3UO3A

Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
174
structure length
174
Chain Sequence
RRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords J-type co-chaperone JAC1, mitochondrial
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 64
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo3A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo3A02
2QWQB 1FAFA 4J7ZA 2YS8A 3BVOA 1XBLA 2DN9A 2Y4TA 1FPOA 2CTWA 2LO1A 2YUAA 3UCSC 1BQ0A 1N4CA 3APQA 2CUGA 1N1CA 2QSAA 2Y4UA 3APOA 1IURA 2PF4E 2KQXA 2M6YA 2EJ7A 4J80A 1WJZA 2GUZB 2QWOB 1GH6A 2CTPA 2QWNB 2QWPB 3AG7A 2RKHA 2LGWA 2CTQA 2DMXA 2N04A 4RWUA 2N05A 1NZ6A 2GUZA 2OCHA 3UO2A 2CTRA 2QWRB 1HDJA 3UO3A 1BQZA 2L6LA 4IT5A
chains in the Genus database with same CATH superfamily
1FZ9E 2ATKC 3LNNA 3RN4A 5JQGB 1J5EB 4YJ2B 3ZMZA 4C7UA 4DTNA 1U97A 2JPNA 1FD9A 4FJMA 3QEIA 4W4KA 3K2OA 2E5LO 3JAWB 1AP6A 4J9ZB 4MVSA 1FS0G 4K3AA 1O9GA 1FFXA 1BT8A 4EFEA 3CB2A 4JAUA 4R50A 2QWRB 2VQFB 4FLZA 1RM1B 4KP4A 4KHUA 1TGOA 2Q69A 4YIOA 3ETDA 5BY1A 1H2LA 2IH3C 1ZL8A 3FYIB 5JVDA 1GM7A 5L3FA 4FJ5A 1MTYG 3N2GB 5IZ7A 4TUYA 3Q4HB 3RMCA 1VEWA 3LZIA 4U7OA 1UPGA 3G67A 3FKSG 4IHJA 1SQFA 4FLWA 2RNBA 4FPPA 1K4DC 4JI5B 5EIBC 1SZXA 1G1XB 3SQ0A 3LSUA 1YI2V 4H44B 4M42A 3FB6C 3EHBB 2WA4A 3M8AA 4LNUB 4K8XA 5JQGA 4YJ2A 1L8DA 3QNOA 2ZXWC 4M3TA 1KP2A 2YI9A 3CC2V 3CRQA 3LDBA 2XAJA 1XMFE 1VQLV 1SC5B 1YCIA 4B3SO 4GX5A 1S3JA 2A9HA 1AI4A 5LXTB 4LF8O 1AILA 3QEPA 1Q43A 1X59A 5KA6A 1Q6HA 4B3RB 4JYAO 3TL8B 1X4TA 2GTSA 2DOSA 1L0LH 5GW7A 4F4LA 4GKJO 2QTOA 1W0JG 1PL0A 3SPJA 2UUAO 1NH2B 1RP3B 3N2GA 3KG2A 2ETNA 5EBWC 3JSLA 3WU2Z 1V54B 2JK5C 2C2AA 3BPZA 4PDRA 2PTMA 4MTGA 4JI0B 3NE6A 3TXQA 1RSOA 2EJRA 3CSXA 1IXBA 1I0HA 1XU3E 2XASA 1Q6IA 2B8IA 1M4UA 3ML0A 2EZOA 4P9PA 4DXWA 1JVMA 4LNUA 1QVFU 3TAGA 2AW9A 2YIBD 1P7GA 2Q68A 3QF7A 4EPHA 1F4NA 4LR3A 4HNAB 5FPOA 1XHZA 4DV1B 3OW2U 1Y76A 3TABA 1FZ2E 3RMAA 3R65A 2ZQMA 1QLEC 5LXTA 1K33A 2AZ2A 5DM6V 4LF9O 1N0JA 3SUOA 1GN2A 1AJNA 1BS3A 5GONB 4DV3B 2UUCO 5B1BC 2Q7GA 1HW7A 1VF6A 1YHQV 4JI8O 3ABMC 4GAMC 2DYSB 1E1RG 3CXHF 4JZ2A 3G6BA 1PL4A 4FM0A 2DTUA 3WB0A 4PJ0Z 2L35A 3EVKA 2WLIB 3JD0A 3K08A 3U10A 4MVQA 4AI6A 3OTOB 5D5PA 4A5UB 1VQ8V 4JV5O 2YEVA 2Y48A 3ASNB 1IBLO 1VMGA 5LP6B 2ZM6B 1IBMB 1AR1B 4R6ZA 2HLDG 2RKHA 2P1OB 3ABKC 5KLVH 3ZMUA 3DGEA 3FB7C 2QXFA 4HNAA 1GN6A 4UB8Z 1KP3A 3NCIA 3AG3B 1FYZE 3RMDA 1AR4A 2OCCC 4XDJA 5CB4A 2HR3A 3K04A 2AGAA 1WN7A 1SZTA 3L71H 3D3IA 1G4YB 1XOUA 4I6JB 1XMGE 4PDLA 2PI4A 5GONA 4EFBA 2KKWA 4IGGA 1OCZB 4KI4A 3HP9A 1MMMA 5KMGB 1HNXB 3CCJV 1HDJA 2OIGA 3LSSA 1ZUQA 2OT5A 4MSWC 5TISZ 1XVDE 1BCCH 1P22A 3LD8A 1S5LZ 5FNVB 2WLIA 1YZBA 1L0NH 3WG7B 1Q6UA 2GHYA 3UKMA 1F51A 3GWKC 4X64O 4UB6Z 2Q0AA 4O2BB 5LP6A 2EINB 5LYJB 4LFBB 1QU7A 3LNMB 4DR2O 4K8ZA 2F93B 5L3BA 5JH7B 2QA4V 2PY5A 3VOUA 3C3SA 1XDCA 2ZD9A 3S3XA 2F23A 4TOIA 1EN4A 2DN9A 4IIJA 5IJ9A 4D7SA 3M99B 1OZ0A 1P4RA 4KUMA 2E32A 3AG2C 3ZN1A 1GAXA 3JD1A 3C6PB 1H38A 1WAZA 4RUEA 2JHAA 2BE3A 2WLJA 4N23A 3O9OA 3JCUZ 2UXBB 3C95A 1N32B 2VQEB 1N34B 1N36B 1VQKV 4I9QA 4DTRA 5FNVA 2OWOA 3K5MA 4DU3A 1IXMA 1SQQH 1EM1A 2OVPB 2ZINA 3P3PA 1QR8A 3IJ4A 4O2BA 2ODMA 1SQBH 1CLQA 1QQCA 1L1FA 4FZ0A 3I5DA 4JI4B 1B04A 3DTUB 3QERA 2ZCEA 4GX2A 2V1DA 1D5AA 4MVMA 4ADOA 4TT3G 3BAAA 4KXRA 4U3JA 1BQ0A 4JI7B 2JH8A 2EILB 1FYJA 4JI6O 4RNGA 1B3QA 2B1GA 2XAHA 3H1IH 2HD0A 2VJ5A 4LF4O 3EXAA 2QR4A 4DTXA 1R3KC 1P49A 4X8AA 1H2MA 1K8AW 5H6RA 4R7CA 3CCSV 2PI5A 3TAFA 4X1KB 1FAFA 4I0XB 4WFAV 3ABTA 1XMOB 3SPHA 2ZKOA 4EKWA 1XNRO 3QO7A 1V55C 4UUJC 1ZWIC 2OCHA 2IW5A 2QM8A 4I50B 3E8BA 1I5XA 5J9PC 2JH9A 4FJ8A 4WCEV 2CGNA 3A0HZ 5BR8O 2Y4UA 2UXDB 2F95B 4M3YA 1XVFE 3NHGA 2P1NB 1UFIA 5EC2C 3KZIZ 4FJNA 3E35A 1J5EO 2P6JA 4MVZA 2AHZA 5LBQA 3QEVA 1FZ4E 4KI6A 4DV7O 1SQPH 3CFOA 1FZ7E 2P5GA 4K35A 3CCVV 1NJIW 4KFMA 1WAFA 4X1KA 3T4ZA 4I0XA 5EIBD 3K58A 2VQFO 4WFBV 5FL7G 5IWAB 1VQ5V 2HVKC 1WNSA 3OM3B 2LGWA 5FPRA 2Y69B 5B3SC 2N05A 4FJIA 1EZVH 1Y67A 1D5NA 1IX9A 1K92A 3DXRA 1WAJA 4I50A 1P84F 5HFLA 3FFQA 4I7ZB 1MG1A 4KHQA 3ZRWA 3VQVA 1VARA 3L72H 2QGNA 2X7RB 4ZIBA 2QWPB 4DV0B 3QG5A 2EULA 4NTWA 3NDKA 1MA1A 1Q82W 3P32A 2CGOA 1NVPD 1KECA 4JI2B 4LH6A 4KL1A 3B8NA 4ZBMA 1N33B 1FZ0E 2EIKB 5IYCO 3HKDB 4P9OA 4WF9V 2QJ1A 4IL6Z 3H1HH 5AG2A 1W2BU 4LP8A 1HNZB 1E1QG 2WA3A 4AKIA 5CA3A 3RYFA 4X65B 3JATB 4B3RO 4WFFA 4KHNA 1SRYA 1W0KG 4G27B 1NR7A 2GDSA 3RYCB 1GTOA 2HG5C 4X5MA 2DWDC 4RO2A 2G38A 4J7ZA 1AJQA 4RAIA 4LFCB 3ETQA 1PD3A 5D5QA 1O9HA 4GYCB 3K57A 2QTSA 4JI0O 1BMFG 4U3FH 2AZ0A 3C3TA 4WFEA 5LGNA 4J7JA 4UVCA 4JRQA 3E22B 2L6LA 4JPRA 5H6QA 4AHCA 4NKGB 3THOA 4X88A 5CBFA 1PV0A 4LF5B 2RMKB 4FJ9A 2IJIA 2QKCA 2CH7A 3STZC 4ABMA 3SJCC 4TQFA 3HKDA 1YSCA 4PA7A 4YXWG 1TVKB 2QEXV 1BSMA 4GZRB 4DV1O 4I55B 4KHWA 4M45A 1E79G 1HP8A 3SQ2A 1NU1H 4IYHA 3JATA 4MTXA 3OE7G 1KD1W 3AK2A 4DV3O 1GKFA 2ZT9B 2UXXA 1VP7A 1WB7A 3RYCA 4QJFB 1FXKC 3ZEDA 1KBHA 1KMIZ 1COWG 4J2EA 4X66B 2YC0A 2XT9A 4B3MB 1URFA 4H33A 2E74B 1KC8W 3H9VA 3D36A 3JARB 1M57C 3BCCH 3BHPA 3OTOO 1JCHA 2ARHA 1SERA 2P1QB 1NTKH 1R3JC 3JAMN 3E22A 3IC9A 3HR0A 2ZM6O 1IBMO 1K73W 3F7YC 3LDSA 1D2DA 1Y6XA 3CCLV 2VJ4A 4TV8B 1KYOF 5KHJA 4X1IB 1TVKA 2RCVA 1JJ2U 3TJTA 3G80A 3JAKB 5H37A 4DTPA 5HFMA 3F5TA 3E4WA 4JI1B 3RWRD 2MMBA 2ZXWB 2E31A 1HNXO 1XNQO 2LO1A 2A06H 4I9WA 2ZE7A 4DR4B 2R9RB 4QPKA 2XHBA 2QKSA 4D6TH 2A3QA 5IT9N 3ASOC 2FMLA 3JARA 3ABUA 1YJ9V 2JIZG 1Q3EA 4KHPB 3KD1E 2QM4A 4DR5B 1FXVA 4JF3A 4UVAA 2YS8A 1BZKA 2CTWA 1NVPB 4LFBO 3ICXA 3ABLC 2E76B 4YHHB 4OX9B 3QESA 1TUEB 2ZE6A 2VWJA 4I9LA 4X1IA 3W7UA 4X62B 2H3OA 1WLEA 1Q90D 5IDJA 4I5SA 3SVIA 3SPGA 1ZX3A 1AVMA 5DEDA 1GN3A 2LQTA 3WB1A 4RG8A 2DQ3A 2JGDB 1H8EG 2HJFC 4LBEC 3CC4V 2XOKG 4G28B 4XDKA 2R72A 4LF6B 4ADNA 4O4HB 2ZNJA 1XL6A 2UXBO 1N32O 1F4MA 4IYIA 4WFHA 2VQEO 1N34O 1WPBA 2HFEC 2LF3A 3OEHG 3JAWA 1QLEB 1P7BA 1YEWA 2BCCH 3C90A 2P22C 3B77A 1XVGE 1QHTA 3X2QC 2QWQB 4CS2A 4PELA 4JI3B 2OIEA 5B1BB 4CH5A 3CS5A 4YY3B 1MSDA 3UCSC 4J41A 2YXYA 3GB7C 3ABMB 5DECA 1DTOA 3APOA 2Q73A 3CCUV 2QWNB 3Q4HA 1XILA 2V4DA 3HKEB 4JASA 2EZPA 5LOVB 1XVCE 4XDLA 1PM9A 3V7DB 1AJPA 3W7WA 4JI7O 2ZR3A 3D3QA 1R3IC 4YJ3B 1I94O 1ZLZA 1N8RW 1XI1A 4AQYB 2M7WA 1FZ1E 2JGDA 4M3UA 2GV9A 4PA9A 1Y66A 2ZDIC 2UXCB 2QE7G 3ABKB 1FZ3E 2IJHA 4JTAB 1R6KA 1GM9A 1OCCC 3NGIA 4O4HA 3DC5A 4H13B 2OCCB 2ITDC 5KUKA 3CMAV 4HBNA 2MZWB 5LHIA 4CZZA 2WAMA 4CC5A 4DTJA 3SYOA 4QNCA 4JYYA 3LDCA 1YIJV 2WLMA 4GLXA 4TSFG 4BIZA 1AI5A 5LOVA 4FJHA 3CRMA 3T1CA 2UXDO 5C8YB 1B6QA 1PP9H 3L75H 1WPXA 3SCXA 4FFKA 5FLXN 1XMQB 2B1EA 3HGKE 3ZHRA 5GTIZ 4HCCA 2KSDA 4TQDA 1VQPV 1H2GA 4LCUC 3H01A 3MDSA 5K1XA 3S9HA 5IWAO 1BE3H 2WLKA 3SJQC 2E3CA 3ZS8C 3AG2B 4PA6A 2P1MB 5LL6Y 3OMNB 4FK2A 2YICA 1NT2B 1G8MA 2ZNIA 2EIMC 4DTUA 3LSQA 4BIUA 3BRCA 3I56V 5KHKA 4P30A 3DC6A 4LWSB 2CK3G 3KCYA 4DV0O 2Q7EA 2YUAA 5C8YA 3OFNG 1EN5A 1KUQA 1YDXA 4HCBA 1N33O 1H2NA 3S3WA 1SKVA 2F4VO 2DQ0A 2B5UA 4PA4A 1Q7YW 4DU1A 2KG7B 4OPHA 4K0KB 3FB8C 5H5NA 1UJWB 2Y0IA 4X65O 5LHGA 4DO2A 2ZR2A 4UCUA 2RQ6A 3ETGA 3ZHVA 1CXZB 2CDYA 5BZBA 3JYCA 4LFCO 3J81N 3TAEA 3E89A 4YIPA 5KMGA 1EZJA 3CJHB 3VQWA 4JAAA 4BIOA 4B08A 4EEQA 4LWSA 1DGSA 1JPXA 3OR6C 3UM7A 5IYDO 1V55B 1VIBA 1J95A 4LF5O 1K9MW 3L70H 1EBOA 2NR5A 3QNEA 2VWKA 3GVMA 2UU9B 2LJ2A 4UCVA 4DR6B 1FZIE 2KG7A 2B1IA 5LYJA 3QO8A 1NI8A 4TV9B 2F43G 3TJYA 4JZGA 5CA0B 3L8BA 1JOYA 4MVUA 2XAFA 4ZI7B 3A2FA 5JH7A 5LMUB 4OGQB 2BTQB 4F6EA 4Q20A 1LR1A 1N1CA 3B09A 2QDOA 1H8HG 1N0NA 3OGKB 1AI6A 4AKGA 4FM2A 2DMXA 4DV4O 3FB5C 2UUAB 1FFTB 2WSSG 3RMBA 2OZSA 5JJJB 4X66O 4B3MO 2PFVA 3CEIA 3WSOA 4RL5A 1QNMA 3W7TA 4E3SA 2EIJC 3HKCB 4EP9A 4N21A 1VQOV 4FM1A 1VQ6V 1IG9A 1MZEA 1SA0B 5B3SB 2YSUB 2DE0X 3OGIB 2V7QG 2FL4A 1R1BA 2DJVA 3U11A 1AP5A 1ZTEA 4FJXA 4BAYA 1XEQA 4IT5A 2OVQB 1K5QA 5E79Z 3CRRA 5A9GA 2FKXA 2YIBA 3E83A 4TV9A 3STLC 5CA0A 4LFAB 2ILMA 3L0MA 4ZI7A 5LA6B 2UUBB 1ORQC 3TCUA 2BTQA 3BEHA 4NYKA 1HNWB 4FIPC 1DK1A 4JI1O 4LF9B 3AK1A 2N04A 2NNUA 3K79A 4UXNA 3CXCU 1HWYA 3CFRA 3QEXA 1M56C 3ZMSA 2P5OA 3N1BA 2UXNA 1JFFB 1SS3A 3EFFK 2JVDA 5IBKB 1MSWD 1NQTA 2N74A 1VQMV 4KHPO 3KCXA 4J2BA 2XAQA 4O2AB 4NXNB 3SUNA 1FXHA 1MMOG 3IFXA 5BMVB 3ETEA 3OEEG 4JV5B 5JCOA 3JALB 4YHHO 4OX9O 4HYOA 3M7MX 3FX7A 1Y74B 1LUWA 3K9SA 1MHYG 2LGQA 3DSQA 4NXMB 4D7TA 1JJOA 3A8TA 4HZ3A 4JI5O 3MHHC 1Y4MA 5LA6A 3RFRA 4R8CA 2KQXA 3OT7A 3ZX6A 2NN4A 1NR1A 1GMGA 4DV2B 2CTRA 3ZIAG 3RT3C 1NS1A 4LF6O 3ZCCA 4J2DA 2BOCC 3ZJZA 4F6RB 2IJJA 1HR0B 4FLXA 4QNHB 4JS4A 4MVOA 4JTDB 4DYLA 3OGMB 1S72V 4JI3O 3ZHSA 1SQXH 2VRZA 1FXKB 4YY3O 5B66Z 1WB8A 4MVRA 4PI2A 3SUQA 3IAYA 3JALA 4J9YB 3CPWU 1FKAO 1Y74A 1YJWV 1K3EA 1M57B 4GUNA 3QVNA 4X1YB 3RWUA 3OMIB 1VQ7V 2R9IA 4DU4A 2ZE8A 3SYAA 3KKYA 3GWOA 2FYOA 3J80N 3VQXA 1FJGB 4B7KA 4WFGA 3R66A 3K5LA 4AQYO 2ATQA 2HHHB 3LDEA 2UXCO 1JA8A 2A0LA 1KQSU 4Z1VA 5LGUA 4ZOLB 1NTMH 2WLNA 2FB5A 2WPDG 3CCQV 4DR3B 1F7YA 1FZ8E 3AEIA 1BHBA 5IYZB 3JSNA 2GUZB 3G4SV 4CH4A 2ZE5A 4I4TB 3NAEA 4HAMA 4CH6A 3CP1A 3BY6A 1PNMA 4DW0A 5J2UB 1XVEE 3RVYA 4MW8A 4W4LA 2A79B 3KD5E 3MAQA 2PUSA 1V9PA 1MABG 2IBZH 4ICGA 3ASOB 2X6CA 1CP9A 2B7MA 4O4JB 1VQNV 1GRJA 2EBOA 3CE2A 2A7WA 4M3XA 2W6IG 2CTQA 4MTOA 4NVPA 1XMQO 2LW1A 2RJZA 2W6JG 2Q9LA 3L9DA 1QR9A 3A0RA 4DV5B 3ABLB 2PYLA 4LF4B 1OJHA 1SQGA 2HP8A 1OCRC 2BTOA 4J42A 4ZOLA 4J2AA 2ITCC 4JTCB 1H2KA 5IYZA 4NB5A 2JGUA 1PNLA 4I55A 2P4VA 3L2OB 2IJKA 3I55V 3W7XA 1NZ6A 3RBZA 4I4TA 3AG4C 4AI8A 1OCOC 2DYRC 3G71V 1VF7A 4PI0A 5J2UA 1KKCA 4MS2A 4JS5A 3SJJA 3ZMTA 1Z5VA 2FTKA 1RPRA 2QM7A 2PYJA 3AK3A 2ADPA 2CUGA 2JEXA 2LP7A 3SJAC 2Q5ZA 3ZHTA 3N2KB 1ROPA 4IHJB 3AG7A 3CFPA 4O4JA 1K34A 3AG1C 3TETA 1EN6A 3X2QB 5B1AC 2RN9A 4JYBA 5KHIA 2LFSA 2WLLB 3UO2A 2QKAA 4FJKA 2Z3YA 5IY5C 1I08A 4KHSA 2Q67A 4UCRA 3UIQA 5JJNB 3ZRVA 1R6TA 4RQFA 4DRXB 1XBLA 2OVRB 3PN1A 5KA5A 4DV7B 1NBMG 3APQA 4K0KO 5L3CA 3K0DA 5F2VO 4TV8A 2OTJV 1IDSA 4M3WA 2DW4A 3RVZA 2K1EA 3J7AU 4FLTA 3UT5B 2LF6A 4UFZA 2HJDA 3LDDA 2GBOA 2LW7A 2F1MA 3JAKA 2JQTA 3A0BZ 4OPAA 3BABA 3QNNA 5KUMA 2CAZC 1OCCB 3J27A 3H1JH 3K59A 5LMNB 3VQYA 1OV9A 3E8FA 4DUZB 3T4DA 3WFVA 4DTMA 1YF2A 3N2KA 3K3WA 1N36O 3L74H 5EC1C 1M1KW 2X6BA 1JR9A 4ZKIA 2WLLA 1RSOB 3K06A 4X5NA 2BOBC 1U96A 1YTFD 5DN6G 4GKKB 3J2PA 1JMKC 2UU9O 3CHXA 2O57A 3HKBB 4DRXA 4NR1A 4DR6O 2WWWA 4FVMA 1YXBA 1VF5B 1LNQA 1GO3F 4J10A 2OYQA 4JI4O 3CD6V 3TGUH 4L87A 3N27A 2D3OW 5LMUO 1FS1A 1R73A 1BGYH 2YIDA 3NR7A 1Y76B 4JRPA 4E2LA 3T1YB 3MHSC 1TUBB 4X9QA 3TXSA 3CCRV 3UT5A 3CCMV 3E4YA 3SQ4A 1WP8A 3OMAB 4E4EA 1RM1C 3BVOA 2YIAA 2ZDIA 1F23A 1FPOA 1YJNV 4DUYB 3SYPA 1M93A 4DK0A 2OTLV 1S0VA 4FJLA 1IURA 2HVJC 2R9AA 4J80A 5IE9A 5CBGA 1XMOO 2YDEA 3F7VC 1S5JA 4FLYA 3K5NA 3F5WC 1QCEA 1MNGA 4B7EA 4H0LB 2BSKB 4UCTA 2JS5A 5LGTA 1K5SA 3RGBA 1AB3A 2YEVB 4FK5C 2XNDG 3RW0A 4PDMA 2EIMB 1VQ9V 1Z2GA 3NXSA 2JJ1G 3FD9A 3B4SA 3HKBA 4P2ZA 3SR2C 1SESA 1G6UA 3T1HB 2Q4PA 2Z0AA 4PD4F 4LFAO 3HKEA 2UUBO 2PZSA 5CB4B 3JASB 2R70A 3TK1A 5KAFZ 1HNWO 1TUBA 3BA8A 3L73H 3CMEV 3B2EE 1AR5A 2MK3A 3CQ8A 4YJ3A 2Y4TA 4QE9A 2DY4A 4B3TB 2IH1C 2IU0A 2D2CB 1GH6A 4LF7B 1VF6C 4UV9A 4RWUA 2P4KA 1SF9A 1XL3C 5ITZB 2RCUA 1PKXA 1V54C 2K5SA 4NXNO 4BR6A 5KHHA 1FZ5E 2BSKA 2AHYA 3OGCC 3MKSB 1DLBA 4DR7B 3VBBA 4GT1A 1OHHG 1XUQA 4NXMO 5IJ0B 4DV6B 4NTYA 2DWEC 4IIJB 4UVBA 5IJ9B 3SPCA 3JASA 4L8JA 4FMTA 2JS3A 4DV2O 2CE4A 2LFRA 1TA8A 1NEXB 1IBKB 1FZHE 2Q7HA 4DR1B 5GTHZ 5CN0A 4JI2O 1XQ8A 1XNQB 2DEBA 4M3ZA 1M9NA 2PGGA 4AILC 1ENVA 5EYPB 1HR0O 2H94A 1HNZO 3SJBC 2DYSC 2E5LB 4J11A 5ITZA 4E4BA 2P90A 3P3NA 4QPJA 1YTFB 4ASUG 5L3EA 3CYOA 3BA9A 4FLUA 3E2EA 1B06A 3HL8A 4CC6A 3ASNC 5EBMC 1EFRG 2Q8VA 1GM8A 2YI8A 4QNDA 5LP6C 2EIJB 1ZAUA 4PDVA 5IJ0A 1XHXA 4O4IB 4U3JB 3ZHUA 1S5HC 1FJGO 2YB5A 5C93A 1W59A 3AG3C 1R3LC 1QLNA 2HHHO 1I5YA 4FLVA 4FZ1A 4DR3O 2Q6AA 3OUFA 4X20B 1OCZC 1S77D 5EYPA 3HB3B 4Z2WA 3B8MA 3E8GA 3OAAG 3FYEB 5A2QN 4B3SB 2HEPA 1A32A 2Z5UA 2JHPA 4LF8B 1IVSA 4U7NA 5CMUA 2QWOB 4WBNB 1THZA 4J7KA 3WG7C 4JYAB 2VIXA 4DTSA 1M56B 2Q0OC 4BW5A 3QO5A 4GKJB 1FXXA 5EBLC 2ZIOA 3SYCA 5B5EZ 2EINC 1IZ3A 1T5EA 5CA1B 1KKDA 4X89A 3CX5F 4MTFA 3H1LH 3CJHA 2MW2B 1Q8IA 4O4IA 4PV1B 3IC7A 3JCZA 3W7SA 2K9PA 1MOFA 1FZ6E 5KX5B 4DV5O 5KHGA 1XL4A 3L1NA 1I94B 1WJZA 1Z5WA 4FJ7A 1K7DA 1WP7A 1TAEA 1BQZA 4G2KA 4X20A 4EB6B 5B1OA 1R6NA 5L3DA 1JX9A 3ZMVA 2JEUA 4Z1MG 3CWBH 4UCSA 4Q6GA 1N4CA 4AKHA 4RQEA 4PA3A 5IYBO 3QEWA 2JHCA 4WBNA 3DXRB 2UUCB 1Q81W 3SGIA 2PFTA 3C6NB 3N1EA 4DR4O 4MT8A 3ZRWB 1YITV 3H1KH 1DF4A 4LC1A 3SPIA 2JJ2G 4JI8B 1JQ0A 5CA1A 4FK4A 2X0LA 2Y0PA 2MW2A 4OXSA 3HKCA 4QIWF 1CPYA 2YXHA 4DR5O 4PHZA 5KX5A 3CRCA 5EZYB 1SA0A 3HGLA 3ZBHA 3E86A 2EILC 5B1NA 5JWPA 3D8CA 2P1PB 1BHAA 1IBLB 3PJSK 1VQ4V 2ZIMA 1KU9A 4QE7A 1SQVH 2GTAA 4EB6A 3OGLB 3SPYA 2FYUH 2B9ZA 4X62O 1LUVA 1RPOA 4O4LB 1LDKE 3RYFB 1I7FA 4DK1A 1ZSPA 4TWKA 2XAGA 2PF4E 4FK0A 4EYWA 3SI6A 1XMHE 1XVBE 4UV8A 3O65A 4JAVA 5JCOC 4JYCA 5LMNO 2IU3A 4DUZO 1Q9XA 1S76D 3SUPA 2H4TA 4KHYA 2VS0A 5EK0A 4ZHQB 3RYHB 4MW3A 3ZN0A 3UQ8A 1JFFA 1Q9YA 2XTAA 3G6EV 1K4CC 1MZFA 3CRAA 2EJ7A 5E1AC 2W0XA 3K0GA 2P7TC 4GKKO 1YVWA 4O2AA 3SQ1A 5EZYA 2OZMA 2CH7B 1NKDA 5BMVA 4X64B 2F4VB 1WA8B 3QETA 4FJGA 3JD2A 4JGSA 3C6OB 3T1YO 2AXTZ 4DR2B 2YXLA 4UCOA 3FAVB 4O4LA 1DF5A 2X6AA 3LUTB 1MHZG 1H2SB 2H8PC 5H9CA 1CEZA 1M5IA 1Q86W 2W0FC 3MD0A 4DUYO 2FW3A 1OCRB 5KAIZ 1AROP 3RYIB 5J2TB 1PPJH 4BWAA 5LHHA 1JW2A 4NTXA 2Y69C 1AI7A 3OD4A 3ZRXA 4FJJA 4DTOA 3OTFA 2P67A 4F6RA 4BW9A 1QVGU 4ZHQA 3RYHA 5JJEB 5K1PA 3AG4B 1OCOB 2DYRB 2M6YA 5BXZA 3K5OA 3HPLC 1IH7A 2ADQB 1FXKA 3OR7C 2GSMB 2P06A 4FFBB 3C94A 2HKOA 1NH2D 4DW1A 3T1HO 1WA8A 3IGAC 3ZHQA 3OUSA 2EIKC 3SNNA 3AG1B 3U0ZA 5L3GA 5B1AB 3LZJA 2XUMA 4GCZA 1GN4A 4GX0A 2JRIA 4CS3A 3BFRA 4X1YA 3FAVA 5IY5B 3SPZA 2E75B 4H37A 4CS4A 1GK9A 4QGPA 4JI6B 4LH7A 2F66C 4B3TO 3RYIA 5J2TA 4LF7O 4DV4B 3QTCA 1PNKA 3SDLA 1SETA 4M3RA 1QBZA 1XREA 4ICGC 2QSAA 5H2FZ 1Q5OA 1FFXB 2RDCA 5IREA 2CTPA 3D36C 2JDIG 3JD4A 3CCEV 3JD3A 2GUZA 3P30A 1KB9F 3ZRSA 3CC7V 1ZL8B 5JVDB 3SYQA 4DR7O 4FFBA 3T2MA 1XNRB 4TUYB 3WB2A 2NLJC 4M41A 2EX3A 4DV6O 1XU5E 3B40A 2KB1A 1K97A 4XBFA 1M90W 2IM9A 3K03A 1RFYA 1BL8A 1US6A 4FJCC 2WLHA 3UO3A 5CBHA 1NTZH 4GX1A 3K9AA 4RUFA 4CBCA 4CH3A 5BR8B 1IBKO 3E8HA 4DR1O
chains in the Genus database with same CATH topology
2QWQB 1FAFA 4J7ZA 2YS8A 3BVOA 1XBLA 2DN9A 2Y4TA 1FPOA 2CTWA 2LO1A 2YUAA 3UCSC 1BQ0A 1N4CA 3APQA 2CUGA 1N1CA 2QSAA 2Y4UA 3APOA 1IURA 2PF4E 2KQXA 2M6YA 2EJ7A 4J80A 1WJZA 2GUZB 2QWOB 1GH6A 2CTPA 2QWNB 2QWPB 3AG7A 2RKHA 2LGWA 2CTQA 2DMXA 2N04A 4RWUA 2N05A 1NZ6A 2GUZA 2OCHA 3UO2A 2CTRA 2QWRB 1HDJA 3UO3A 1BQZA 2L6LA 4IT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWQ B;  1FAF A;  4J7Z A;  2YS8 A;  3BVO A;  1XBL A;  2DN9 A;  2Y4T A;  1FPO A;  2CTW A;  2LO1 A;  2YUA A;  3UCS C;  1BQ0 A;  1N4C A;  3APQ A;  2CUG A;  1N1C A;  2QSA A;  2Y4U A;  3APO A;  1IUR A;  2PF4 E;  2KQX A;  2M6Y A;  2EJ7 A;  4J80 A;  1WJZ A;  2GUZ B;  2QWO B;  1GH6 A;  2CTP A;  2QWN B;  2QWP B;  3AG7 A;  2RKH A;  2LGW A;  2CTQ A;  2DMX A;  2N04 A;  4RWU A;  2N05 A;  1NZ6 A;  2GUZ A;  2OCH A;  3UO2 A;  2CTR A;  2QWR B;  1HDJ A;  3UO3 A;  1BQZ A;  2L6L A;  4IT5 A; 
#chains in the Genus database with same CATH topology
 1FZ9 E;  2ATK C;  3LNN A;  3RN4 A;  5JQG B;  1J5E B;  4YJ2 B;  3ZMZ A;  4C7U A;  4DTN A;  1U97 A;  2JPN A;  1FD9 A;  4FJM A;  3QEI A;  4W4K A;  3K2O A;  2E5L O;  3JAW B;  1AP6 A;  4J9Z B;  4MVS A;  1FS0 G;  4K3A A;  1O9G A;  1FFX A;  1BT8 A;  4EFE A;  3CB2 A;  4JAU A;  4R50 A;  2QWR B;  2VQF B;  4FLZ A;  1RM1 B;  4KP4 A;  4KHU A;  1TGO A;  2Q69 A;  4YIO A;  3ETD A;  5BY1 A;  1H2L A;  2IH3 C;  1ZL8 A;  3FYI B;  5JVD A;  1GM7 A;  5L3F A;  4FJ5 A;  1MTY G;  3N2G B;  5IZ7 A;  4TUY A;  3Q4H B;  3RMC A;  1VEW A;  3LZI A;  4U7O A;  1UPG A;  3G67 A;  3FKS G;  4IHJ A;  1SQF A;  4FLW A;  2RNB A;  4FPP A;  1K4D C;  4JI5 B;  5EIB C;  1SZX A;  1G1X B;  3SQ0 A;  3LSU A;  1YI2 V;  4H44 B;  4M42 A;  3FB6 C;  3EHB B;  2WA4 A;  3M8A A;  4LNU B;  4K8X A;  5JQG A;  4YJ2 A;  1L8D A;  3QNO A;  2ZXW C;  4M3T A;  1KP2 A;  2YI9 A;  3CC2 V;  3CRQ A;  3LDB A;  2XAJ A;  1XMF E;  1VQL V;  1SC5 B;  1YCI A;  4B3S O;  4GX5 A;  1S3J A;  2A9H A;  1AI4 A;  5LXT B;  4LF8 O;  1AIL A;  3QEP A;  1Q43 A;  1X59 A;  5KA6 A;  1Q6H A;  4B3R B;  4JYA O;  3TL8 B;  1X4T A;  2GTS A;  2DOS A;  1L0L H;  5GW7 A;  4F4L A;  4GKJ O;  2QTO A;  1W0J G;  1PL0 A;  3SPJ A;  2UUA O;  1NH2 B;  1RP3 B;  3N2G A;  3KG2 A;  2ETN A;  5EBW C;  3JSL A;  3WU2 Z;  1V54 B;  2JK5 C;  2C2A A;  3BPZ A;  4PDR A;  2PTM A;  4MTG A;  4JI0 B;  3NE6 A;  3TXQ A;  1RSO A;  2EJR A;  3CSX A;  1IXB A;  1I0H A;  1XU3 E;  2XAS A;  1Q6I A;  2B8I A;  1M4U A;  3ML0 A;  2EZO A;  4P9P A;  4DXW A;  1JVM A;  4LNU A;  1QVF U;  3TAG A;  2AW9 A;  2YIB D;  1P7G A;  2Q68 A;  3QF7 A;  4EPH A;  1F4N A;  4LR3 A;  4HNA B;  5FPO A;  1XHZ A;  4DV1 B;  3OW2 U;  1Y76 A;  3TAB A;  1FZ2 E;  3RMA A;  3R65 A;  2ZQM A;  1QLE C;  5LXT A;  1K33 A;  2AZ2 A;  5DM6 V;  4LF9 O;  1N0J A;  3SUO A;  1GN2 A;  1AJN A;  1BS3 A;  5GON B;  4DV3 B;  2UUC O;  5B1B C;  2Q7G A;  1HW7 A;  1VF6 A;  1YHQ V;  4JI8 O;  3ABM C;  4GAM C;  2DYS B;  1E1R G;  3CXH F;  4JZ2 A;  3G6B A;  1PL4 A;  4FM0 A;  2DTU A;  3WB0 A;  4PJ0 Z;  2L35 A;  3EVK A;  2WLI B;  3JD0 A;  3K08 A;  3U10 A;  4MVQ A;  4AI6 A;  3OTO B;  5D5P A;  4A5U B;  1VQ8 V;  4JV5 O;  2YEV A;  2Y48 A;  3ASN B;  1IBL O;  1VMG A;  5LP6 B;  2ZM6 B;  1IBM B;  1AR1 B;  4R6Z A;  2HLD G;  2RKH A;  2P1O B;  3ABK C;  5KLV H;  3ZMU A;  3DGE A;  3FB7 C;  2QXF A;  4HNA A;  1GN6 A;  4UB8 Z;  1KP3 A;  3NCI A;  3AG3 B;  1FYZ E;  3RMD A;  1AR4 A;  2OCC C;  4XDJ A;  5CB4 A;  2HR3 A;  3K04 A;  2AGA A;  1WN7 A;  1SZT A;  3L71 H;  3D3I A;  1G4Y B;  1XOU A;  4I6J B;  1XMG E;  4PDL A;  2PI4 A;  5GON A;  4EFB A;  2KKW A;  4IGG A;  1OCZ B;  4KI4 A;  3HP9 A;  1MMM A;  5KMG B;  1HNX B;  3CCJ V;  1HDJ A;  2OIG A;  3LSS A;  1ZUQ A;  2OT5 A;  4MSW C;  5TIS Z;  1XVD E;  1BCC H;  1P22 A;  3LD8 A;  1S5L Z;  5FNV B;  2WLI A;  1YZB A;  1L0N H;  3WG7 B;  1Q6U A;  2GHY A;  3UKM A;  1F51 A;  3GWK C;  4X64 O;  4UB6 Z;  2Q0A A;  4O2B B;  5LP6 A;  2EIN B;  5LYJ B;  4LFB B;  1QU7 A;  3LNM B;  4DR2 O;  4K8Z A;  2F93 B;  5L3B A;  5JH7 B;  2QA4 V;  2PY5 A;  3VOU A;  3C3S A;  1XDC A;  2ZD9 A;  3S3X A;  2F23 A;  4TOI A;  1EN4 A;  2DN9 A;  4IIJ A;  5IJ9 A;  4D7S A;  3M99 B;  1OZ0 A;  1P4R A;  4KUM A;  2E32 A;  3AG2 C;  3ZN1 A;  1GAX A;  3JD1 A;  3C6P B;  1H38 A;  1WAZ A;  4RUE A;  2JHA A;  2BE3 A;  2WLJ A;  4N23 A;  3O9O A;  3JCU Z;  2UXB B;  3C95 A;  1N32 B;  2VQE B;  1N34 B;  1N36 B;  1VQK V;  4I9Q A;  4DTR A;  5FNV A;  2OWO A;  3K5M A;  4DU3 A;  1IXM A;  1SQQ H;  1EM1 A;  2OVP B;  2ZIN A;  3P3P A;  1QR8 A;  3IJ4 A;  4O2B A;  2ODM A;  1SQB H;  1CLQ A;  1QQC A;  1L1F A;  4FZ0 A;  3I5D A;  4JI4 B;  1B04 A;  3DTU B;  3QER A;  2ZCE A;  4GX2 A;  2V1D A;  1D5A A;  4MVM A;  4ADO A;  4TT3 G;  3BAA A;  4KXR A;  4U3J A;  1BQ0 A;  4JI7 B;  2JH8 A;  2EIL B;  1FYJ A;  4JI6 O;  4RNG A;  1B3Q A;  2B1G A;  2XAH A;  3H1I H;  2HD0 A;  2VJ5 A;  4LF4 O;  3EXA A;  2QR4 A;  4DTX A;  1R3K C;  1P49 A;  4X8A A;  1H2M A;  1K8A W;  5H6R A;  4R7C A;  3CCS V;  2PI5 A;  3TAF A;  4X1K B;  1FAF A;  4I0X B;  4WFA V;  3ABT A;  1XMO B;  3SPH A;  2ZKO A;  4EKW A;  1XNR O;  3QO7 A;  1V55 C;  4UUJ C;  1ZWI C;  2OCH A;  2IW5 A;  2QM8 A;  4I50 B;  3E8B A;  1I5X A;  5J9P C;  2JH9 A;  4FJ8 A;  4WCE V;  2CGN A;  3A0H Z;  5BR8 O;  2Y4U A;  2UXD B;  2F95 B;  4M3Y A;  1XVF E;  3NHG A;  2P1N B;  1UFI A;  5EC2 C;  3KZI Z;  4FJN A;  3E35 A;  1J5E O;  2P6J A;  4MVZ A;  2AHZ A;  5LBQ A;  3QEV A;  1FZ4 E;  4KI6 A;  4DV7 O;  1SQP H;  3CFO A;  1FZ7 E;  2P5G A;  4K35 A;  3CCV V;  1NJI W;  4KFM A;  1WAF A;  4X1K A;  3T4Z A;  4I0X A;  5EIB D;  3K58 A;  2VQF O;  4WFB V;  5FL7 G;  5IWA B;  1VQ5 V;  2HVK C;  1WNS A;  3OM3 B;  2LGW A;  5FPR A;  2Y69 B;  5B3S C;  2N05 A;  4FJI A;  1EZV H;  1Y67 A;  1D5N A;  1IX9 A;  1K92 A;  3DXR A;  1WAJ A;  4I50 A;  1P84 F;  5HFL A;  3FFQ A;  4I7Z B;  1MG1 A;  4KHQ A;  3ZRW A;  3VQV A;  1VAR A;  3L72 H;  2QGN A;  2X7R B;  4ZIB A;  2QWP B;  4DV0 B;  3QG5 A;  2EUL A;  4NTW A;  3NDK A;  1MA1 A;  1Q82 W;  3P32 A;  2CGO A;  1NVP D;  1KEC A;  4JI2 B;  4LH6 A;  4KL1 A;  3B8N A;  4ZBM A;  1N33 B;  1FZ0 E;  2EIK B;  5IYC O;  3HKD B;  4P9O A;  4WF9 V;  2QJ1 A;  4IL6 Z;  3H1H H;  5AG2 A;  1W2B U;  4LP8 A;  1HNZ B;  1E1Q G;  2WA3 A;  4AKI A;  5CA3 A;  3RYF A;  4X65 B;  3JAT B;  4B3R O;  4WFF A;  4KHN A;  1SRY A;  1W0K G;  4G27 B;  1NR7 A;  2GDS A;  3RYC B;  1GTO A;  2HG5 C;  4X5M A;  2DWD C;  4RO2 A;  2G38 A;  4J7Z A;  1AJQ A;  4RAI A;  4LFC B;  3ETQ A;  1PD3 A;  5D5Q A;  1O9H A;  4GYC B;  3K57 A;  2QTS A;  4JI0 O;  1BMF G;  4U3F H;  2AZ0 A;  3C3T A;  4WFE A;  5LGN A;  4J7J A;  4UVC A;  4JRQ A;  3E22 B;  2L6L A;  4JPR A;  5H6Q A;  4AHC A;  4NKG B;  3THO A;  4X88 A;  5CBF A;  1PV0 A;  4LF5 B;  2RMK B;  4FJ9 A;  2IJI A;  2QKC A;  2CH7 A;  3STZ C;  4ABM A;  3SJC C;  4TQF A;  3HKD A;  1YSC A;  4PA7 A;  4YXW G;  1TVK B;  2QEX V;  1BSM A;  4GZR B;  4DV1 O;  4I55 B;  4KHW A;  4M45 A;  1E79 G;  1HP8 A;  3SQ2 A;  1NU1 H;  4IYH A;  3JAT A;  4MTX A;  3OE7 G;  1KD1 W;  3AK2 A;  4DV3 O;  1GKF A;  2ZT9 B;  2UXX A;  1VP7 A;  1WB7 A;  3RYC A;  4QJF B;  1FXK C;  3ZED A;  1KBH A;  1KMI Z;  1COW G;  4J2E A;  4X66 B;  2YC0 A;  2XT9 A;  4B3M B;  1URF A;  4H33 A;  2E74 B;  1KC8 W;  3H9V A;  3D36 A;  3JAR B;  1M57 C;  3BCC H;  3BHP A;  3OTO O;  1JCH A;  2ARH A;  1SER A;  2P1Q B;  1NTK H;  1R3J C;  3JAM N;  3E22 A;  3IC9 A;  3HR0 A;  2ZM6 O;  1IBM O;  1K73 W;  3F7Y C;  3LDS A;  1D2D A;  1Y6X A;  3CCL V;  2VJ4 A;  4TV8 B;  1KYO F;  5KHJ A;  4X1I B;  1TVK A;  2RCV A;  1JJ2 U;  3TJT A;  3G80 A;  3JAK B;  5H37 A;  4DTP A;  5HFM A;  3F5T A;  3E4W A;  4JI1 B;  3RWR D;  2MMB A;  2ZXW B;  2E31 A;  1HNX O;  1XNQ O;  2LO1 A;  2A06 H;  4I9W A;  2ZE7 A;  4DR4 B;  2R9R B;  4QPK A;  2XHB A;  2QKS A;  4D6T H;  2A3Q A;  5IT9 N;  3ASO C;  2FML A;  3JAR A;  3ABU A;  1YJ9 V;  2JIZ G;  1Q3E A;  4KHP B;  3KD1 E;  2QM4 A;  4DR5 B;  1FXV A;  4JF3 A;  4UVA A;  2YS8 A;  1BZK A;  2CTW A;  1NVP B;  4LFB O;  3ICX A;  3ABL C;  2E76 B;  4YHH B;  4OX9 B;  3QES A;  1TUE B;  2ZE6 A;  2VWJ A;  4I9L A;  4X1I A;  3W7U A;  4X62 B;  2H3O A;  1WLE A;  1Q90 D;  5IDJ A;  4I5S A;  3SVI A;  3SPG A;  1ZX3 A;  1AVM A;  5DED A;  1GN3 A;  2LQT A;  3WB1 A;  4RG8 A;  2DQ3 A;  2JGD B;  1H8E G;  2HJF C;  4LBE C;  3CC4 V;  2XOK G;  4G28 B;  4XDK A;  2R72 A;  4LF6 B;  4ADN A;  4O4H B;  2ZNJ A;  1XL6 A;  2UXB O;  1N32 O;  1F4M A;  4IYI A;  4WFH A;  2VQE O;  1N34 O;  1WPB A;  2HFE C;  2LF3 A;  3OEH G;  3JAW A;  1QLE B;  1P7B A;  1YEW A;  2BCC H;  3C90 A;  2P22 C;  3B77 A;  1XVG E;  1QHT A;  3X2Q C;  2QWQ B;  4CS2 A;  4PEL A;  4JI3 B;  2OIE A;  5B1B B;  4CH5 A;  3CS5 A;  4YY3 B;  1MSD A;  3UCS C;  4J41 A;  2YXY A;  3GB7 C;  3ABM B;  5DEC A;  1DTO A;  3APO A;  2Q73 A;  3CCU V;  2QWN B;  3Q4H A;  1XIL A;  2V4D A;  3HKE B;  4JAS A;  2EZP A;  5LOV B;  1XVC E;  4XDL A;  1PM9 A;  3V7D B;  1AJP A;  3W7W A;  4JI7 O;  2ZR3 A;  3D3Q A;  1R3I C;  4YJ3 B;  1I94 O;  1ZLZ A;  1N8R W;  1XI1 A;  4AQY B;  2M7W A;  1FZ1 E;  2JGD A;  4M3U A;  2GV9 A;  4PA9 A;  1Y66 A;  2ZDI C;  2UXC B;  2QE7 G;  3ABK B;  1FZ3 E;  2IJH A;  4JTA B;  1R6K A;  1GM9 A;  1OCC C;  3NGI A;  4O4H A;  3DC5 A;  4H13 B;  2OCC B;  2ITD C;  5KUK A;  3CMA V;  4HBN A;  2MZW B;  5LHI A;  4CZZ A;  2WAM A;  4CC5 A;  4DTJ A;  3SYO A;  4QNC A;  4JYY A;  3LDC A;  1YIJ V;  2WLM A;  4GLX A;  4TSF G;  4BIZ A;  1AI5 A;  5LOV A;  4FJH A;  3CRM A;  3T1C A;  2UXD O;  5C8Y B;  1B6Q A;  1PP9 H;  3L75 H;  1WPX A;  3SCX A;  4FFK A;  5FLX N;  1XMQ B;  2B1E A;  3HGK E;  3ZHR A;  5GTI Z;  4HCC A;  2KSD A;  4TQD A;  1VQP V;  1H2G A;  4LCU C;  3H01 A;  3MDS A;  5K1X A;  3S9H A;  5IWA O;  1BE3 H;  2WLK A;  3SJQ C;  2E3C A;  3ZS8 C;  3AG2 B;  4PA6 A;  2P1M B;  5LL6 Y;  3OMN B;  4FK2 A;  2YIC A;  1NT2 B;  1G8M A;  2ZNI A;  2EIM C;  4DTU A;  3LSQ A;  4BIU A;  3BRC A;  3I56 V;  5KHK A;  4P30 A;  3DC6 A;  4LWS B;  2CK3 G;  3KCY A;  4DV0 O;  2Q7E A;  2YUA A;  5C8Y A;  3OFN G;  1EN5 A;  1KUQ A;  1YDX A;  4HCB A;  1N33 O;  1H2N A;  3S3W A;  1SKV A;  2F4V O;  2DQ0 A;  2B5U A;  4PA4 A;  1Q7Y W;  4DU1 A;  2KG7 B;  4OPH A;  4K0K B;  3FB8 C;  5H5N A;  1UJW B;  2Y0I A;  4X65 O;  5LHG A;  4DO2 A;  2ZR2 A;  4UCU A;  2RQ6 A;  3ETG A;  3ZHV A;  1CXZ B;  2CDY A;  5BZB A;  3JYC A;  4LFC O;  3J81 N;  3TAE A;  3E89 A;  4YIP A;  5KMG A;  1EZJ A;  3CJH B;  3VQW A;  4JAA A;  4BIO A;  4B08 A;  4EEQ A;  4LWS A;  1DGS A;  1JPX A;  3OR6 C;  3UM7 A;  5IYD O;  1V55 B;  1VIB A;  1J95 A;  4LF5 O;  1K9M W;  3L70 H;  1EBO A;  2NR5 A;  3QNE A;  2VWK A;  3GVM A;  2UU9 B;  2LJ2 A;  4UCV A;  4DR6 B;  1FZI E;  2KG7 A;  2B1I A;  5LYJ A;  3QO8 A;  1NI8 A;  4TV9 B;  2F43 G;  3TJY A;  4JZG A;  5CA0 B;  3L8B A;  1JOY A;  4MVU A;  2XAF A;  4ZI7 B;  3A2F A;  5JH7 A;  5LMU B;  4OGQ B;  2BTQ B;  4F6E A;  4Q20 A;  1LR1 A;  1N1C A;  3B09 A;  2QDO A;  1H8H G;  1N0N A;  3OGK B;  1AI6 A;  4AKG A;  4FM2 A;  2DMX A;  4DV4 O;  3FB5 C;  2UUA B;  1FFT B;  2WSS G;  3RMB A;  2OZS A;  5JJJ B;  4X66 O;  4B3M O;  2PFV A;  3CEI A;  3WSO A;  4RL5 A;  1QNM A;  3W7T A;  4E3S A;  2EIJ C;  3HKC B;  4EP9 A;  4N21 A;  1VQO V;  4FM1 A;  1VQ6 V;  1IG9 A;  1MZE A;  1SA0 B;  5B3S B;  2YSU B;  2DE0 X;  3OGI B;  2V7Q G;  2FL4 A;  1R1B A;  2DJV A;  3U11 A;  1AP5 A;  1ZTE A;  4FJX A;  4BAY A;  1XEQ A;  4IT5 A;  2OVQ B;  1K5Q A;  5E79 Z;  3CRR A;  5A9G A;  2FKX A;  2YIB A;  3E83 A;  4TV9 A;  3STL C;  5CA0 A;  4LFA B;  2ILM A;  3L0M A;  4ZI7 A;  5LA6 B;  2UUB B;  1ORQ C;  3TCU A;  2BTQ A;  3BEH A;  4NYK A;  1HNW B;  4FIP C;  1DK1 A;  4JI1 O;  4LF9 B;  3AK1 A;  2N04 A;  2NNU A;  3K79 A;  4UXN A;  3CXC U;  1HWY A;  3CFR A;  3QEX A;  1M56 C;  3ZMS A;  2P5O A;  3N1B A;  2UXN A;  1JFF B;  1SS3 A;  3EFF K;  2JVD A;  5IBK B;  1MSW D;  1NQT A;  2N74 A;  1VQM V;  4KHP O;  3KCX A;  4J2B A;  2XAQ A;  4O2A B;  4NXN B;  3SUN A;  1FXH A;  1MMO G;  3IFX A;  5BMV B;  3ETE A;  3OEE G;  4JV5 B;  5JCO A;  3JAL B;  4YHH O;  4OX9 O;  4HYO A;  3M7M X;  3FX7 A;  1Y74 B;  1LUW A;  3K9S A;  1MHY G;  2LGQ A;  3DSQ A;  4NXM B;  4D7T A;  1JJO A;  3A8T A;  4HZ3 A;  4JI5 O;  3MHH C;  1Y4M A;  5LA6 A;  3RFR A;  4R8C A;  2KQX A;  3OT7 A;  3ZX6 A;  2NN4 A;  1NR1 A;  1GMG A;  4DV2 B;  2CTR A;  3ZIA G;  3RT3 C;  1NS1 A;  4LF6 O;  3ZCC A;  4J2D A;  2BOC C;  3ZJZ A;  4F6R B;  2IJJ A;  1HR0 B;  4FLX A;  4QNH B;  4JS4 A;  4MVO A;  4JTD B;  4DYL A;  3OGM B;  1S72 V;  4JI3 O;  3ZHS A;  1SQX H;  2VRZ A;  1FXK B;  4YY3 O;  5B66 Z;  1WB8 A;  4MVR A;  4PI2 A;  3SUQ A;  3IAY A;  3JAL A;  4J9Y B;  3CPW U;  1FKA O;  1Y74 A;  1YJW V;  1K3E A;  1M57 B;  4GUN A;  3QVN A;  4X1Y B;  3RWU A;  3OMI B;  1VQ7 V;  2R9I A;  4DU4 A;  2ZE8 A;  3SYA A;  3KKY A;  3GWO A;  2FYO A;  3J80 N;  3VQX A;  1FJG B;  4B7K A;  4WFG A;  3R66 A;  3K5L A;  4AQY O;  2ATQ A;  2HHH B;  3LDE A;  2UXC O;  1JA8 A;  2A0L A;  1KQS U;  4Z1V A;  5LGU A;  4ZOL B;  1NTM H;  2WLN A;  2FB5 A;  2WPD G;  3CCQ V;  4DR3 B;  1F7Y A;  1FZ8 E;  3AEI A;  1BHB A;  5IYZ B;  3JSN A;  2GUZ B;  3G4S V;  4CH4 A;  2ZE5 A;  4I4T B;  3NAE A;  4HAM A;  4CH6 A;  3CP1 A;  3BY6 A;  1PNM A;  4DW0 A;  5J2U B;  1XVE E;  3RVY A;  4MW8 A;  4W4L A;  2A79 B;  3KD5 E;  3MAQ A;  2PUS A;  1V9P A;  1MAB G;  2IBZ H;  4ICG A;  3ASO B;  2X6C A;  1CP9 A;  2B7M A;  4O4J B;  1VQN V;  1GRJ A;  2EBO A;  3CE2 A;  2A7W A;  4M3X A;  2W6I G;  2CTQ A;  4MTO A;  4NVP A;  1XMQ O;  2LW1 A;  2RJZ A;  2W6J G;  2Q9L A;  3L9D A;  1QR9 A;  3A0R A;  4DV5 B;  3ABL B;  2PYL A;  4LF4 B;  1OJH A;  1SQG A;  2HP8 A;  1OCR C;  2BTO A;  4J42 A;  4ZOL A;  4J2A A;  2ITC C;  4JTC B;  1H2K A;  5IYZ A;  4NB5 A;  2JGU A;  1PNL A;  4I55 A;  2P4V A;  3L2O B;  2IJK A;  3I55 V;  3W7X A;  1NZ6 A;  3RBZ A;  4I4T A;  3AG4 C;  4AI8 A;  1OCO C;  2DYR C;  3G71 V;  1VF7 A;  4PI0 A;  5J2U A;  1KKC A;  4MS2 A;  4JS5 A;  3SJJ A;  3ZMT A;  1Z5V A;  2FTK A;  1RPR A;  2QM7 A;  2PYJ A;  3AK3 A;  2ADP A;  2CUG A;  2JEX A;  2LP7 A;  3SJA C;  2Q5Z A;  3ZHT A;  3N2K B;  1ROP A;  4IHJ B;  3AG7 A;  3CFP A;  4O4J A;  1K34 A;  3AG1 C;  3TET A;  1EN6 A;  3X2Q B;  5B1A C;  2RN9 A;  4JYB A;  5KHI A;  2LFS A;  2WLL B;  3UO2 A;  2QKA A;  4FJK A;  2Z3Y A;  5IY5 C;  1I08 A;  4KHS A;  2Q67 A;  4UCR A;  3UIQ A;  5JJN B;  3ZRV A;  1R6T A;  4RQF A;  4DRX B;  1XBL A;  2OVR B;  3PN1 A;  5KA5 A;  4DV7 B;  1NBM G;  3APQ A;  4K0K O;  5L3C A;  3K0D A;  5F2V O;  4TV8 A;  2OTJ V;  1IDS A;  4M3W A;  2DW4 A;  3RVZ A;  2K1E A;  3J7A U;  4FLT A;  3UT5 B;  2LF6 A;  4UFZ A;  2HJD A;  3LDD A;  2GBO A;  2LW7 A;  2F1M A;  3JAK A;  2JQT A;  3A0B Z;  4OPA A;  3BAB A;  3QNN A;  5KUM A;  2CAZ C;  1OCC B;  3J27 A;  3H1J H;  3K59 A;  5LMN B;  3VQY A;  1OV9 A;  3E8F A;  4DUZ B;  3T4D A;  3WFV A;  4DTM A;  1YF2 A;  3N2K A;  3K3W A;  1N36 O;  3L74 H;  5EC1 C;  1M1K W;  2X6B A;  1JR9 A;  4ZKI A;  2WLL A;  1RSO B;  3K06 A;  4X5N A;  2BOB C;  1U96 A;  1YTF D;  5DN6 G;  4GKK B;  3J2P A;  1JMK C;  2UU9 O;  3CHX A;  2O57 A;  3HKB B;  4DRX A;  4NR1 A;  4DR6 O;  2WWW A;  4FVM A;  1YXB A;  1VF5 B;  1LNQ A;  1GO3 F;  4J10 A;  2OYQ A;  4JI4 O;  3CD6 V;  3TGU H;  4L87 A;  3N27 A;  2D3O W;  5LMU O;  1FS1 A;  1R73 A;  1BGY H;  2YID A;  3NR7 A;  1Y76 B;  4JRP A;  4E2L A;  3T1Y B;  3MHS C;  1TUB B;  4X9Q A;  3TXS A;  3CCR V;  3UT5 A;  3CCM V;  3E4Y A;  3SQ4 A;  1WP8 A;  3OMA B;  4E4E A;  1RM1 C;  3BVO A;  2YIA A;  2ZDI A;  1F23 A;  1FPO A;  1YJN V;  4DUY B;  3SYP A;  1M93 A;  4DK0 A;  2OTL V;  1S0V A;  4FJL A;  1IUR A;  2HVJ C;  2R9A A;  4J80 A;  5IE9 A;  5CBG A;  1XMO O;  2YDE A;  3F7V C;  1S5J A;  4FLY A;  3K5N A;  3F5W C;  1QCE A;  1MNG A;  4B7E A;  4H0L B;  2BSK B;  4UCT A;  2JS5 A;  5LGT A;  1K5S A;  3RGB A;  1AB3 A;  2YEV B;  4FK5 C;  2XND G;  3RW0 A;  4PDM A;  2EIM B;  1VQ9 V;  1Z2G A;  3NXS A;  2JJ1 G;  3FD9 A;  3B4S A;  3HKB A;  4P2Z A;  3SR2 C;  1SES A;  1G6U A;  3T1H B;  2Q4P A;  2Z0A A;  4PD4 F;  4LFA O;  3HKE A;  2UUB O;  2PZS A;  5CB4 B;  3JAS B;  2R70 A;  3TK1 A;  5KAF Z;  1HNW O;  1TUB A;  3BA8 A;  3L73 H;  3CME V;  3B2E E;  1AR5 A;  2MK3 A;  3CQ8 A;  4YJ3 A;  2Y4T A;  4QE9 A;  2DY4 A;  4B3T B;  2IH1 C;  2IU0 A;  2D2C B;  1GH6 A;  4LF7 B;  1VF6 C;  4UV9 A;  4RWU A;  2P4K A;  1SF9 A;  1XL3 C;  5ITZ B;  2RCU A;  1PKX A;  1V54 C;  2K5S A;  4NXN O;  4BR6 A;  5KHH A;  1FZ5 E;  2BSK A;  2AHY A;  3OGC C;  3MKS B;  1DLB A;  4DR7 B;  3VBB A;  4GT1 A;  1OHH G;  1XUQ A;  4NXM O;  5IJ0 B;  4DV6 B;  4NTY A;  2DWE C;  4IIJ B;  4UVB A;  5IJ9 B;  3SPC A;  3JAS A;  4L8J A;  4FMT A;  2JS3 A;  4DV2 O;  2CE4 A;  2LFR A;  1TA8 A;  1NEX B;  1IBK B;  1FZH E;  2Q7H A;  4DR1 B;  5GTH Z;  5CN0 A;  4JI2 O;  1XQ8 A;  1XNQ B;  2DEB A;  4M3Z A;  1M9N A;  2PGG A;  4AIL C;  1ENV A;  5EYP B;  1HR0 O;  2H94 A;  1HNZ O;  3SJB C;  2DYS C;  2E5L B;  4J11 A;  5ITZ A;  4E4B A;  2P90 A;  3P3N A;  4QPJ A;  1YTF B;  4ASU G;  5L3E A;  3CYO A;  3BA9 A;  4FLU A;  3E2E A;  1B06 A;  3HL8 A;  4CC6 A;  3ASN C;  5EBM C;  1EFR G;  2Q8V A;  1GM8 A;  2YI8 A;  4QND A;  5LP6 C;  2EIJ B;  1ZAU A;  4PDV A;  5IJ0 A;  1XHX A;  4O4I B;  4U3J B;  3ZHU A;  1S5H C;  1FJG O;  2YB5 A;  5C93 A;  1W59 A;  3AG3 C;  1R3L C;  1QLN A;  2HHH O;  1I5Y A;  4FLV A;  4FZ1 A;  4DR3 O;  2Q6A A;  3OUF A;  4X20 B;  1OCZ C;  1S77 D;  5EYP A;  3HB3 B;  4Z2W A;  3B8M A;  3E8G A;  3OAA G;  3FYE B;  5A2Q N;  4B3S B;  2HEP A;  1A32 A;  2Z5U A;  2JHP A;  4LF8 B;  1IVS A;  4U7N A;  5CMU A;  2QWO B;  4WBN B;  1THZ A;  4J7K A;  3WG7 C;  4JYA B;  2VIX A;  4DTS A;  1M56 B;  2Q0O C;  4BW5 A;  3QO5 A;  4GKJ B;  1FXX A;  5EBL C;  2ZIO A;  3SYC A;  5B5E Z;  2EIN C;  1IZ3 A;  1T5E A;  5CA1 B;  1KKD A;  4X89 A;  3CX5 F;  4MTF A;  3H1L H;  3CJH A;  2MW2 B;  1Q8I A;  4O4I A;  4PV1 B;  3IC7 A;  3JCZ A;  3W7S A;  2K9P A;  1MOF A;  1FZ6 E;  5KX5 B;  4DV5 O;  5KHG A;  1XL4 A;  3L1N A;  1I94 B;  1WJZ A;  1Z5W A;  4FJ7 A;  1K7D A;  1WP7 A;  1TAE A;  1BQZ A;  4G2K A;  4X20 A;  4EB6 B;  5B1O A;  1R6N A;  5L3D A;  1JX9 A;  3ZMV A;  2JEU A;  4Z1M G;  3CWB H;  4UCS A;  4Q6G A;  1N4C A;  4AKH A;  4RQE A;  4PA3 A;  5IYB O;  3QEW A;  2JHC A;  4WBN A;  3DXR B;  2UUC B;  1Q81 W;  3SGI A;  2PFT A;  3C6N B;  3N1E A;  4DR4 O;  4MT8 A;  3ZRW B;  1YIT V;  3H1K H;  1DF4 A;  4LC1 A;  3SPI A;  2JJ2 G;  4JI8 B;  1JQ0 A;  5CA1 A;  4FK4 A;  2X0L A;  2Y0P A;  2MW2 A;  4OXS A;  3HKC A;  4QIW F;  1CPY A;  2YXH A;  4DR5 O;  4PHZ A;  5KX5 A;  3CRC A;  5EZY B;  1SA0 A;  3HGL A;  3ZBH A;  3E86 A;  2EIL C;  5B1N A;  5JWP A;  3D8C A;  2P1P B;  1BHA A;  1IBL B;  3PJS K;  1VQ4 V;  2ZIM A;  1KU9 A;  4QE7 A;  1SQV H;  2GTA A;  4EB6 A;  3OGL B;  3SPY A;  2FYU H;  2B9Z A;  4X62 O;  1LUV A;  1RPO A;  4O4L B;  1LDK E;  3RYF B;  1I7F A;  4DK1 A;  1ZSP A;  4TWK A;  2XAG A;  2PF4 E;  4FK0 A;  4EYW A;  3SI6 A;  1XMH E;  1XVB E;  4UV8 A;  3O65 A;  4JAV A;  5JCO C;  4JYC A;  5LMN O;  2IU3 A;  4DUZ O;  1Q9X A;  1S76 D;  3SUP A;  2H4T A;  4KHY A;  2VS0 A;  5EK0 A;  4ZHQ B;  3RYH B;  4MW3 A;  3ZN0 A;  3UQ8 A;  1JFF A;  1Q9Y A;  2XTA A;  3G6E V;  1K4C C;  1MZF A;  3CRA A;  2EJ7 A;  5E1A C;  2W0X A;  3K0G A;  2P7T C;  4GKK O;  1YVW A;  4O2A A;  3SQ1 A;  5EZY A;  2OZM A;  2CH7 B;  1NKD A;  5BMV A;  4X64 B;  2F4V B;  1WA8 B;  3QET A;  4FJG A;  3JD2 A;  4JGS A;  3C6O B;  3T1Y O;  2AXT Z;  4DR2 B;  2YXL A;  4UCO A;  3FAV B;  4O4L A;  1DF5 A;  2X6A A;  3LUT B;  1MHZ G;  1H2S B;  2H8P C;  5H9C A;  1CEZ A;  1M5I A;  1Q86 W;  2W0F C;  3MD0 A;  4DUY O;  2FW3 A;  1OCR B;  5KAI Z;  1ARO P;  3RYI B;  5J2T B;  1PPJ H;  4BWA A;  5LHH A;  1JW2 A;  4NTX A;  2Y69 C;  1AI7 A;  3OD4 A;  3ZRX A;  4FJJ A;  4DTO A;  3OTF A;  2P67 A;  4F6R A;  4BW9 A;  1QVG U;  4ZHQ A;  3RYH A;  5JJE B;  5K1P A;  3AG4 B;  1OCO B;  2DYR B;  2M6Y A;  5BXZ A;  3K5O A;  3HPL C;  1IH7 A;  2ADQ B;  1FXK A;  3OR7 C;  2GSM B;  2P06 A;  4FFB B;  3C94 A;  2HKO A;  1NH2 D;  4DW1 A;  3T1H O;  1WA8 A;  3IGA C;  3ZHQ A;  3OUS A;  2EIK C;  3SNN A;  3AG1 B;  3U0Z A;  5L3G A;  5B1A B;  3LZJ A;  2XUM A;  4GCZ A;  1GN4 A;  4GX0 A;  2JRI A;  4CS3 A;  3BFR A;  4X1Y A;  3FAV A;  5IY5 B;  3SPZ A;  2E75 B;  4H37 A;  4CS4 A;  1GK9 A;  4QGP A;  4JI6 B;  4LH7 A;  2F66 C;  4B3T O;  3RYI A;  5J2T A;  4LF7 O;  4DV4 B;  3QTC A;  1PNK A;  3SDL A;  1SET A;  4M3R A;  1QBZ A;  1XRE A;  4ICG C;  2QSA A;  5H2F Z;  1Q5O A;  1FFX B;  2RDC A;  5IRE A;  2CTP A;  3D36 C;  2JDI G;  3JD4 A;  3CCE V;  3JD3 A;  2GUZ A;  3P30 A;  1KB9 F;  3ZRS A;  3CC7 V;  1ZL8 B;  5JVD B;  3SYQ A;  4DR7 O;  4FFB A;  3T2M A;  1XNR B;  4TUY B;  3WB2 A;  2NLJ C;  4M41 A;  2EX3 A;  4DV6 O;  1XU5 E;  3B40 A;  2KB1 A;  1K97 A;  4XBF A;  1M90 W;  2IM9 A;  3K03 A;  1RFY A;  1BL8 A;  1US6 A;  4FJC C;  2WLH A;  3UO3 A;  5CBH A;  1NTZ H;  4GX1 A;  3K9A A;  4RUF A;  4CBC A;  4CH3 A;  5BR8 B;  1IBK O;  3E8H A;  4DR1 O; 
#chains in the Genus database with same CATH homology
 2QWQ B;  1FAF A;  4J7Z A;  2YS8 A;  3BVO A;  1XBL A;  2DN9 A;  2Y4T A;  1FPO A;  2CTW A;  2LO1 A;  2YUA A;  3UCS C;  1BQ0 A;  1N4C A;  3APQ A;  2CUG A;  1N1C A;  2QSA A;  2Y4U A;  3APO A;  1IUR A;  2PF4 E;  2KQX A;  2M6Y A;  2EJ7 A;  4J80 A;  1WJZ A;  2GUZ B;  2QWO B;  1GH6 A;  2CTP A;  2QWN B;  2QWP B;  3AG7 A;  2RKH A;  2LGW A;  2CTQ A;  2DMX A;  2N04 A;  4RWU A;  2N05 A;  1NZ6 A;  2GUZ A;  2OCH A;  3UO2 A;  2CTR A;  2QWR B;  1HDJ A;  3UO3 A;  1BQZ A;  2L6L A;  4IT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...