DA 3AK3A 3ASOB 4DV3O 3FX7A 4LCUC 1M5IA 1R1BA 1AP6A 1Y76B 1GN4A 2DQ0A 4UCTA 4DTRA 1LNQA 3RWRD 3RT3C 2O57A 3HGKE 1JW2A 2IM9A 5LXTA 3ZMUA 5IYZA 4RUEA 1RSOB 2ZR2A 3NAEA 2AW9A 3U11A 4H37A 3SJQC 3HKCB 1AR4A 1FPOA 1SQPH 3TJTA 1ZLZA 5LOVB 4XDJA 1VARA 3VQVA 1DF4A 1NKDA 3TAEA 3E8GA 4QIWF 5FLXN 4JI5B 3QEIA 2PGGA 1YEWA 3HKCA 2ITCC 2DQ3A 5LGTA 3E22B 5BY1A 3I55V 4LC1A 5B1NA 1AI7A 1P22A 4M3XA 1SQBH 3H1JH 3TAFA 2B9ZA 4P9OA 2EIKB 2YXYA 4M3UA 3CQ8A 1Y76A 1VEWA 1MTYG 5JJNB 3NXSA 4MSWC 2RJZA 2LFSA 4ICGA 3C90A 5LMNO 1B06A 3QEXA 1GKFA 4TT3G 3AG3B 1OCOC 4OGQB 4LF6O 1IX9A 4ABMA 1NT2B 3ZCCA 4K0KO 4X1IB 4I50B 5L3EA 1IDSA 2DYSC 3BFRA 3CXCU 3X2QC 1GM7A 3MKSB 3RYCB 1MSDA 2ZE8A 5B1AB 2ODMA 1NJIW 3FB5C 1FFTB 2HEPA 5IE9A 3MDSA 4XDKA 5LGUA 4B3TB 2AXTZ 3JAWA 2DWDC 1FZ1E 4BW9A 3SPYA 3EHBB 4FFBB 5FPOA 1QR9A 4I6JB 1HWYA 1FXVA 1NH2B 3IC9A 4X64B 1FYJA 1Z5VA 1N0NA 5BMVB 3SUQA 3DC6A 3AG4B 3QESA 2B1EA 3WG7C 3C3SA 1XMGE 4LF5O 3GWOA 4I9QA 3RMCA 3D8CA 3LDEA 4DR4O 1CXZB 1Q43A 1XL4A 2Q68A 4JV5O 2XAJA 2UUBO 4KXRA 2VWKA 2WLMA 4KUMA 1MA1A 2ZDIC 1N1CA 5B1BB 4OX9B 1AROP 4PI2A 4NXNO 2IBZH 3AG7A 3JARB 2LO1A 4LWSB 3QVNA 3K2OA 4GLXA 1NS1A 2CDYA 3UT5A 4B3SO 2Q0OC 1N34O 3SPHA 1EN5A 5GTIZ 5A9GA 4LNUA 4JS4A 2RN9A 1Q6UA 3E35A 4YY3O 4JS5A 1Q6IA 3JALB 2ITDC 5H37A 2OT5A 4DUZO 3ABKB 3CC4V 1MMMA 1Y74A 5JJJB 2EJ7A 4QE9A 5IYZB 3AG4C 4JI2B 4FLWA 2CK3G 2FTKA 4DUZB 4YJ3A 1NR1A 4YIOA 3O65A 4O4HA 4BWAA 3QO8A 2JHCA 4PA6A 3V7DB 4DRXA 4CBCA 4LFCB 1FJGO 3ICXA 2P1OB 3LUTB 4MVOA 3QEVA 3N27A 4QPKA 4HYOA 2KKWA 3ZN0A 2ZKOA 2QEXV 3B77A 3CXHF 2X6CA 1N8RW 3MHHC 4F6RA 5K1XA 1S5HC 1QLEC 2Y69B 4A5UB 4TQDA 4FJKA 2OZMA 3E8FA 4AHCA 1QVFU 4M3RA 1FZ8E 4P30A 1WN7A 4B3MB 2LJ2A 4YJ3B 2WLHA 1OV9A 1VIBA 2DTUA 1Q8IA 3CX5F 2BSKA 2OCCC 1R3JC 1ZSPA 4PELA 1GAXA 4DV0O 4JI4O 4DRXB 1RM1C 4Q20A 4RWUA 3SYPA 1K5SA 2OVPB 1AVMA 1YDXA 1SZXA 1LUVA 3K58A 2EX3A 2CTRA 3G6BA 4B7KA 4KHWA 1Y74B 2R9IA 2HLDG 3H1IH 3OMIB 1MSWD 1TUEB 4BIUA 1V9PA 2CTQA 4DTOA 1R6KA 2QE7G 4B3MO 4AQYB 1OCOB 2XT9A 4DUYB 4O2AA 2LFRA 1VQPV 1Q86W 3JD0A 3CCQV 4ZOLB 3CCRV 5E79Z 2JGDA 4KHPO 1OCRC 2LW1A 3MD0A 1BGYH 1EN6A 4AQYO 4YJ2A 2RMKB 2H4TA 4J7KA 4R8CA 4DU3A 5GTHZ 4LH7A 3VOUA 3H1HH 2G38A 4FJNA 5IYCO 2P4VA 3JD4A 4NTYA 4FJ8A 4ASUG 5LGNA 3HGLA 2HKOA 1VQ7V 2FYUH 2EIJC 3FAVA 2UU9B 1M4UA 4PA3A 2X6AA 3OGKB 5TISZ 4FLVA 1XVEE 3B8MA 4IGGA 3UT5B 1N36B 1K5QA 4FJHA 4DV7O 1V54C 5LL6Y 1S72V 2B8IA 1AJNA 1YF2A 4DR5B 1M56B 2PY5A 2P4KA 4AKHA 4I4TB 2XOKG 2YSUB 2VJ4A 3RYFA 3JSLA 2PFVA 1I08A 3CCUV 4JTDB 5B1BC 3AG1C 2CAZC 3RBZA 1U96A 1M9NA 4JGSA 4UB6Z 4FLTA 2KG7B 3ABLB 4DV5B 2Q6AA 5HFLA 4X66O 1FXKC 4FFKA 2F4VB 4JI1B 1TGOA 5FL7G 2F1MA 2JIZG 4IL6Z 1OCZC 3I5DA 1BMFG 3SJJA 2EIMB 1IBKO 1L1FA 5IJ9B 4DV2O 2IU3A 4J42A 4MTXA 2PI5A 5LYJB 3SPIA 3L74H 5B3SB 2JJ1G 3TGUH 4KI6A 2F95B 4K35A 1XHXA 2YS8A 1K9MW 1R3IC 4JI8B 2H94A 5FPRA 4ZIBA 2H8PC 4QPJA 4LFBB 1UFIA 5IJ9A 4K3AA 3T1HO 3LSSA 5BMVA 1XMOO 1Y4MA 2CUGA 1JOYA 5LXTB 4X1KB 4I5SA 4LWSA 3EVKA 3RYHB 4MVSA 4RAIA 1SS3A 1THZA 2YICA 4J9ZB 4NXNB 1ZAUA 1AI6A 1VP7A 4JYCA 1WLEA 3SGIA 1MZEA 4LF4O 2QDOA 1GMGA 4MVUA 3N2KB 2PTMA 1O9GA 1JVMA 1VQNV 1Q90D 3RYHA 1I5YA 4WFHA 4LF4B 2ADPA 4JYAO 2VQEB 1PM9A 3CCMV 3G4SV 2P67A 3A0HZ 5B1AC 2QWOB 3D3QA 3ZHQA 1VQ8V 1IG9A 1WNSA 2Q8VA 1R6NA 4D7SA 1DLBA 2KSDA 1JX9A 1FXXA 2E75B 1K7DA 3WSOA 4RQEA 5BZBA 3LZIA 2ZINA 3K5OA 1NVPD 2IU0A 2QM4A 1KKDA 3OGLB 3AK2A 4KL1A 1NBMG 3GVMA 3L75H 4IHJB 3WB2A 3WG7B 1VQ6V 5KUKA 2HVJC 3OR7C 3KD5E 5EBMC 1F4NA 1TUBB 3BVOA 1XHZA 5L3CA 1COWG 1YJ9V 2MW2B 2ZM6B 2UU9O 2OIGA 1R73A 1V55C 2BSKB 2BTOA 4C7UA 1KBHA 1OCRB 2UUAB 4FJ9A 5E1AC 1AI5A 4GAMC 3CHXA 4WFGA 3NHGA 1V55B 3RYCA 1P49A 1WA8B 2JEUA 4YIPA 3JASB 2JHAA 2RNBA 5JQGB 1YCIA 2AZ2A 3TXSA 3CCSV 1K4DC 5EYPB 5HFMA 2OWOA 2P5OA 2E76B 3IAYA
chains in the Genus database with same CATH topology
2CTWA 2CUGA 2QWNB 3APQA 1NZ6A 2PF4E 2QWQB 1IURA 2EJ7A 3UCSC 1BQZA 1XBLA 1N1CA 2QWOB 3UO3A 2M6YA 2QWPB 2OCHA 2GUZA 1GH6A 2Y4TA 3AG7A 2KQXA 2N05A 2LO1A 4IT5A 3BVOA 4RWUA 1FAFA 2CTQA 2LGWA 2YS8A 1HDJA 2DMXA 2GUZB 2L6LA 2QSAA 2QWRB 4J80A 1N4CA 2YUAA 4J7ZA 2N04A 1FPOA 3UO2A 2CTRA 2RKHA 3APOA 2CTPA 2DN9A 1WJZA 1BQ0A 2Y4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTW A;  2CUG A;  2QWN B;  3APQ A;  1NZ6 A;  2PF4 E;  2QWQ B;  1IUR A;  2EJ7 A;  3UCS C;  1BQZ A;  1XBL A;  1N1C A;  2QWO B;  3UO3 A;  2M6Y A;  2QWP B;  2OCH A;  2GUZ A;  1GH6 A;  2Y4T A;  3AG7 A;  2KQX A;  2N05 A;  2LO1 A;  4IT5 A;  3BVO A;  4RWU A;  1FAF A;  2CTQ A;  2LGW A;  2YS8 A;  1HDJ A;  2DMX A;  2GUZ B;  2L6L A;  2QSA A;  2QWR B;  4J80 A;  1N4C A;  2YUA A;  4J7Z A;  2N04 A;  1FPO A;  3UO2 A;  2CTR A;  2RKH A;  3APO A;  2CTP A;  2DN9 A;  1WJZ A;  1BQ0 A;  2Y4U A; 
#chains in the Genus database with same CATH topology
 4DV6 B;  4DW1 A;  5KLV H;  1H2K A;  3KD1 E;  3FFQ A;  3ZRS A;  2LF3 A;  3UO3 A;  2YXL A;  1PNM A;  3DXR A;  2LGQ A;  2JRI A;  5ITZ B;  2FL4 A;  1AB3 A;  4J10 A;  1DTO A;  4K0K B;  1GO3 F;  2YUA A;  2WA3 A;  4BIO A;  3IGA C;  2OIE A;  2ZE6 A;  3ZMS A;  1Q5O A;  4FK0 A;  3ZBH A;  1R3L C;  2QWN B;  2LP7 A;  3DGE A;  3O9O A;  4WF9 V;  4O4J B;  4CH3 A;  1VF7 A;  3W7T A;  4DV4 O;  4O4L B;  4R7C A;  3CJH A;  2E31 A;  4M41 A;  5JJE B;  4LF7 B;  3SQ2 A;  3HR0 A;  1YTF B;  5H6R A;  1LR1 A;  2F4V O;  3CE2 A;  2KB1 A;  4J7Z A;  2D2C B;  2UUA O;  2ZXW B;  2K9P A;  3K5L A;  1IBK B;  1S5J A;  4JZG A;  2QXF A;  2YI8 A;  5L3G A;  1QR8 A;  2UXN A;  3OUF A;  3VBB A;  2UUC O;  3SVI A;  3VQW A;  1P7G A;  1WA8 A;  1CEZ A;  3SQ4 A;  4JI7 B;  3ZHT A;  4UFZ A;  4O4I A;  2A3Q A;  4LR3 A;  2F66 C;  2QR4 A;  1D2D A;  1SA0 B;  1FFX A;  1JR9 A;  1WPB A;  2C2A A;  3JSN A;  4PHZ A;  2VS0 A;  3CRR A;  3C6O B;  4I7Z B;  1IXM A;  1SQV H;  4JTA B;  5IYB O;  4KP4 A;  4B3R O;  3JD2 A;  3JAL A;  3CCJ V;  3SUO A;  4N23 A;  3L0M A;  2LGW A;  1G8M A;  1A32 A;  4FFB A;  3ETE A;  5CA1 A;  1KU9 A;  1FZ4 E;  2P06 A;  2QTO A;  4FMT A;  4MTO A;  4M3W A;  5EZY A;  2ARH A;  1CLQ A;  2JS3 A;  4NTW A;  4F6R B;  1XVB E;  2HD0 A;  2CTW A;  2WLI B;  4YXW G;  2GV9 A;  4DR2 O;  1N33 B;  1WAJ A;  3OEE G;  4JRQ A;  1XU3 E;  3K9A A;  4QJF B;  2EIJ B;  4KHQ A;  1EM1 A;  1EFR G;  4FZ1 A;  5EBW C;  1SQF A;  1EN4 A;  4GKJ O;  5KX5 B;  4AIL C;  4DUY O;  4UXN A;  4WFE A;  1BSM A;  1XVD E;  1FXK B;  4JYB A;  2JGD B;  2PUS A;  1KKC A;  3M8A A;  4L8J A;  3HPL C;  3T1Y B;  4AKI A;  3EFF K;  1XMQ B;  1IZ3 A;  2AHY A;  3BHP A;  4LF8 O;  4X64 O;  2HHH B;  1VMG A;  4IHJ A;  4YHH B;  2WLI A;  4DK1 A;  5BXZ A;  1JFF B;  1JQ0 A;  4TUY A;  4JYY A;  2XUM A;  5EK0 A;  5CBG A;  4IIJ A;  4ZBM A;  3LDS A;  3L1N A;  2Q5Z A;  2FB5 A;  4X1Y A;  4JV5 B;  2WWW A;  2R9A A;  3ABM C;  3ABL C;  2CH7 A;  5BR8 O;  1H2S B;  2QWQ B;  3LNN A;  1HNZ B;  4FM1 A;  4UB8 Z;  3VQX A;  3TET A;  2WAM A;  2Q67 A;  1E1Q G;  2QWR B;  3SPG A;  1F4M A;  4MVR A;  1YVW A;  2WLK A;  1GN3 A;  4Q6G A;  1HNW B;  1XMF E;  4MW8 A;  4WBN A;  5L3D A;  1CPY A;  4DR4 B;  1MNG A;  1Z2G A;  3A8T A;  5C93 A;  1XNQ B;  3TAG A;  1PNK A;  4X8A A;  4BR6 A;  4DV1 B;  4P2Z A;  3JD3 A;  1XVG E;  4JI6 O;  4KFM A;  3K5M A;  2DW4 A;  4GYC B;  4X20 B;  5LA6 A;  3S3X A;  1BHB A;  3N1E A;  3B2E E;  4DV7 B;  2YIB D;  1J5E O;  1B04 A;  1H2M A;  5ITZ A;  2ATQ A;  3D3I A;  1OHH G;  1JFF A;  1OCC C;  3STZ C;  4U3J A;  2HP8 A;  2X7R B;  3E86 A;  1Q9Y A;  2EIL B;  3FB8 C;  2OYQ A;  5IBK B;  4FPP A;  4NKG B;  3THO A;  4QGP A;  3L9D A;  2MMB A;  4NXM O;  1URF A;  4G2K A;  3T4Z A;  2JGU A;  5EC2 C;  4XBF A;  4D7T A;  5KHI A;  1PL0 A;  3BAA A;  2W6J G;  3CEI A;  1FYZ E;  2W0F C;  1I94 B;  1XNQ O;  4D6T H;  4DYL A;  4QNH B;  1WPX A;  5DM6 V;  4X5N A;  4OX9 O;  3ZHR A;  4GKK B;  2PI4 A;  3K5N A;  1FZ0 E;  4RUF A;  1YZB A;  4DTX A;  2IJH A;  3L72 H;  3CPW U;  1XQ8 A;  3APQ A;  3K79 A;  1K3E A;  3QER A;  2D3O W;  3OGC C;  3S9H A;  1VQL V;  2VIX A;  2F43 G;  4DTS A;  5KMG B;  3LNM B;  3TL8 B;  2OTL V;  3QNN A;  2LQT A;  2FML A;  1QHT A;  3H01 A;  4WFA V;  3E89 A;  5IY5 B;  3QO7 A;  2Q7E A;  3OW2 U;  4O2A B;  4FJM A;  3T1H B;  3OMA B;  5KHH A;  4BAY A;  2OZS A;  3SPZ A;  5KHG A;  4EPH A;  4I9L A;  4WFF A;  2OCC B;  3ZMV A;  4FLZ A;  1WB8 A;  3K59 A;  3CRA A;  5DEC A;  2YB5 A;  5LA6 B;  4H13 B;  3I56 V;  1PV0 A;  3T1Y O;  1KP2 A;  3J7A U;  4I0X A;  5K1P A;  5CMU A;  4O4L A;  3N2G A;  4LFA O;  1KC8 W;  4QND A;  3TK1 A;  3LZJ A;  5KHK A;  3K3W A;  4GX0 A;  3RYI A;  1AR1 B;  4X65 O;  3P3N A;  3ZN1 A;  3ZMT A;  2W0X A;  2VQF O;  2ZCE A;  2IH1 C;  3BY6 A;  1FZ3 E;  3F7V C;  3W7U A;  3WB0 A;  1HW7 A;  1N32 B;  2Y0I A;  3SJB C;  4GT1 A;  4IYI A;  4EP9 A;  4DO2 A;  4O2B A;  3E4Y A;  3HP9 A;  4JZ2 A;  3FYI B;  4ZKI A;  1N0J A;  4NTX A;  2IJK A;  1VF6 A;  3CRQ A;  3HKE B;  2FW3 A;  4LF8 B;  2B1I A;  3CWB H;  1Q7Y W;  2HJF C;  3OD4 A;  4JI2 O;  5FNV B;  2DMX A;  2QSA A;  1D5N A;  3CRM A;  1K34 A;  2N04 A;  2RQ6 A;  1RFY A;  5KA6 A;  1I5X A;  4FJ5 A;  2DYS B;  3ASN C;  3Q4H B;  2P1Q B;  4ZI7 B;  4TWK A;  2UXD O;  2A06 H;  2M7W A;  5B3S C;  3AG1 B;  4HCC A;  4J41 A;  2M6Y A;  3JD1 A;  3ETQ A;  2QM7 A;  2Y4T A;  1BT8 A;  3KCX A;  1W59 A;  4E2L A;  4DTN A;  4JI1 O;  3PN1 A;  3LD8 A;  4J2D A;  2MZW B;  5F2V O;  2ZE5 A;  1FZH E;  2XTA A;  1CP9 A;  3T1C A;  3TAB A;  4JAV A;  4ZHQ B;  2JDI G;  3JAS A;  1YI2 V;  3SDL A;  5KX5 A;  3E22 A;  4B08 A;  5J2T A;  4O4H B;  3OAA G;  4HAM A;  3CC7 V;  4X65 B;  3K03 A;  4MVM A;  3L70 H;  4E4E A;  4BW5 A;  2HVK C;  5KMG A;  5KAF Z;  3K9S A;  4IYH A;  2IH3 C;  2CH7 B;  2DYR C;  2F93 B;  2Y0P A;  4MVZ A;  1SC5 B;  4TV8 B;  4PD4 F;  2PYL A;  1XRE A;  2QM8 A;  1BQZ A;  5LP6 C;  3BPZ A;  3ZRW A;  1MAB G;  4EKW A;  3CME V;  1RP3 B;  3SYQ A;  4I55 B;  3ZRV A;  3OUS A;  1F7Y A;  4FZ0 A;  3BA8 A;  3OFN G;  4B7E A;  4J2E A;  1AP5 A;  3JCU Z;  1XL6 A;  2IJJ A;  4JYA B;  4GKK O;  3J27 A;  4PA7 A;  1FFX B;  4JI3 O;  3UKM A;  4RG8 A;  1FZ7 E;  4ZHQ A;  1TVK B;  3K0D A;  4GKJ B;  2P5G A;  3PJS K;  3ABM B;  1XVC E;  2QWP B;  4X5M A;  4JRP A;  1SKV A;  4DXW A;  2JQT A;  1KYO F;  1KP3 A;  2Z3Y A;  3NCI A;  4DK0 A;  4CC6 A;  3E8B A;  4PDR A;  4NYK A;  4LF5 B;  4DR1 O;  3RVZ A;  4UV8 A;  4AI8 A;  4PDL A;  3A2F A;  4TQF A;  1QVG U;  4MT8 A;  4WBN B;  3U10 A;  2Y69 C;  3CS5 A;  4NXM B;  4KI4 A;  2QTS A;  2GUZ A;  1SA0 A;  4LFB O;  4CH6 A;  4F6E A;  1G6U A;  3J81 N;  1YJW V;  2EUL A;  3CFO A;  2EIN C;  4DR6 O;  3CP1 A;  1XL3 C;  3TXQ A;  3RFR A;  4X1K A;  1SF9 A;  2GTS A;  1JJO A;  4J2A A;  1GM8 A;  3FKS G;  1JA8 A;  3K08 A;  1SRY A;  4J9Y B;  1P7B A;  1QLN A;  1J95 A;  4PJ0 Z;  4X66 B;  1AJQ A;  2H3O A;  1NTZ H;  4Z1M G;  4H33 A;  4M3Z A;  1OZ0 A;  3TJY A;  4GX2 A;  2IW5 A;  1FZI E;  4ADN A;  5C8Y A;  1ENV A;  5EYP A;  4FK2 A;  4ZI7 A;  3WU2 Z;  1WP8 A;  4MTF A;  4FJ7 A;  1R3K C;  1NTM H;  3AG2 C;  1W0J G;  2ZQM A;  1SQG A;  4DR5 O;  1VQ4 V;  5B66 Z;  4TOI A;  1HNZ O;  2XAF A;  2VRZ A;  1RM1 B;  4DV4 B;  3A0R A;  4I0X B;  1M57 B;  1K4C C;  2B5U A;  2A0L A;  4UV9 A;  3J2P A;  4YHH O;  1BZK A;  1H2N A;  4FM2 A;  4FJX A;  3UIQ A;  4OXS A;  3ZHV A;  2UXC B;  3JAR A;  2WLL B;  3NDK A;  2Q4P A;  1KB9 F;  1TUB A;  5CA1 B;  4FIP C;  2ZR3 A;  1J5E B;  2ZIM A;  3QET A;  1GN6 A;  4OPH A;  4FLY A;  5H6Q A;  1XMQ O;  3OEH G;  4E4B A;  3BCC H;  2V7Q G;  5JVD B;  1PKX A;  2VQE O;  3AK1 A;  2JHP A;  4JI8 O;  3CB2 A;  4UVB A;  5LMN B;  5JCO A;  2ZT9 B;  2GHY A;  3E8H A;  5EIB D;  2BTQ A;  3NGI A;  3B4S A;  1XBL A;  2P1N B;  2EIK C;  2E5L O;  3N2K A;  3ZRX A;  2EZP A;  2NR5 A;  2NNU A;  2UXX A;  4Z1V A;  1YHQ V;  1HR0 B;  1Y67 A;  1ZL8 A;  4Z2W A;  1YSC A;  4PDV A;  4WCE V;  2IJI A;  2ZDI A;  3B40 A;  3HKD A;  5B1O A;  1S76 D;  2WLN A;  1Q81 W;  2YID A;  1YJN V;  3HKE A;  4LF9 O;  3BAB A;  3CCE V;  3ZHS A;  4UCV A;  3BA9 A;  4CH5 A;  4LBE C;  3G71 V;  4W4L A;  1M90 W;  4JI6 B;  2A9H A;  2LW7 A;  5H9C A;  2EZO A;  3SYO A;  3X2Q B;  3L8B A;  5J9P C;  1KMI Z;  1Q6H A;  1R6T A;  2VWJ A;  3A0B Z;  3HL8 A;  4NR1 A;  3F7Y C;  2HHH O;  2P90 A;  5LMU B;  2NN4 A;  1D5A A;  4E3S A;  4EEQ A;  1GH6 A;  2WLJ A;  1NEX B;  1JPX A;  3P32 A;  1VQ9 V;  3OTF A;  3QG5 A;  1OCZ B;  1P84 F;  3NR7 A;  4RQF A;  2YEV A;  3NE6 A;  1GK9 A;  3Q4H A;  4GZR B;  2CTP A;  2E3C A;  2QJ1 A;  4JTC B;  4UVA A;  3JAK A;  3UCS C;  3QEW A;  4DV3 B;  2RCV A;  4TV8 A;  1GTO A;  2KG7 A;  4CH4 A;  2F23 A;  2EBO A;  2UXB O;  4K8X A;  1FXH A;  4WFB V;  4KHP B;  2AHZ A;  1OCC B;  3CJH B;  4B3R B;  1WAF A;  2K5S A;  4IIJ B;  2EIN B;  4L87 A;  5EIB C;  3LDB A;  1FZ5 E;  3SYA A;  3JAK B;  1SES A;  4JI0 O;  1SET A;  1GRJ A;  2R9R B;  1UPG A;  3J80 N;  1BE3 H;  3QEP A;  1VQM V;  3LDC A;  1IH7 A;  4LF9 B;  4CS4 A;  3JAT A;  3BEH A;  1SER A;  1LUW A;  3HKB B;  4DTM A;  1VQK V;  3C6P B;  2L6L A;  2JEX A;  1N32 O;  4AKG A;  1N33 O;  3QNE A;  3SYC A;  1Y6X A;  1NR7 A;  4DV1 O;  2RDC A;  1ZWI C;  3U0Z A;  2ZM6 O;  3WB1 A;  3DSQ A;  1WB7 A;  1S5L Z;  2Q0A A;  2X0L A;  4J11 A;  4JPR A;  4LFA B;  1Z5W A;  2DWE C;  1X59 A;  5EZY B;  1I7F A;  5JH7 A;  2EJR A;  3W7S A;  5CB4 A;  2VQF B;  3RYF B;  4RL5 A;  4M3T A;  3ZS8 C;  1I0H A;  1YXB A;  1ZUQ A;  5IT9 N;  5DN6 G;  2E5L B;  4M42 A;  2RKH A;  3APO A;  2Q69 A;  1ZTE A;  3FAV B;  4PDM A;  2GBO A;  4GCZ A;  4F4L A;  1S0V A;  2ZXW C;  1IXB A;  4O4J A;  2N05 A;  3KCY A;  3IC7 A;  1XNR B;  4X62 O;  2K1E A;  1E79 G;  3OR6 C;  3RYI B;  4H44 B;  3B8N A;  2WSS G;  3FB6 C;  1YIT V;  1K8A W;  2Z0A A;  4PV1 B;  1M56 C;  1UJW B;  2ILM A;  1XI1 A;  4FVM A;  4YY3 B;  3GB7 C;  4JI0 B;  3CCV V;  4DU1 A;  1QU7 A;  4M3Y A;  1B6Q A;  3LDD A;  3CFR A;  4ICG C;  1QLE B;  3JAW B;  3R65 A;  1KD1 W;  3D36 A;  1M1K W;  1NU1 H;  1DF5 A;  2JPN A;  1K73 W;  4IT5 A;  2YXH A;  3SQ0 A;  4DTJ A;  4KHS A;  3E4W A;  1FZ2 E;  1AJP A;  5JH7 B;  4DR3 O;  2WLL A;  2BOB C;  5B5E Z;  5IZ7 A;  4X88 A;  5J2U B;  2HJD A;  3SJA C;  5IRE A;  4MVQ A;  4FLX A;  2E74 B;  3H9V A;  3CYO A;  1K97 A;  4X20 A;  3STL C;  3SQ1 A;  3W7W A;  1JCH A;  2UUB B;  1NVP B;  1S77 D;  2UXC O;  2YC0 A;  1N4C A;  2P1P B;  2X6B A;  3AEI A;  3W7X A;  4EYW A;  3CFP A;  4B3T O;  3R66 A;  1XMO B;  2CGN A;  4YJ2 B;  3FYE B;  4MTG A;  4UVC A;  3OMN B;  1MMO G;  4HCB A;  2OCH A;  4GX1 A;  1JMK C;  3E83 A;  1HP8 A;  2DEB A;  1MHY G;  3CRC A;  3QTC A;  4ADO A;  5EC1 C;  1HR0 O;  4OPA A;  1FS0 G;  4I4T A;  1V54 B;  1O9H A;  1BS3 A;  3HB3 B;  2QKA A;  4DV5 O;  1MOF A;  4QNC A;  4TUY B;  4AI6 A;  2YEV B;  1BCC H;  1PP9 H;  4X9Q A;  5LHI A;  4DR7 B;  2UXB B;  3CCL V;  3CSX A;  2DYR B;  4LF7 O;  1FKA O;  4FJG A;  2L35 A;  4J80 A;  4JAA A;  5LBQ A;  1H8E G;  5GW7 A;  2BE3 A;  1ZX3 A;  4CC5 A;  2V1D A;  3FB7 C;  3HKB A;  1L0L H;  4DTP A;  2ZE7 A;  4H0L B;  4MS2 A;  5CBH A;  2DOS A;  1QBZ A;  4GUN A;  2A7W A;  3G6E V;  1BL8 A;  3TCU A;  1PNL A;  5JCO C;  1FS1 A;  4DU4 A;  3C3T A;  5GON A;  4DR1 B;  2JS5 A;  3ABT A;  5IWA O;  4DV6 O;  5CA0 B;  1AIL A;  2JVD A;  1TVK A;  4B3S B;  1WP7 A;  2Q7G A;  3HKD B;  3G67 A;  5LHH A;  2MK3 A;  2JK5 C;  3ASN B;  5JQG A;  5IDJ A;  1SZT A;  1QQC A;  3ABK C;  4CZZ A;  1IBL B;  5LP6 B;  2ZNJ A;  4HBN A;  1FZ6 E;  2Q7H A;  3P3P A;  5H5N A;  2XAH A;  4JI3 B;  4CS2 A;  3S3W A;  3OGM B;  1RPR A;  1F23 A;  1XIL A;  2ZD9 A;  3SPJ A;  3L2O B;  2HR3 A;  1H2L A;  4KHU A;  1FZ9 E;  2P7T C;  1BQ0 A;  4GX5 A;  4JAU A;  4TV9 A;  4ZOL A;  3OT7 A;  5D5P A;  1NTK H;  4RNG A;  3RMB A;  4U7N A;  1YIJ V;  1VQ5 V;  1PL4 A;  5CBF A;  2AZ0 A;  3L73 H;  1XNR O;  4I50 A;  3H1K H;  1HDJ A;  2XAQ A;  2UXD B;  1LDK E;  5J2U A;  2FKX A;  3KG2 A;  1K92 A;  5D5Q A;  3DTU B;  3K06 A;  4LFC O;  4FJI A;  4FJC C;  1H8H G;  4JI7 O;  2W6I G;  1H2G A;  4K8Z A;  1EZJ A;  4X1I A;  4LP8 A;  1MHZ G;  3CMA V;  4P9P A;  3RMA A;  1EZV H;  1NQT A;  1L0N H;  1BHA A;  2RCU A;  3C6N B;  2QGN A;  5IWA B;  3H1L H;  1M93 A;  1EBO A;  4M45 A;  3OTO B;  5EBL C;  2WA4 A;  2Z5U A;  2DJV A;  4LF6 B;  3T2M A;  2Y4U A;  4O4I B;  2B7M A;  4FM0 A;  2P22 C;  2PF4 E;  3L71 H;  2XND G;  5L3B A;  4X89 A;  1ROP A;  3UM7 A;  4DTU A;  1IBL O;  5A2Q N;  2JH8 A;  2YI9 A;  2ZIO A;  3SNN A;  3RN4 A;  2E32 A;  2VJ5 A;  3IFX A;  2GSM B;  3SUN A;  1S3J A;  1RSO A;  1NZ6 A;  4PI0 A;  4R6Z A;  4R50 A;  3SR2 C;  1GN2 A;  4J7J A;  2YIB A;  2KQX A;  5LYJ A;  2HFE C;  1Y66 A;  5KHJ A;  1FXK A;  1FD9 A;  4DV2 B;  1XUQ A;  3MAQ A;  3RGB A;  1IVS A;  3ZJZ A;  1YTF D;  2QKC A;  3AG2 B;  4XDL A;  1G4Y B;  1IBM O;  2PYJ A;  3C94 A;  3K57 A;  2CGO A;  3SI6 A;  3RWU A;  3DXR B;  5LP6 A;  2UUC B;  1M57 C;  4JAS A;  3DC5 A;  4KHN A;  4PA9 A;  1SQQ H;  4RO2 A;  4UCO A;  5FNV A;  3UQ8 A;  5IYD O;  3UO2 A;  2EIM C;  4LNU B;  5KA5 A;  4FJJ A;  3OM3 B;  1FJG B;  3D36 C;  4NVP A;  1OJH A;  1NH2 D;  1W0K G;  4PA4 A;  3G80 A;  4N21 A;  2Q9L A;  2ADQ B;  4EB6 A;  1NI8 A;  1AR5 A;  1TAE A;  3K0G A;  3RW0 A;  1VF5 B;  4DR6 B;  2YDE A;  1XU5 E;  1N36 O;  3FD9 A;  4BIZ A;  3CD6 V;  5H2F Z;  5J2T B;  4UCS A;  3KZI Z;  2XAS A;  5CB4 B;  1KQS U;  1XEQ A;  3ZHU A;  1DGS A;  1L8D A;  5IY5 C;  2QA4 V;  1QCE A;  3BRC A;  2OVR B;  2Q73 A;  1WJZ A;  2MW2 A;  4DW0 A;  1N34 B;  3WFV A;  1XDC A;  3KKY A;  3GWK C;  4G27 B;  3K04 A;  3M7M X;  2QKS A;  3RMD A;  5DED A;  1JJ2 U;  4FK5 C;  3SUP A;  2ZNI A;  4EFB A;  3SCX A;  4U3J B;  4DR2 B;  5IJ0 B;  4X1Y B;  3JAT B;  2BCC H;  2ETN A;  3JAM N;  3ETD A;  2HG5 C;  1HNW O;  5L3F A;  1AI4 A;  1IUR A;  3F5T A;  2WPD G;  1I94 O;  1GM9 A;  4HNA B;  4QE7 A;  3QO5 A;  1ORQ C;  2R70 A;  2BOC C;  3EXA A;  1KUQ A;  1VF6 C;  1XMH E;  3ML0 A;  2Y48 A;  3RVY A;  2YIA A;  1VQO V;  4U7O A;  3LSQ A;  1Q3E A;  4X62 B;  4I55 A;  3ZMZ A;  3P30 A;  2JJ2 G;  2DY4 A;  4UCR A;  3AG3 C;  4CS3 A;  4O2B B;  1XOU A;  2B1G A;  1K33 A;  5LOV A;  3LSU A;  2GTA A;  2DN9 A;  1W2B U;  2V4D A;  2PFT A;  1B3Q A;  2OTJ V;  5LMU O;  2ATK C;  2P6J A;  5IJ0 A;  3ZX6 A;  5C8Y B;  5BR8 B;  4FJL A;  1KEC A;  4I9W A;  1Q9X A;  3ZIA G;  3E2E A;  2LF6 A;  4U3F H;  3ZRW B;  3QF7 A;  3IJ4 A;  1RPO A;  1IBM B;  3CC2 V;  1Q82 W;  5LHG A;  1H38 A;  1X4T A;  2JH9 A;  4DV0 B;  4JI4 B;  4KHY A;  4HNA A;  4HZ3 A;  1DK1 A;  4TSF G;  4W4K A;  3JCZ A;  5CA0 A;  1PD3 A;  1XVF E;  3SPC A;  2PZS A;  4JF3 A;  4LH6 A;  2EIL C;  5KUM A;  1WAZ A;  2A79 B;  4TV9 B;  2NLJ C;  2GUZ B;  5AG2 A;  1ZL8 B;  3VQY A;  4EFE A;  3M99 B;  3C95 A;  1E1R G;  4UUJ C;  3ZED A;  3JYC A;  1T5E A;  4UCU A;  2OVQ B;  1SQX H;  1US6 A;  3ASO C;  1QNM A;  2AGA A;  5KAI Z;  5JVD A;  4DR3 B;  3OGI B;  3SJC C;  5CN0 A;  3QNO A;  2BTQ B;  3OE7 G;  1PPJ H;  1TA8 A;  1F51 A;  2P1M B;  3ABU A;  1HNX B;  1MZF A;  1U97 A;  4G28 B;  3OTO O;  4MW3 A;  4EB6 B;  3N1B A;  3N2G B;  1HNX O;  2DE0 X;  3B09 A;  4NB5 A;  4FLU A;  2XAG A;  2GDS A;  4J2B A;  1MG1 A;  4FK4 A;  3MHS C;  2R72 A;  2XHB A;  5JWP A;  2FYO A;  4DR7 O;  1FAF A;  1G1X B;  1P4R A;  5CA3 A;  4JI5 O;  2N74 A;  3ETG A;  3F5W C;  5GON B;  2CE4 A;  3T4D A;  3AK3 A;  3ASO B;  4DV3 O;  3FX7 A;  4LCU C;  1M5I A;  1R1B A;  1AP6 A;  1Y76 B;  1GN4 A;  2DQ0 A;  4UCT A;  4DTR A;  1LNQ A;  3RWR D;  3RT3 C;  2O57 A;  3HGK E;  1JW2 A;  2IM9 A;  5LXT A;  3ZMU A;  5IYZ A;  4RUE A;  1RSO B;  2ZR2 A;  3NAE A;  2AW9 A;  3U11 A;  4H37 A;  3SJQ C;  3HKC B;  1AR4 A;  1FPO A;  1SQP H;  3TJT A;  1ZLZ A;  5LOV B;  4XDJ A;  1VAR A;  3VQV A;  1DF4 A;  1NKD A;  3TAE A;  3E8G A;  4QIW F;  5FLX N;  4JI5 B;  3QEI A;  2PGG A;  1YEW A;  3HKC A;  2ITC C;  2DQ3 A;  5LGT A;  3E22 B;  5BY1 A;  3I55 V;  4LC1 A;  5B1N A;  1AI7 A;  1P22 A;  4M3X A;  1SQB H;  3H1J H;  3TAF A;  2B9Z A;  4P9O A;  2EIK B;  2YXY A;  4M3U A;  3CQ8 A;  1Y76 A;  1VEW A;  1MTY G;  5JJN B;  3NXS A;  4MSW C;  2RJZ A;  2LFS A;  4ICG A;  3C90 A;  5LMN O;  1B06 A;  3QEX A;  1GKF A;  4TT3 G;  3AG3 B;  1OCO C;  4OGQ B;  4LF6 O;  1IX9 A;  4ABM A;  1NT2 B;  3ZCC A;  4K0K O;  4X1I B;  4I50 B;  5L3E A;  1IDS A;  2DYS C;  3BFR A;  3CXC U;  3X2Q C;  1GM7 A;  3MKS B;  3RYC B;  1MSD A;  2ZE8 A;  5B1A B;  2ODM A;  1NJI W;  3FB5 C;  1FFT B;  2HEP A;  5IE9 A;  3MDS A;  4XDK A;  5LGU A;  4B3T B;  2AXT Z;  3JAW A;  2DWD C;  1FZ1 E;  4BW9 A;  3SPY A;  3EHB B;  4FFB B;  5FPO A;  1QR9 A;  4I6J B;  1HWY A;  1FXV A;  1NH2 B;  3IC9 A;  4X64 B;  1FYJ A;  1Z5V A;  1N0N A;  5BMV B;  3SUQ A;  3DC6 A;  3AG4 B;  3QES A;  2B1E A;  3WG7 C;  3C3S A;  1XMG E;  4LF5 O;  3GWO A;  4I9Q A;  3RMC A;  3D8C A;  3LDE A;  4DR4 O;  1CXZ B;  1Q43 A;  1XL4 A;  2Q68 A;  4JV5 O;  2XAJ A;  2UUB O;  4KXR A;  2VWK A;  2WLM A;  4KUM A;  1MA1 A;  2ZDI C;  1N1C A;  5B1B B;  4OX9 B;  1ARO P;  4PI2 A;  4NXN O;  2IBZ H;  3AG7 A;  3JAR B;  2LO1 A;  4LWS B;  3QVN A;  3K2O A;  4GLX A;  1NS1 A;  2CDY A;  3UT5 A;  4B3S O;  2Q0O C;  1N34 O;  3SPH A;  1EN5 A;  5GTI Z;  5A9G A;  4LNU A;  4JS4 A;  2RN9 A;  1Q6U A;  3E35 A;  4YY3 O;  4JS5 A;  1Q6I A;  3JAL B;  2ITD C;  5H37 A;  2OT5 A;  4DUZ O;  3ABK B;  3CC4 V;  1MMM A;  1Y74 A;  5JJJ B;  2EJ7 A;  4QE9 A;  5IYZ B;  3AG4 C;  4JI2 B;  4FLW A;  2CK3 G;  2FTK A;  4DUZ B;  4YJ3 A;  1NR1 A;  4YIO A;  3O65 A;  4O4H A;  4BWA A;  3QO8 A;  2JHC A;  4PA6 A;  3V7D B;  4DRX A;  4CBC A;  4LFC B;  1FJG O;  3ICX A;  2P1O B;  3LUT B;  4MVO A;  3QEV A;  3N27 A;  4QPK A;  4HYO A;  2KKW A;  3ZN0 A;  2ZKO A;  2QEX V;  3B77 A;  3CXH F;  2X6C A;  1N8R W;  3MHH C;  4F6R A;  5K1X A;  1S5H C;  1QLE C;  2Y69 B;  4A5U B;  4TQD A;  4FJK A;  2OZM A;  3E8F A;  4AHC A;  1QVF U;  4M3R A;  1FZ8 E;  4P30 A;  1WN7 A;  4B3M B;  2LJ2 A;  4YJ3 B;  2WLH A;  1OV9 A;  1VIB A;  2DTU A;  1Q8I A;  3CX5 F;  2BSK A;  2OCC C;  1R3J C;  1ZSP A;  4PEL A;  1GAX A;  4DV0 O;  4JI4 O;  4DRX B;  1RM1 C;  4Q20 A;  4RWU A;  3SYP A;  1K5S A;  2OVP B;  1AVM A;  1YDX A;  1SZX A;  1LUV A;  3K58 A;  2EX3 A;  2CTR A;  3G6B A;  4B7K A;  4KHW A;  1Y74 B;  2R9I A;  2HLD G;  3H1I H;  3OMI B;  1MSW D;  1TUE B;  4BIU A;  1V9P A;  2CTQ A;  4DTO A;  1R6K A;  2QE7 G;  4B3M O;  4AQY B;  1OCO B;  2XT9 A;  4DUY B;  4O2A A;  2LFR A;  1VQP V;  1Q86 W;  3JD0 A;  3CCQ V;  4ZOL B;  3CCR V;  5E79 Z;  2JGD A;  4KHP O;  1OCR C;  2LW1 A;  3MD0 A;  1BGY H;  1EN6 A;  4AQY O;  4YJ2 A;  2RMK B;  2H4T A;  4J7K A;  4R8C A;  4DU3 A;  5GTH Z;  4LH7 A;  3VOU A;  3H1H H;  2G38 A;  4FJN A;  5IYC O;  2P4V A;  3JD4 A;  4NTY A;  4FJ8 A;  4ASU G;  5LGN A;  3HGL A;  2HKO A;  1VQ7 V;  2FYU H;  2EIJ C;  3FAV A;  2UU9 B;  1M4U A;  4PA3 A;  2X6A A;  3OGK B;  5TIS Z;  4FLV A;  1XVE E;  3B8M A;  4IGG A;  3UT5 B;  1N36 B;  1K5Q A;  4FJH A;  4DV7 O;  1V54 C;  5LL6 Y;  1S72 V;  2B8I A;  1AJN A;  1YF2 A;  4DR5 B;  1M56 B;  2PY5 A;  2P4K A;  4AKH A;  4I4T B;  2XOK G;  2YSU B;  2VJ4 A;  3RYF A;  3JSL A;  2PFV A;  1I08 A;  3CCU V;  4JTD B;  5B1B C;  3AG1 C;  2CAZ C;  3RBZ A;  1U96 A;  1M9N A;  4JGS A;  4UB6 Z;  4FLT A;  2KG7 B;  3ABL B;  4DV5 B;  2Q6A A;  5HFL A;  4X66 O;  1FXK C;  4FFK A;  2F4V B;  4JI1 B;  1TGO A;  5FL7 G;  2F1M A;  2JIZ G;  4IL6 Z;  1OCZ C;  3I5D A;  1BMF G;  3SJJ A;  2EIM B;  1IBK O;  1L1F A;  5IJ9 B;  4DV2 O;  2IU3 A;  4J42 A;  4MTX A;  2PI5 A;  5LYJ B;  3SPI A;  3L74 H;  5B3S B;  2JJ1 G;  3TGU H;  4KI6 A;  2F95 B;  4K35 A;  1XHX A;  2YS8 A;  1K9M W;  1R3I C;  4JI8 B;  2H94 A;  5FPR A;  4ZIB A;  2H8P C;  4QPJ A;  4LFB B;  1UFI A;  5IJ9 A;  4K3A A;  3T1H O;  3LSS A;  5BMV A;  1XMO O;  1Y4M A;  2CUG A;  1JOY A;  5LXT B;  4X1K B;  4I5S A;  4LWS A;  3EVK A;  3RYH B;  4MVS A;  4RAI A;  1SS3 A;  1THZ A;  2YIC A;  4J9Z B;  4NXN B;  1ZAU A;  1AI6 A;  1VP7 A;  4JYC A;  1WLE A;  3SGI A;  1MZE A;  4LF4 O;  2QDO A;  1GMG A;  4MVU A;  3N2K B;  2PTM A;  1O9G A;  1JVM A;  1VQN V;  1Q90 D;  3RYH A;  1I5Y A;  4WFH A;  4LF4 B;  2ADP A;  4JYA O;  2VQE B;  1PM9 A;  3CCM V;  3G4S V;  2P67 A;  3A0H Z;  5B1A C;  2QWO B;  3D3Q A;  3ZHQ A;  1VQ8 V;  1IG9 A;  1WNS A;  2Q8V A;  1R6N A;  4D7S A;  1DLB A;  2KSD A;  1JX9 A;  1FXX A;  2E75 B;  1K7D A;  3WSO A;  4RQE A;  5BZB A;  3LZI A;  2ZIN A;  3K5O A;  1NVP D;  2IU0 A;  2QM4 A;  1KKD A;  3OGL B;  3AK2 A;  4KL1 A;  1NBM G;  3GVM A;  3L75 H;  4IHJ B;  3WB2 A;  3WG7 B;  1VQ6 V;  5KUK A;  2HVJ C;  3OR7 C;  3KD5 E;  5EBM C;  1F4N A;  1TUB B;  3BVO A;  1XHZ A;  5L3C A;  1COW G;  1YJ9 V;  2MW2 B;  2ZM6 B;  2UU9 O;  2OIG A;  1R73 A;  1V55 C;  2BSK B;  2BTO A;  4C7U A;  1KBH A;  1OCR B;  2UUA B;  4FJ9 A;  5E1A C;  1AI5 A;  4GAM C;  3CHX A;  4WFG A;  3NHG A;  1V55 B;  3RYC A;  1P49 A;  1WA8 B;  2JEU A;  4YIP A;  3JAS B;  2JHA A;  2RNB A;  5JQG B;  1YCI A;  2AZ2 A;  3TXS A;  3CCS V;  1K4D C;  5EYP B;  5HFM A;  2OWO A;  2P5O A;  2E76 B;  3IAY A; 
#chains in the Genus database with same CATH homology
 2CTW A;  2CUG A;  2QWN B;  3APQ A;  1NZ6 A;  2PF4 E;  2QWQ B;  1IUR A;  2EJ7 A;  3UCS C;  1BQZ A;  1XBL A;  1N1C A;  2QWO B;  3UO3 A;  2M6Y A;  2QWP B;  2OCH A;  2GUZ A;  1GH6 A;  2Y4T A;  3AG7 A;  2KQX A;  2N05 A;  2LO1 A;  4IT5 A;  3BVO A;  4RWU A;  1FAF A;  2CTQ A;  2LGW A;  2YS8 A;  1HDJ A;  2DMX A;  2GUZ B;  2L6L A;  2QSA A;  2QWR B;  4J80 A;  1N4C A;  2YUA A;  4J7Z A;  2N04 A;  1FPO A;  3UO2 A;  2CTR A;  2RKH A;  3APO A;  2CTP A;  2DN9 A;  1WJZ A;  1BQ0 A;  2Y4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...