3UO3A

Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
174
structure length
174
Chain Sequence
b'RRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords J-type co-chaperone JAC1, mitochondrial
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 64
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo3A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo3A02
4J7ZA 4RWUA 2YS8A 1WJZA 2N04A 1XBLA 1GH6A 2GUZB 2N05A 3UO3A 2CUGA 2QWPB 2CTRA 3BVOA 2QWRB 1IURA 1FPOA 2KQXA 2GUZA 3UO2A 2M6YA 2CTQA 2PF4E 4J80A 3UCSC 2YUAA 2L6LA 2CTPA 2EJ7A 2QWQB 2Y4TA 3APQA 2RKHA 2DMXA 3AG7A 2Y4UA 2LGWA 2CTWA 1N4CA 2OCHA 4IT5A 1NZ6A 2LO1A 2DN9A 2QSAA 3APOA 1BQ0A 1BQZA 1HDJA 1FAFA 1N1CA 2QWOB 2QWNB
chains in the Genus database with same CATH superfamily
3P30A 3N2GA 3ETQA 3E8FA 5A9GA 4MS2A 2OCCB 4YIPA 2VRZA 5B66Z 4J80A 2ZNIA 1FZ7E 1MZFA 2ZKOA 2UXXA 1XDCA 2HKOA 5EBMC 5KAIZ 4LF7O 1BS3A 4QIWF 5FL7G 1GN6A 5BXZA 2NNUA 3ZIAG 5L3FA 3KG2A 5EK0A 3SDLA 3HB3B 1IZ3A 2Q6AA 2XAJA 1RM1C 3JD0A 3K2OA 3FB6C 3NDKA 5IJ9B 4DRXB 4NYKA 5JCOC 3FB5C 3NR7A 4JS5A 3ICXA 4PJ0Z 1PPJH 1NTZH 1ZLZA 2EILB 2HJFC 1YZBA 1D2DA 2CTQA 4MVQA 2P1QB 3IAYA 4PA6A 4G28B 1DLBA 1WAFA 5LBQA 1FXHA 1M4UA 1YHQV 4LH7A 5LA6B 2P4KA 2WLLA 3STLC 1R3LC 1WJZA 2IJIA 3C3SA 4MTFA 4FLVA 2R9IA 5CA3A 3M99B 2XT9A 3ETGA 4CS2A 4GX5A 3AK1A 2EULA 3DTUB 4RQFA 4W4LA 2QKCA 4EB6B 3ZRXA 4DV4O 4WFGA 5KMGA 1JOYA 2P06A 2IBZH 3B8NA 4LNUA 3CEIA 1H8HG 3CMAV 1SQXH 2G38A 3ABUA 3CPWU 1GK9A 3SUQA 4BIOA 2RN9A 3CRCA 2W0FC 4UVCA 4M3WA 4FJXA 1X4TA 5IJ0A 3A0RA 2JJ1G 4C7UA 1BHAA 3APOA 2IH1C 2V1DA 1FXKB 2ADPA 5CA0B 1WLEA 4FFBA 4GAMC 5CA1A 3RYCB 2P22C 5L3DA 3FX7A 3QNEA 2GUZA 4RAIA 2FTKA 3ZRVA 3LDDA 4CS4A 2Y0PA 3G80A 3FAVA 4UCOA 3ZX6A 3VQYA 3E8BA 4PDVA 1K4DC 4M45A 4MTXA 1XVEE 3AG4C 2PZSA 1ORQC 3J2PA 3RYHA 1QCEA 3A2FA 5FNVB 5LHHA 1FD9A 3OEEG 3B4SA 2ADQB 3QNNA 5D5QA 2YB5A 1BL8A 4X66O 4DV1B 3LD8A 1L8DA 4EPHA 5ITZA 1VQOV 4D7TA 1NBMG 3JAKB 4JI6O 4DV1O 2LQTA 1HDJA 3SJAC 5BMVA 1PL4A 3W7SA 3G71V 2DYRB 4OXSA 1HNXB 4IYIA 1HNXO 4WFHA 3JD2A 2HP8A 5H9CA 3L8BA 2JEUA 2UXNA 1EN4A 4ZOLA 4ZBMA 1AP6A 2QWOB 4ZI7B 3ABKB 4JRQA 2HFEC 5B1OA 1FZ1E 5LMNB 3AG2B 1Y74B 5JQGA 3CCUV 3HKCB 1KKCA 1ZX3A 3J81N 4IHJA 5IY5C 5LMNO 4JI1B 4CC6A 2IJKA 1SA0B 4BAYA 1CP9A 4TQFA 4JI1O 1SQQH 1VF6C 5KAFZ 2CTRA 3I55V 2R9RB 4LF5B 4O2BA 3IGAC 2WSSG 4JTDB 2WLJA 4LFCB 4WFAV 3HR0A 4IIJB 1Q43A 4Z1VA 3JASA 3SUNA 4P2ZA 4LFCO 3H01A 4DTOA 1ROPA 4F6RB 2LF3A 4JI5B 1Q7YW 2R9AA 4U3FH 4JI5O 3ABLB 2JJ2G 3CRRA 1YTFB 1XQ8A 1I94B 3LDCA 5B1AC 4GZRB 1COWG 1XHXA 1I94O 4PD4F 2EINC 3WG7B 3GVMA 4X9QA 3J80N 3OAAG 4B08A 4KHPB 1P4RA 1DGSA 1FXXA 1JJOA 1FZ2E 4KHPO 1LUWA 4HCBA 2ZT9B 1IBMB 1XL6A 4ZHQA 4YXWG 2KB1A 1XVGE 1FZIE 1EFRG 1IBMO 1F4MA 4M3YA 4B7EA 1SESA 1NVPD 2ZXWC 4MVSA 4HYOA 4I55A 3JCUZ 1AI4A 1E1QG 1OCOC 5IBKB 3F7YC 3HKBA 2XOKG 3ZHRA 4K0KB 3SR2C 2PF4E 5LOVA 2PYLA 3SUPA 1AILA 1WB7A 4DV7B 4K0KO 1T5EA 5J9PC 4X1IB 2ZNJA 1XVFE 4MTOA 2QM8A 4DV7O 3SPYA 3OR7C 2H8PC 1DK1A 3MHHC 1MOFA 1P49A 4X1YA 4PHZA 2ATKC 4ADNA 2JHCA 5C8YA 1FS0G 2MMBA 3BVOA 4YJ3A 1FPOA 3LZIA 1I08A 1XEQA 3ASOC 4DK0A 2LF6A 4PDLA 3CP1A 3C6PB 2A7WA 2RQ6A 2JPNA 4KI6A 3NXSA 4I0XA 1O9HA 3S3WA 4KHQA 3ZMZA 2YEVA 2ZINA 3W7XA 4FLUA 2OVQB 1ZAUA 1OCZB 2WWWA 1MA1A 2P6JA 4Q20A 2GV9A 3O9OA 4FK2A 1GM7A 4RUEA 4FLWA 3RMBA 5LHGA 4J41A 2Y4TA 4JASA 1VF6A 4UV8A 3Q4HA 1NU1H 3G67A 2Q0OC 1ENVA 2AHYA 3LUTB 3U10A 2OCCC 2BTOA 3CYOA 4MTGA 1M9NA 1R1BA 1KMIZ 4DYLA 1JW2A 1SQVH 2QEXV 4DR4O 4LWSA 2BSKA 2AW9A 5IYZA 5JVDA 5GONA 4UCUA 4MVOA 5E79Z 3WB1A 5EZYA 3JATB 4E4BA 3A8TA 2GDSA 3CHXA 2CGOA 2DQ3A 1FKAO 4HNAB 3HGKE 3BRCA 4I9LA 1QQCA 1PM9A 5LP6B 4UB6Z 2EILC 3TAFA 1MZEA 5IDJA 4E3SA 2JDIG 5IT9N 3JYCA 1JR9A 3TCUA 5GTHZ 1K7DA 3OW2U 3L70H 2W6IG 3K57A 4JAVA 2LW7A 3SPCA 1Y76A 3H9VA 2XASA 3UT5A 1US6A 5EYPA 1TA8A 1NKDA 4FFKA 3SYQA 4F6EA 3E35A 4PA9A 3P3NA 1RPOA 2B1GA 3ZRSA 1SRYA 1XILA 2D2CB 2MK3A 5LGNA 2QGNA 2PI5A 2RMKB 2UUCB 3ZRWA 1SQGA 2P7TC 1OZ0A 5IYDO 2IH3C 3C94A 1KP2A 2UUCO 1WNSA 2GSMB 3KCYA 5LYJA 2KG7B 4H44B 1R6TA 3T4ZA 3TK1A 4P30A 3LSQA 4DUYB 5KHGA 3VQXA 2BE3A 2KKWA 3W7UA 4DUYO 3CCLV 3T1HB 1H2NA 4KHNA 1RSOA 1A32A 2EIJC 4R7CA 2EINB 5L3CA 2QA4V 3TAEA 3T1HO 4ADOA 1XU5E 2GBOA 1FZ5E 1ZL8A 3UCSC 1D5NA 1WAJA 2JVDA 1FXKC 1ZWIC 2ZIOA 2A79B 2VJ4A 3B8MA 2LGWA 2CTWA 1SQPH 1YIJV 4M3RA 4X65B 2UU9B 1N1CA 3G4SV 4NXMB 2ODMA 3CJHB 3GWOA 2UU9O 1VARA 4FJGA 1ZUQA 4NXMO 2ZXWB 4PI2A 2X0LA 3CCMV 4DR3B 4DR6B 4JZGA 3HGLA 3SJCC 3L73H 4DR3O 5IWAB 1VQPV 4DU4A 2ZD9A 2WPDG 2QWPB 1WPXA 5IWAO 4PV1B 5B5EZ 5IREA 4DTJA 2UUBB 3DC5A 2YIBA 4FVMA 2WLIA 4O4JA 4PA3A 2OVPB 2H3OA 4DV3B 2UUBO 3U11A 5FLXN 1B3QA 4FZ0A 4DV0B 2DYRC 2YIDA 1MTYG 3OM3B 4O4IB 3RW0A 4DV3O 1I0HA 2JGDB 5J2UB 4DV0O 2FW3A 4K35A 1HW7A 2CDYA 5KX5B 1Y66A 4MVMA 2Q68A 3D3QA 3LSSA 4YY3B 3AEIA 5IJ9A 1Y4MA 1XVDE 5K1XA 3C6NB 3FD9A 4GUNA 2YICA 2HHHB 4GX0A 3BFRA 3HP9A 4RQEA 3JARB 4X88A 4NXNB 3ABKC 1RFYA 4L87A 4H0LB 2HHHO 2N74A 4NXNO 3P32A 1S76D 4QPKA 2DN9A 5C93A 5L3GA 1Y6XA 3RYFA 4ABMA 5LA6A 1YF2A 2PUSA 2E74B 2Y48A 5FPOA 3OEHG 4IYHA 3IJ4A 4LF7B 4E2LA 3SJBC 4NTXA 4TOIA 3OMIB 1GTOA 4WBNB 4AI8A 5IZ7A 5HFMA 2ZIMA 3K5NA 1YDXA 2P5GA 1M1KW 2FMLA 5LXTB 3SYPA 3H1HH 4HCCA 4EB6A 2UUAB 4MW8A 4JPRA 2YSUB 4UVAA 2R70A 2UUAO 2RCVA 2RDCA 3LNMB 5EC2C 4LF4B 2YI9A 3ML0A 4HZ3A 2F4VB 4FM0A 2P67A 1Q9YA 2DQ0A 4FM2A 4DV6O 4LF4O 2UXCB 4CZZA 2F4VO 1V9PA 3ABLC 3CRQA 3LDBA 3SCXA 1JMKC 3CQ8A 2UXCO 3SPZA 3ZMTA 4B3SB 1WA8B 5D5PA 4X20B 5CBGA 1YJNV 3WG7C 4DTMA 4B3SO 3RGBA 3JALB 1KBHA 4FK5C 1WP7A 3RYCA 1H8EG 1Q8IA 3C6OB 4PDMA 5EIBD 4M3ZA 2AHZA 1XUQA 4NVPA 4DV4B 2OCHA 3QVNA 1R6NA 5LL6Y 2P4VA 1FYZE 1GM9A 3N2GB 2E31A 3OE7G 1EN6A 2P1PB 3SQ1A 4JI7B 3RVZA 1NR1A 2LGQA 3UO2A 1EZJA 1Z5WA 2JQTA 4KXRA 3T1CA 4JI7O 4M3UA 1OCCB 3JCZA 3KCXA 4FK0A 2EIJB 3R66A 1HNWB 3SPGA 1K97A 3E83A 1B6QA 2VWJA 1GAXA 1I7FA 1NZ6A 2EIMC 4TV8A 4OX9O 1HNWO 3JAKA 4J7ZA 2QR4A 3N2KB 1WAZA 2EZOA 1G8MA 1PL0A 4F4LA 2K9PA 3A0HZ 1TVKB 3F5TA 1Z5VA 2WLKA 4N23A 4XBFA 1X59A 1BQZA 1KU9A 5L3EA 1N8RW 3TXSA 1BT8A 1L1FA 2X6BA 2QWRB 3ETEA 4X66B 4FJ9A 1Y74A 1XL3C 1KUQA 3HKCA 2DJVA 1OCZC 4RUFA 4DV5O 1H2LA 4JI6B 3W7TA 4K3AA 2YIBD 2YI8A 4UFZA 1KP3A 1OJHA 1SA0A 1XOUA 4KP4A 3TJTA 2ZR3A 3DC6A 1JX9A 4IT5A 3OGKB 3UIQA 4KUMA 2AXTZ 4LNUB 2BTQB 2WLMA 4J9ZB 4NB5A 1K9MW 1H38A 4M42A 2IU0A 3TXQA 1YVWA 2ETNA 1VQ8V 4AKHA 4R6ZA 4J11A 1NVPB 3CC7V 2B1EA 2FYUH 1WPBA 4LP8A 2CH7A 4TSFG 4UCVA 2NN4A 5JCOA 4JTCB 1MHZG 3L74H 3ZHQA 1J5EB 3A0BZ 2GUZB 4F6RA 3KKYA 4DW0A 4ICGC 3NCIA 1XL4A 5LP6C 2V7QG 2PI4A 1MABG 1J5EO 4K8ZA 4M3XA 1NH2D 3TAGA 1JCHA 4KFMA 4B7KA 4GKKB 3CD6V 4DTSA 3V7DB 3K9AA 4UXNA 1Q6UA 3SNNA 1MMMA 1MNGA 4GX2A 4GKKO 5A2QN 5GTIZ 2QSAA 1N0NA 4LF8B 2ILMA 1K34A 1BE3H 4QPJA 1M93A 2YS8A 1D5AA 3E86A 4FJJA 1PV0A 1KB9F 3QO5A 4LF8O 5CBHA 3CCQV 2KQXA 4EKWA 4JYAB 4PA7A 3K59A 3WFVA 4JYAO 4X1KB 1R3JC 3B2EE 1LUVA 3OT7A 4FLYA 1K8AW 3D8CA 1G6UA 3B40A 1F51A 4OGQB 4BR6A 2F43G 1FYJA 1SC5B 2A0LA 3PJSK 3K03A 3T1YO 3K0GA 4FJ8A 3U0ZA 3D3IA 2YUAA 1AB3A 3APQA 4DTNA 3JD1A 4UCRA 5LHIA 4FLZA 3W7WA 5KHKA 3G6EV 4DR2O 1XVCE 3DXRA 3E22A 4DR1B 2F95B 1XMFE 3E4YA 3MDSA 3RMCA 5IYBO 4DR1O 1AROP 1Q86W 1KC8W 2PFTA 4YIOA 1G4YB 4J2BA 4O4HB 2DW4A 3SPIA 2ZR2A 1F7YA 4AKGA 3RN4A 1AJNA 1N4CA 4KHYA 3S3XA 4I7ZB 4NTWA 1YJ9V 4L8JA 3JAMN 2QWNB 4RNGA 5JH7A 3UQ8A 4NR1A 1N33O 2Y69B 4Z1MG 3AG3C 5K1PA 3RWUA 2EIMB 5EIBC 1W59A 1AR4A 4O2AB 4N21A 3JAWA 2HLDG 3JASB 1QLNA 3O65A 2OT5A 2F66C 3WSOA 3DGEA 1SQBH 3ZMVA 3EXAA 4Q6GA 3STZC 4FJ5A 3NHGA 2DYSB 3C3TA 1AVMA 3CXCU 4U3JA 2WAMA 1YEWA 3RYIB 1EN5A 4GYCB 5CB4B 5JJEB 3JATA 1TUBB 1M57B 1P7BA 2XTAA 3ABTA 2EJRA 5LGTA 2Z3YA 4ICGA 1R3IC 4CBCA 2Z5UA 2HD0A 1I5YA 3CE2A 2MZWB 4ZHQB 1F23A 5H6RA 1MMOG 3QF7A 4AQYB 1JPXA 1TAEA 2Q4PA 4JAUA 1JJ2U 4CS3A 3AG1B 2LP7A 4CH5A 4AQYO 4DR4B 2E32A 4FJIA 4EFEA 3CSXA 4NKGB 3CB2A 1XREA 5LOVB 2Q7GA 3FYIB 3CCJV 4MSWC 3SQ4A 1EZVH 1HNZO 3OMNB 1KD1W 4I50A 2QXFA 1XMQB 2KSDA 4Z2WA 5KUKA 1XHZA 2FB5A 4X1YB 3THOA 3CCEV 2QM4A 4LC1A 1XMQO 3HKDA 2LW1A 1TGOA 5DN6G 3UM7A 4JYYA 3ZN1A 2ZDIC 3LNNA 3FKSG 3OGLB 1U97A 4WFBV 1LR1A 1FZ0E 3GWKC 3OMAB 3RMDA 1GO3F 3CRMA 4J7JA 4TWKA 3R65A 1S77D 3SYAA 3L71H 2ZCEA 5KUMA 2D3OW 4CC5A 1H2GA 4JI4B 1BSMA 2YEVB 5JJJB 1K5SA 1MSWD 2Y4UA 2PGGA 1H2KA 3FB8C 1N36B 2B1IA 4LFBO 4JI4O 1S5LZ 3QTCA 1BMFG 1Q6IA 2HVKC 1N36O 1YSCA 2DWEC 2RNBA 3TGUH 4JI2B 2JS5A 2JHAA 4IGGA 3BY6A 1R3KC 2P1NB 1K33A 4JI2O 3CJHA 2M6YA 3Q4HB 4LBEC 2Q8VA 1NS1A 4M3TA 4AI6A 4GCZA 3AK3A 2DWDC 1H2MA 1EM1A 1V55C 3AK2A 2K5SA 5B1BB 2OZSA 5IYZB 5JVDB 1OCCC 4O4LB 1GN3A 3UO3A 1AR5A 4P9PA 3H1LH 4EEQA 1CXZB 2B9ZA 4WFEA 4EFBA 1DTOA 3J7AU 3L2OB 3SUOA 4JAAA 2WLNA 3QO8A 4ASUG 3CRAA 3SPHA 2EIKB 4FM1A 1Q5OA 1FZHE 3SI6A 3GB7C 4H33A 3I5DA 4PA4A 4MT8A 1FS1A 2IJJA 2C2AA 4B3RB 1XU3E 1RPRA 3UKMA 4TV9B 1W0KG 1Q81W 4I4TB 4B3RO 2P1OB 2H4TA 1JA8A 1Y76B 3UT5B 4YJ2B 1L0LH 2JIZG 2UXBB 4A5UB 2HEPA 3L72H 3BHPA 2UXBO 5CMUA 3BA9A 3AG3B 3H1KH 1NTKH 5HFLA 4RG8A 1PNKA 1SETA 4BIZA 5J2TA 3BEHA 1IBLB 2IU3A 1K4CC 1YCIA 2OIGA 3ZRWB 1BHBA 1JFFA 2FKXA 1IBLO 1L0NH 1SQFA 3CCSV 3CXHF 3JD4A 2IJHA 4UVBA 1PNMA 1V54B 1M5IA 3OTFA 5E1AC 1QR9A 3BA8A 3ABMC 1KECA 1UJWB 4WBNA 2NLJC 1XI1A 3MHSC 3M7MX 2W0XA 1VP7A 3CC4V 3C95A 3IC9A 3D36C 4DRXA 1FZ9E 2O57A 2JH8A 4ZKIA 4JV5O 1U96A 5H6QA 4FJLA 3ZMUA 3I56V 4MVRA 5KHHA 4EYWA 4PDRA 2YDEA 1AI7A 4AHCA 4JI0B 4LR3A 3RMAA 2N05A 1GH6A 1KKDA 2OIEA 1AI5A 1NTMH 1GM8A 1WA8A 4JI0O 4X20A 1SS3A 5EC1C 2MW2B 3JALA 2XAGA 4BW9A 3MAQA 4HBNA 4G27B 5KA5A 2Q5ZA 2W6JG 1QU7A 2LFSA 3K9SA 1PP9H 3RVYA 3B77A 4X62O 3H1JH 1K5QA 1FZ4E 1UPGA 3PN1A 1IH7A 4KHWA 2PFVA 3FFQA 4CH3A 2JEXA 4J2DA 4O4JB 2WLIB 4DK1A 4JF3A 4LFAB 3QO7A 2F23A 4DUZB 2OZMA 4DV6B 1SKVA 2Q67A 5KA6A 4LFAO 1S5JA 4DV2B 4W4KA 3HKEB 1FFXB 2H94A 4DUZO 3K06A 2ATQA 3OUSA 3KD5E 4DV2O 2JRIA 4J2EA 3CWBH 1ZTEA 1HR0B 4RL5A 3IFXA 1E79G 2XAHA 1G1XB 4G2KA 1Y67A 1O9GA 1HR0O 1FXKA 1F4NA 4JI8B 1IURA 3N2KA 5CA0A 3TETA 1M90W 4QNHB 1KYOF 4JI8O 2ITDC 4BWAA 5B3SC 1OCRC 4YHHB 1FJGB 4TUYB 1B06A 3CS5A 3OGCC 4UCSA 4PI0A 3VQVA 3RYFB 1IVSA 3ASNC 4YHHO 1TVKA 3L75H 1FJGO 2OTJV 1NH2B 1AP5A 3F7VC 3K08A 2X6CA 2GHYA 4FJCC 2YXLA 3OD4A 2YIAA 4QJFB 2CE4A 2XHBA 5EBWC 4QNCA 3E8GA 2X7RB 1LDKE 1Q9XA 1V55B 5BR8B 3E8HA 5FNVA 2ZE5A 3SYCA 5BR8O 3WU2Z 1XMOB 2Y0IA 5EBLC 4OX9B 2Y69C 4H37A 3MKSB 2XUMA 3BCCH 1XMOO 2R72A 3H1IH 1FZ3E 3SGIA 3CC2V 1SZTA 1ZSPA 2BTQA 2EZPA 2QM7A 4QE7A 3QEPA 4KHUA 2WA3A 1AR1B 2GTAA 4DTXA 2DYSC 2VS0A 1FXVA 2IM9A 3ZMSA 3ZHTA 1EBOA 2WLLB 3ZN0A 4EP9A 3D36A 1NT2B 3SJQC 4FLXA 1OHHG 2N04A 1M56B 1PKXA 1NR7A 1VIBA 1M57C 4ZI7A 1DF4A 4DV5B 2QWQB 3N1EA 4FJMA 3BPZA 2A06H 1NJIW 5DM6V 5LGUA 1FFTB 5IE9A 4I9WA 4X89A 5KMGB 4I9QA 5JWPA 2E5LB 2IW5A 2B8IA 2DEBA 2Q7HA 2EX3A 2E5LO 3AG1C 3ABMB 2DE0X 2CGNA 1CLQA 4U7NA 4D6TH 1Q3EA 1YI2V 4XDKA 4AKIA 2WLHA 4TV8B 4X1KA 5IJ0B 2QDOA 1N0JA 4UV9A 2FL4A 4IIJA 1DF5A 3K04A 4FFBB 3X2QB 5CA1B 1I5XA 1THZA 5BZBA 4BIUA 4FLTA 3QESA 1IX9A 2JH9A 3ZBHA 1VQ4V 2L35A 1QVGU 3QG5A 2PY5A 3ZCCA 4JYCA 3FAVB 1QLEB 1HP8A 3RT3C 1WN7A 4LCUC 2PYJA 3SYOA 3RYHB 2ITCC 4X5MA 1W0JG 1GRJA 3K79A 3QEXA 2F93B 4MW3A 5H5NA 2AGAA 3NGIA 1VEWA 4K8XA 3CX5F 2LFRA 2JK5C 1XNRB 2GTSA 2L6LA 1VQ6V 4DXWA 2YXYA 5ITZB 2DMXA 1XNRO 3QNOA 5TISZ 1IG9A 3OR6C 4O4HA 1P84F 4WFFA 4DTPA 1URFA 2AZ0A 4E4EA 5BMVB 4FJNA 3BAAA 3KZIZ 2HR3A 4D7SA 3T1YB 4DTRA 4DR7B 3S9HA 5CN0A 2Q9LA 2QTOA 2AZ2A 2P5OA 2CH7B 4UUJC 1RM1B 4FPPA 1CPYA 3T4DA 3OTOB 4DR7O 4GX1A 5B1BC 2DTUA 1K3EA 4DR2B 1HWYA 4LF5O 3J27A 4KI4A 4O2AA 3OTOO 3WB0A 3N1BA 4ZOLB 4X1IA 1IXBA 2CAZC 4AILC 2A9HA 5B3SB 1OCRB 2F1MA 5JQGB 3EFFK 3CCRV 1K73W 2EIKC 4IHJB 2BOBC 4DU3A 1VQMV 3ASNB 4FJHA 4BW5A 1QHTA 4B3MB 1MSDA 1Z2GA 2FYOA 4I6JB 3RYIA 4B3MO 3JSLA 3RWRD 5CB4A 4GKJB 1QNMA 4J42A 1WP8A 1TUBA 3MD0A 3OUFA 3K5LA 3OGMB 4QNDA 3ZHUA 1FZ8E 4GKJO 2UXDB 4QE9A 1N33B 1PNLA 4O2BB 2UXDO 2Q7EA 2HG5C 1PD3A 2B7MA 3QERA 4LF9B 4CH4A 2P90A 1XMHE 1GN4A 3E4WA 2LJ2A 3K3WA 1OV9A 3K5MA 2OWOA 4LF9O 4KHSA 4CH6A 2DY4A 1NEXB 2ZE6A 1V54C 4QGPA 4B3TB 4DTUA 3SPJA 3EHBB 2QKSA 1S5HC 1MG1A 5JJNB 5DECA 1IXMA 4B3TO 3IC7A 2ZE8A 1VMGA 2XAFA 3SVIA 1XMGE 1R6KA 4FIPC 3NE6A 3CFPA 1NQTA 3DXRB 3L9DA 3E22B 2QJ1A 4WCEV 3RFRA 4IL6Z 1BCCH 1J95A 4HNAA 4X64B 2X6AA 2HJDA 4JI3B 5LP6A 1S72V 2PTMA 2RKHA 1VQKV 5L3BA 4X64O 2JHPA 1SERA 4JI3O 2V4DA 5DEDA 3E2EA 3AG4B 4FK4A 2CTPA 5H37A 1JVMA 3WB2A 3CMEV 5LMUB 2BOCC 3P3PA 1N32B 3ZHVA 4I55B 5JH7B 1RP3B 4H13B 5LMUO 1N32O 3HKBB 3L1NA 1IDSA 2EBOA 1HNZB 3TL8B 3VBBA 5KHIA 3JAWB 4JZ2A 2B5UA 3TJYA 3VOUA 1P22A 2XAQA 4GLXA 3E89A 3KD1E 2E76B 2VQEB 2YXHA 3K0DA 2ZE7A 2JGUA 1YTFD 2KG7A 4J2AA 2LO1A 1YITV 2WA4A 4M41A 5C8YB 5FPRA 4DO2A 4U3JB 1FAFA 2VQEO 4JYBA 4YJ3B 3L0MA 4J7KA 4O4LA 4ZIBA 5AG2A 2RJZA 1VQLV 3T2MA 4R50A 3BABA 3QEWA 3LDEA 3ETDA 4FJ7A 4I0XB 2K1EA 4LFBB 2QE7G 2E3CA 4I5SA 1GKFA 5IY5B 1FZ6E 4GT1A 1CEZA 3ZEDA 2JS3A 3JD3A 4DU1A 1KQSU 5F2VO 3N27A 1QBZA 3LDSA 4MVUA 4TV9A 3ZHSA 4I4TA 3SJJA 2OTLV 1BZKA 2ARHA 4TT3G 4YJ2A 2VJ5A 2ZQMA 4HAMA 4TQDA 2QKAA 3K58A 2P1MB 3LSUA 4MVZA 1H2SB 4LWSB 2BSKB 2CK3G 4DW1A 4RWUA 5GONB 3HL8A 1JQ0A 4UCTA 1QR8A 3JSNA 1K92A 2CUGA 5EZYB 4I50B 2Q69A 3FYEB 5BY1A 3HPLC 3FB7C 4U7OA 4FJKA 5B1NA 1VQ7V 3K5OA 4J9YB 3HKDB 4X5NA 2VWKA 4FZ1A 3B09A 3AG7A 1AJPA 5B1AB 1VQNV 5KLVH 3ZS8C 4XDJA 1AI6A 2YC0A 4O4IA 1UFIA 2Q0AA 1XBLA 2JGDA 5J2UA 3C90A 1GMGA 2NR5A 5KX5A 4RO2A 2RCUA 1GN2A 3CCVV 1SF9A 5EYPB 4PELA 3QETA 3CFOA 5IYCO 1M56C 2VIXA 4UB8Z 2XNDG 3JARA 5H2FZ 2OVRB 1IBKB 3QEIA 1BQ0A 3CFRA 2E75B 1VQ5V 1IBKO 4X65O 3OGIB 3SQ2A 3G6BA 2Q73A 4DR5B 5LYJB 2OYQA 4LH6A 1P7GA 5GW7A 1OCOB 1N34B 2MW2A 1VF7A 4NTYA 2QTSA 4DR5O 4JS4A 1XNQB 1W2BU 1N34O 3QEVA 4DR6O 4XDLA 1RSOB 2DOSA 4P9OA 1XNQO 1Q90D 5LXTA 1TUEB 4JTAB 5KHJA 1YXBA 1ZL8B 2BCCH 4OPHA 3M8AA 4JV5B 1NI8A 3EVKA 1YJWV 1Q82W 3TABA 3OFNG 1BGYH 3X2QC 2EJ7A 3VQWA 2ZDIA 1XVBE 4KL1A 3HKEA 1FFXA 3DSQA 3LZJA 3ASOB 1SZXA 4FMTA 5CBFA 4WF9V 2M7WA 1QLEC 2A3QA 3NAEA 3F5WC 4X8AA 4LF6B 4YY3O 4OPAA 2ZM6B 3SQ0A 3ZJZA 1B04A 1MHYG 1VF5B 4JGSA 4LF6O 4J10A 2HVJC 2ZM6O 1S3JA 1Q6HA 4TUYA 4X62B 3AG2C 2VQFB 1VQ9V 2Z0AA 5J2TB 4JRPA 1S0VA 1WB8A 1R73A 3RBZA 1QVFU 1AJQA 4R8CA 2VQFO 1JFFB 1LNQA 1E1RG
chains in the Genus database with same CATH topology
4J7ZA 4RWUA 2YS8A 1WJZA 2N04A 1XBLA 1GH6A 2GUZB 2N05A 3UO3A 2CUGA 2QWPB 2CTRA 3BVOA 2QWRB 1IURA 1FPOA 2KQXA 2GUZA 3UO2A 2M6YA 2CTQA 2PF4E 4J80A 3UCSC 2YUAA 2L6LA 2CTPA 2EJ7A 2QWQB 2Y4TA 3APQA 2RKHA 2DMXA 3AG7A 2Y4UA 2LGWA 2CTWA 1N4CA 2OCHA 4IT5A 1NZ6A 2LO1A 2DN9A 2QSAA 3APOA 1BQ0A 1BQZA 1HDJA 1FAFA 1N1CA 2QWOB 2QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Z A;  4RWU A;  2YS8 A;  1WJZ A;  2N04 A;  1XBL A;  1GH6 A;  2GUZ B;  2N05 A;  3UO3 A;  2CUG A;  2QWP B;  2CTR A;  3BVO A;  2QWR B;  1IUR A;  1FPO A;  2KQX A;  2GUZ A;  3UO2 A;  2M6Y A;  2CTQ A;  2PF4 E;  4J80 A;  3UCS C;  2YUA A;  2L6L A;  2CTP A;  2EJ7 A;  2QWQ B;  2Y4T A;  3APQ A;  2RKH A;  2DMX A;  3AG7 A;  2Y4U A;  2LGW A;  2CTW A;  1N4C A;  2OCH A;  4IT5 A;  1NZ6 A;  2LO1 A;  2DN9 A;  2QSA A;  3APO A;  1BQ0 A;  1BQZ A;  1HDJ A;  1FAF A;  1N1C A;  2QWO B;  2QWN B; 
#chains in the Genus database with same CATH topology
 3P30 A;  3N2G A;  3ETQ A;  3E8F A;  5A9G A;  4MS2 A;  2OCC B;  4YIP A;  2VRZ A;  5B66 Z;  4J80 A;  2ZNI A;  1FZ7 E;  1MZF A;  2ZKO A;  2UXX A;  1XDC A;  2HKO A;  5EBM C;  5KAI Z;  4LF7 O;  1BS3 A;  4QIW F;  5FL7 G;  1GN6 A;  5BXZ A;  2NNU A;  3ZIA G;  5L3F A;  3KG2 A;  5EK0 A;  3SDL A;  3HB3 B;  1IZ3 A;  2Q6A A;  2XAJ A;  1RM1 C;  3JD0 A;  3K2O A;  3FB6 C;  3NDK A;  5IJ9 B;  4DRX B;  4NYK A;  5JCO C;  3FB5 C;  3NR7 A;  4JS5 A;  3ICX A;  4PJ0 Z;  1PPJ H;  1NTZ H;  1ZLZ A;  2EIL B;  2HJF C;  1YZB A;  1D2D A;  2CTQ A;  4MVQ A;  2P1Q B;  3IAY A;  4PA6 A;  4G28 B;  1DLB A;  1WAF A;  5LBQ A;  1FXH A;  1M4U A;  1YHQ V;  4LH7 A;  5LA6 B;  2P4K A;  2WLL A;  3STL C;  1R3L C;  1WJZ A;  2IJI A;  3C3S A;  4MTF A;  4FLV A;  2R9I A;  5CA3 A;  3M99 B;  2XT9 A;  3ETG A;  4CS2 A;  4GX5 A;  3AK1 A;  2EUL A;  3DTU B;  4RQF A;  4W4L A;  2QKC A;  4EB6 B;  3ZRX A;  4DV4 O;  4WFG A;  5KMG A;  1JOY A;  2P06 A;  2IBZ H;  3B8N A;  4LNU A;  3CEI A;  1H8H G;  3CMA V;  1SQX H;  2G38 A;  3ABU A;  3CPW U;  1GK9 A;  3SUQ A;  4BIO A;  2RN9 A;  3CRC A;  2W0F C;  4UVC A;  4M3W A;  4FJX A;  1X4T A;  5IJ0 A;  3A0R A;  2JJ1 G;  4C7U A;  1BHA A;  3APO A;  2IH1 C;  2V1D A;  1FXK B;  2ADP A;  5CA0 B;  1WLE A;  4FFB A;  4GAM C;  5CA1 A;  3RYC B;  2P22 C;  5L3D A;  3FX7 A;  3QNE A;  2GUZ A;  4RAI A;  2FTK A;  3ZRV A;  3LDD A;  4CS4 A;  2Y0P A;  3G80 A;  3FAV A;  4UCO A;  3ZX6 A;  3VQY A;  3E8B A;  4PDV A;  1K4D C;  4M45 A;  4MTX A;  1XVE E;  3AG4 C;  2PZS A;  1ORQ C;  3J2P A;  3RYH A;  1QCE A;  3A2F A;  5FNV B;  5LHH A;  1FD9 A;  3OEE G;  3B4S A;  2ADQ B;  3QNN A;  5D5Q A;  2YB5 A;  1BL8 A;  4X66 O;  4DV1 B;  3LD8 A;  1L8D A;  4EPH A;  5ITZ A;  1VQO V;  4D7T A;  1NBM G;  3JAK B;  4JI6 O;  4DV1 O;  2LQT A;  1HDJ A;  3SJA C;  5BMV A;  1PL4 A;  3W7S A;  3G71 V;  2DYR B;  4OXS A;  1HNX B;  4IYI A;  1HNX O;  4WFH A;  3JD2 A;  2HP8 A;  5H9C A;  3L8B A;  2JEU A;  2UXN A;  1EN4 A;  4ZOL A;  4ZBM A;  1AP6 A;  2QWO B;  4ZI7 B;  3ABK B;  4JRQ A;  2HFE C;  5B1O A;  1FZ1 E;  5LMN B;  3AG2 B;  1Y74 B;  5JQG A;  3CCU V;  3HKC B;  1KKC A;  1ZX3 A;  3J81 N;  4IHJ A;  5IY5 C;  5LMN O;  4JI1 B;  4CC6 A;  2IJK A;  1SA0 B;  4BAY A;  1CP9 A;  4TQF A;  4JI1 O;  1SQQ H;  1VF6 C;  5KAF Z;  2CTR A;  3I55 V;  2R9R B;  4LF5 B;  4O2B A;  3IGA C;  2WSS G;  4JTD B;  2WLJ A;  4LFC B;  4WFA V;  3HR0 A;  4IIJ B;  1Q43 A;  4Z1V A;  3JAS A;  3SUN A;  4P2Z A;  4LFC O;  3H01 A;  4DTO A;  1ROP A;  4F6R B;  2LF3 A;  4JI5 B;  1Q7Y W;  2R9A A;  4U3F H;  4JI5 O;  3ABL B;  2JJ2 G;  3CRR A;  1YTF B;  1XQ8 A;  1I94 B;  3LDC A;  5B1A C;  4GZR B;  1COW G;  1XHX A;  1I94 O;  4PD4 F;  2EIN C;  3WG7 B;  3GVM A;  4X9Q A;  3J80 N;  3OAA G;  4B08 A;  4KHP B;  1P4R A;  1DGS A;  1FXX A;  1JJO A;  1FZ2 E;  4KHP O;  1LUW A;  4HCB A;  2ZT9 B;  1IBM B;  1XL6 A;  4ZHQ A;  4YXW G;  2KB1 A;  1XVG E;  1FZI E;  1EFR G;  1IBM O;  1F4M A;  4M3Y A;  4B7E A;  1SES A;  1NVP D;  2ZXW C;  4MVS A;  4HYO A;  4I55 A;  3JCU Z;  1AI4 A;  1E1Q G;  1OCO C;  5IBK B;  3F7Y C;  3HKB A;  2XOK G;  3ZHR A;  4K0K B;  3SR2 C;  2PF4 E;  5LOV A;  2PYL A;  3SUP A;  1AIL A;  1WB7 A;  4DV7 B;  4K0K O;  1T5E A;  5J9P C;  4X1I B;  2ZNJ A;  1XVF E;  4MTO A;  2QM8 A;  4DV7 O;  3SPY A;  3OR7 C;  2H8P C;  1DK1 A;  3MHH C;  1MOF A;  1P49 A;  4X1Y A;  4PHZ A;  2ATK C;  4ADN A;  2JHC A;  5C8Y A;  1FS0 G;  2MMB A;  3BVO A;  4YJ3 A;  1FPO A;  3LZI A;  1I08 A;  1XEQ A;  3ASO C;  4DK0 A;  2LF6 A;  4PDL A;  3CP1 A;  3C6P B;  2A7W A;  2RQ6 A;  2JPN A;  4KI6 A;  3NXS A;  4I0X A;  1O9H A;  3S3W A;  4KHQ A;  3ZMZ A;  2YEV A;  2ZIN A;  3W7X A;  4FLU A;  2OVQ B;  1ZAU A;  1OCZ B;  2WWW A;  1MA1 A;  2P6J A;  4Q20 A;  2GV9 A;  3O9O A;  4FK2 A;  1GM7 A;  4RUE A;  4FLW A;  3RMB A;  5LHG A;  4J41 A;  2Y4T A;  4JAS A;  1VF6 A;  4UV8 A;  3Q4H A;  1NU1 H;  3G67 A;  2Q0O C;  1ENV A;  2AHY A;  3LUT B;  3U10 A;  2OCC C;  2BTO A;  3CYO A;  4MTG A;  1M9N A;  1R1B A;  1KMI Z;  4DYL A;  1JW2 A;  1SQV H;  2QEX V;  4DR4 O;  4LWS A;  2BSK A;  2AW9 A;  5IYZ A;  5JVD A;  5GON A;  4UCU A;  4MVO A;  5E79 Z;  3WB1 A;  5EZY A;  3JAT B;  4E4B A;  3A8T A;  2GDS A;  3CHX A;  2CGO A;  2DQ3 A;  1FKA O;  4HNA B;  3HGK E;  3BRC A;  4I9L A;  1QQC A;  1PM9 A;  5LP6 B;  4UB6 Z;  2EIL C;  3TAF A;  1MZE A;  5IDJ A;  4E3S A;  2JDI G;  5IT9 N;  3JYC A;  1JR9 A;  3TCU A;  5GTH Z;  1K7D A;  3OW2 U;  3L70 H;  2W6I G;  3K57 A;  4JAV A;  2LW7 A;  3SPC A;  1Y76 A;  3H9V A;  2XAS A;  3UT5 A;  1US6 A;  5EYP A;  1TA8 A;  1NKD A;  4FFK A;  3SYQ A;  4F6E A;  3E35 A;  4PA9 A;  3P3N A;  1RPO A;  2B1G A;  3ZRS A;  1SRY A;  1XIL A;  2D2C B;  2MK3 A;  5LGN A;  2QGN A;  2PI5 A;  2RMK B;  2UUC B;  3ZRW A;  1SQG A;  2P7T C;  1OZ0 A;  5IYD O;  2IH3 C;  3C94 A;  1KP2 A;  2UUC O;  1WNS A;  2GSM B;  3KCY A;  5LYJ A;  2KG7 B;  4H44 B;  1R6T A;  3T4Z A;  3TK1 A;  4P30 A;  3LSQ A;  4DUY B;  5KHG A;  3VQX A;  2BE3 A;  2KKW A;  3W7U A;  4DUY O;  3CCL V;  3T1H B;  1H2N A;  4KHN A;  1RSO A;  1A32 A;  2EIJ C;  4R7C A;  2EIN B;  5L3C A;  2QA4 V;  3TAE A;  3T1H O;  4ADO A;  1XU5 E;  2GBO A;  1FZ5 E;  1ZL8 A;  3UCS C;  1D5N A;  1WAJ A;  2JVD A;  1FXK C;  1ZWI C;  2ZIO A;  2A79 B;  2VJ4 A;  3B8M A;  2LGW A;  2CTW A;  1SQP H;  1YIJ V;  4M3R A;  4X65 B;  2UU9 B;  1N1C A;  3G4S V;  4NXM B;  2ODM A;  3CJH B;  3GWO A;  2UU9 O;  1VAR A;  4FJG A;  1ZUQ A;  4NXM O;  2ZXW B;  4PI2 A;  2X0L A;  3CCM V;  4DR3 B;  4DR6 B;  4JZG A;  3HGL A;  3SJC C;  3L73 H;  4DR3 O;  5IWA B;  1VQP V;  4DU4 A;  2ZD9 A;  2WPD G;  2QWP B;  1WPX A;  5IWA O;  4PV1 B;  5B5E Z;  5IRE A;  4DTJ A;  2UUB B;  3DC5 A;  2YIB A;  4FVM A;  2WLI A;  4O4J A;  4PA3 A;  2OVP B;  2H3O A;  4DV3 B;  2UUB O;  3U11 A;  5FLX N;  1B3Q A;  4FZ0 A;  4DV0 B;  2DYR C;  2YID A;  1MTY G;  3OM3 B;  4O4I B;  3RW0 A;  4DV3 O;  1I0H A;  2JGD B;  5J2U B;  4DV0 O;  2FW3 A;  4K35 A;  1HW7 A;  2CDY A;  5KX5 B;  1Y66 A;  4MVM A;  2Q68 A;  3D3Q A;  3LSS A;  4YY3 B;  3AEI A;  5IJ9 A;  1Y4M A;  1XVD E;  5K1X A;  3C6N B;  3FD9 A;  4GUN A;  2YIC A;  2HHH B;  4GX0 A;  3BFR A;  3HP9 A;  4RQE A;  3JAR B;  4X88 A;  4NXN B;  3ABK C;  1RFY A;  4L87 A;  4H0L B;  2HHH O;  2N74 A;  4NXN O;  3P32 A;  1S76 D;  4QPK A;  2DN9 A;  5C93 A;  5L3G A;  1Y6X A;  3RYF A;  4ABM A;  5LA6 A;  1YF2 A;  2PUS A;  2E74 B;  2Y48 A;  5FPO A;  3OEH G;  4IYH A;  3IJ4 A;  4LF7 B;  4E2L A;  3SJB C;  4NTX A;  4TOI A;  3OMI B;  1GTO A;  4WBN B;  4AI8 A;  5IZ7 A;  5HFM A;  2ZIM A;  3K5N A;  1YDX A;  2P5G A;  1M1K W;  2FML A;  5LXT B;  3SYP A;  3H1H H;  4HCC A;  4EB6 A;  2UUA B;  4MW8 A;  4JPR A;  2YSU B;  4UVA A;  2R70 A;  2UUA O;  2RCV A;  2RDC A;  3LNM B;  5EC2 C;  4LF4 B;  2YI9 A;  3ML0 A;  4HZ3 A;  2F4V B;  4FM0 A;  2P67 A;  1Q9Y A;  2DQ0 A;  4FM2 A;  4DV6 O;  4LF4 O;  2UXC B;  4CZZ A;  2F4V O;  1V9P A;  3ABL C;  3CRQ A;  3LDB A;  3SCX A;  1JMK C;  3CQ8 A;  2UXC O;  3SPZ A;  3ZMT A;  4B3S B;  1WA8 B;  5D5P A;  4X20 B;  5CBG A;  1YJN V;  3WG7 C;  4DTM A;  4B3S O;  3RGB A;  3JAL B;  1KBH A;  4FK5 C;  1WP7 A;  3RYC A;  1H8E G;  1Q8I A;  3C6O B;  4PDM A;  5EIB D;  4M3Z A;  2AHZ A;  1XUQ A;  4NVP A;  4DV4 B;  2OCH A;  3QVN A;  1R6N A;  5LL6 Y;  2P4V A;  1FYZ E;  1GM9 A;  3N2G B;  2E31 A;  3OE7 G;  1EN6 A;  2P1P B;  3SQ1 A;  4JI7 B;  3RVZ A;  1NR1 A;  2LGQ A;  3UO2 A;  1EZJ A;  1Z5W A;  2JQT A;  4KXR A;  3T1C A;  4JI7 O;  4M3U A;  1OCC B;  3JCZ A;  3KCX A;  4FK0 A;  2EIJ B;  3R66 A;  1HNW B;  3SPG A;  1K97 A;  3E83 A;  1B6Q A;  2VWJ A;  1GAX A;  1I7F A;  1NZ6 A;  2EIM C;  4TV8 A;  4OX9 O;  1HNW O;  3JAK A;  4J7Z A;  2QR4 A;  3N2K B;  1WAZ A;  2EZO A;  1G8M A;  1PL0 A;  4F4L A;  2K9P A;  3A0H Z;  1TVK B;  3F5T A;  1Z5V A;  2WLK A;  4N23 A;  4XBF A;  1X59 A;  1BQZ A;  1KU9 A;  5L3E A;  1N8R W;  3TXS A;  1BT8 A;  1L1F A;  2X6B A;  2QWR B;  3ETE A;  4X66 B;  4FJ9 A;  1Y74 A;  1XL3 C;  1KUQ A;  3HKC A;  2DJV A;  1OCZ C;  4RUF A;  4DV5 O;  1H2L A;  4JI6 B;  3W7T A;  4K3A A;  2YIB D;  2YI8 A;  4UFZ A;  1KP3 A;  1OJH A;  1SA0 A;  1XOU A;  4KP4 A;  3TJT A;  2ZR3 A;  3DC6 A;  1JX9 A;  4IT5 A;  3OGK B;  3UIQ A;  4KUM A;  2AXT Z;  4LNU B;  2BTQ B;  2WLM A;  4J9Z B;  4NB5 A;  1K9M W;  1H38 A;  4M42 A;  2IU0 A;  3TXQ A;  1YVW A;  2ETN A;  1VQ8 V;  4AKH A;  4R6Z A;  4J11 A;  1NVP B;  3CC7 V;  2B1E A;  2FYU H;  1WPB A;  4LP8 A;  2CH7 A;  4TSF G;  4UCV A;  2NN4 A;  5JCO A;  4JTC B;  1MHZ G;  3L74 H;  3ZHQ A;  1J5E B;  3A0B Z;  2GUZ B;  4F6R A;  3KKY A;  4DW0 A;  4ICG C;  3NCI A;  1XL4 A;  5LP6 C;  2V7Q G;  2PI4 A;  1MAB G;  1J5E O;  4K8Z A;  4M3X A;  1NH2 D;  3TAG A;  1JCH A;  4KFM A;  4B7K A;  4GKK B;  3CD6 V;  4DTS A;  3V7D B;  3K9A A;  4UXN A;  1Q6U A;  3SNN A;  1MMM A;  1MNG A;  4GX2 A;  4GKK O;  5A2Q N;  5GTI Z;  2QSA A;  1N0N A;  4LF8 B;  2ILM A;  1K34 A;  1BE3 H;  4QPJ A;  1M93 A;  2YS8 A;  1D5A A;  3E86 A;  4FJJ A;  1PV0 A;  1KB9 F;  3QO5 A;  4LF8 O;  5CBH A;  3CCQ V;  2KQX A;  4EKW A;  4JYA B;  4PA7 A;  3K59 A;  3WFV A;  4JYA O;  4X1K B;  1R3J C;  3B2E E;  1LUV A;  3OT7 A;  4FLY A;  1K8A W;  3D8C A;  1G6U A;  3B40 A;  1F51 A;  4OGQ B;  4BR6 A;  2F43 G;  1FYJ A;  1SC5 B;  2A0L A;  3PJS K;  3K03 A;  3T1Y O;  3K0G A;  4FJ8 A;  3U0Z A;  3D3I A;  2YUA A;  1AB3 A;  3APQ A;  4DTN A;  3JD1 A;  4UCR A;  5LHI A;  4FLZ A;  3W7W A;  5KHK A;  3G6E V;  4DR2 O;  1XVC E;  3DXR A;  3E22 A;  4DR1 B;  2F95 B;  1XMF E;  3E4Y A;  3MDS A;  3RMC A;  5IYB O;  4DR1 O;  1ARO P;  1Q86 W;  1KC8 W;  2PFT A;  4YIO A;  1G4Y B;  4J2B A;  4O4H B;  2DW4 A;  3SPI A;  2ZR2 A;  1F7Y A;  4AKG A;  3RN4 A;  1AJN A;  1N4C A;  4KHY A;  3S3X A;  4I7Z B;  4NTW A;  1YJ9 V;  4L8J A;  3JAM N;  2QWN B;  4RNG A;  5JH7 A;  3UQ8 A;  4NR1 A;  1N33 O;  2Y69 B;  4Z1M G;  3AG3 C;  5K1P A;  3RWU A;  2EIM B;  5EIB C;  1W59 A;  1AR4 A;  4O2A B;  4N21 A;  3JAW A;  2HLD G;  3JAS B;  1QLN A;  3O65 A;  2OT5 A;  2F66 C;  3WSO A;  3DGE A;  1SQB H;  3ZMV A;  3EXA A;  4Q6G A;  3STZ C;  4FJ5 A;  3NHG A;  2DYS B;  3C3T A;  1AVM A;  3CXC U;  4U3J A;  2WAM A;  1YEW A;  3RYI B;  1EN5 A;  4GYC B;  5CB4 B;  5JJE B;  3JAT A;  1TUB B;  1M57 B;  1P7B A;  2XTA A;  3ABT A;  2EJR A;  5LGT A;  2Z3Y A;  4ICG A;  1R3I C;  4CBC A;  2Z5U A;  2HD0 A;  1I5Y A;  3CE2 A;  2MZW B;  4ZHQ B;  1F23 A;  5H6R A;  1MMO G;  3QF7 A;  4AQY B;  1JPX A;  1TAE A;  2Q4P A;  4JAU A;  1JJ2 U;  4CS3 A;  3AG1 B;  2LP7 A;  4CH5 A;  4AQY O;  4DR4 B;  2E32 A;  4FJI A;  4EFE A;  3CSX A;  4NKG B;  3CB2 A;  1XRE A;  5LOV B;  2Q7G A;  3FYI B;  3CCJ V;  4MSW C;  3SQ4 A;  1EZV H;  1HNZ O;  3OMN B;  1KD1 W;  4I50 A;  2QXF A;  1XMQ B;  2KSD A;  4Z2W A;  5KUK A;  1XHZ A;  2FB5 A;  4X1Y B;  3THO A;  3CCE V;  2QM4 A;  4LC1 A;  1XMQ O;  3HKD A;  2LW1 A;  1TGO A;  5DN6 G;  3UM7 A;  4JYY A;  3ZN1 A;  2ZDI C;  3LNN A;  3FKS G;  3OGL B;  1U97 A;  4WFB V;  1LR1 A;  1FZ0 E;  3GWK C;  3OMA B;  3RMD A;  1GO3 F;  3CRM A;  4J7J A;  4TWK A;  3R65 A;  1S77 D;  3SYA A;  3L71 H;  2ZCE A;  5KUM A;  2D3O W;  4CC5 A;  1H2G A;  4JI4 B;  1BSM A;  2YEV B;  5JJJ B;  1K5S A;  1MSW D;  2Y4U A;  2PGG A;  1H2K A;  3FB8 C;  1N36 B;  2B1I A;  4LFB O;  4JI4 O;  1S5L Z;  3QTC A;  1BMF G;  1Q6I A;  2HVK C;  1N36 O;  1YSC A;  2DWE C;  2RNB A;  3TGU H;  4JI2 B;  2JS5 A;  2JHA A;  4IGG A;  3BY6 A;  1R3K C;  2P1N B;  1K33 A;  4JI2 O;  3CJH A;  2M6Y A;  3Q4H B;  4LBE C;  2Q8V A;  1NS1 A;  4M3T A;  4AI6 A;  4GCZ A;  3AK3 A;  2DWD C;  1H2M A;  1EM1 A;  1V55 C;  3AK2 A;  2K5S A;  5B1B B;  2OZS A;  5IYZ B;  5JVD B;  1OCC C;  4O4L B;  1GN3 A;  3UO3 A;  1AR5 A;  4P9P A;  3H1L H;  4EEQ A;  1CXZ B;  2B9Z A;  4WFE A;  4EFB A;  1DTO A;  3J7A U;  3L2O B;  3SUO A;  4JAA A;  2WLN A;  3QO8 A;  4ASU G;  3CRA A;  3SPH A;  2EIK B;  4FM1 A;  1Q5O A;  1FZH E;  3SI6 A;  3GB7 C;  4H33 A;  3I5D A;  4PA4 A;  4MT8 A;  1FS1 A;  2IJJ A;  2C2A A;  4B3R B;  1XU3 E;  1RPR A;  3UKM A;  4TV9 B;  1W0K G;  1Q81 W;  4I4T B;  4B3R O;  2P1O B;  2H4T A;  1JA8 A;  1Y76 B;  3UT5 B;  4YJ2 B;  1L0L H;  2JIZ G;  2UXB B;  4A5U B;  2HEP A;  3L72 H;  3BHP A;  2UXB O;  5CMU A;  3BA9 A;  3AG3 B;  3H1K H;  1NTK H;  5HFL A;  4RG8 A;  1PNK A;  1SET A;  4BIZ A;  5J2T A;  3BEH A;  1IBL B;  2IU3 A;  1K4C C;  1YCI A;  2OIG A;  3ZRW B;  1BHB A;  1JFF A;  2FKX A;  1IBL O;  1L0N H;  1SQF A;  3CCS V;  3CXH F;  3JD4 A;  2IJH A;  4UVB A;  1PNM A;  1V54 B;  1M5I A;  3OTF A;  5E1A C;  1QR9 A;  3BA8 A;  3ABM C;  1KEC A;  1UJW B;  4WBN A;  2NLJ C;  1XI1 A;  3MHS C;  3M7M X;  2W0X A;  1VP7 A;  3CC4 V;  3C95 A;  3IC9 A;  3D36 C;  4DRX A;  1FZ9 E;  2O57 A;  2JH8 A;  4ZKI A;  4JV5 O;  1U96 A;  5H6Q A;  4FJL A;  3ZMU A;  3I56 V;  4MVR A;  5KHH A;  4EYW A;  4PDR A;  2YDE A;  1AI7 A;  4AHC A;  4JI0 B;  4LR3 A;  3RMA A;  2N05 A;  1GH6 A;  1KKD A;  2OIE A;  1AI5 A;  1NTM H;  1GM8 A;  1WA8 A;  4JI0 O;  4X20 A;  1SS3 A;  5EC1 C;  2MW2 B;  3JAL A;  2XAG A;  4BW9 A;  3MAQ A;  4HBN A;  4G27 B;  5KA5 A;  2Q5Z A;  2W6J G;  1QU7 A;  2LFS A;  3K9S A;  1PP9 H;  3RVY A;  3B77 A;  4X62 O;  3H1J H;  1K5Q A;  1FZ4 E;  1UPG A;  3PN1 A;  1IH7 A;  4KHW A;  2PFV A;  3FFQ A;  4CH3 A;  2JEX A;  4J2D A;  4O4J B;  2WLI B;  4DK1 A;  4JF3 A;  4LFA B;  3QO7 A;  2F23 A;  4DUZ B;  2OZM A;  4DV6 B;  1SKV A;  2Q67 A;  5KA6 A;  4LFA O;  1S5J A;  4DV2 B;  4W4K A;  3HKE B;  1FFX B;  2H94 A;  4DUZ O;  3K06 A;  2ATQ A;  3OUS A;  3KD5 E;  4DV2 O;  2JRI A;  4J2E A;  3CWB H;  1ZTE A;  1HR0 B;  4RL5 A;  3IFX A;  1E79 G;  2XAH A;  1G1X B;  4G2K A;  1Y67 A;  1O9G A;  1HR0 O;  1FXK A;  1F4N A;  4JI8 B;  1IUR A;  3N2K A;  5CA0 A;  3TET A;  1M90 W;  4QNH B;  1KYO F;  4JI8 O;  2ITD C;  4BWA A;  5B3S C;  1OCR C;  4YHH B;  1FJG B;  4TUY B;  1B06 A;  3CS5 A;  3OGC C;  4UCS A;  4PI0 A;  3VQV A;  3RYF B;  1IVS A;  3ASN C;  4YHH O;  1TVK A;  3L75 H;  1FJG O;  2OTJ V;  1NH2 B;  1AP5 A;  3F7V C;  3K08 A;  2X6C A;  2GHY A;  4FJC C;  2YXL A;  3OD4 A;  2YIA A;  4QJF B;  2CE4 A;  2XHB A;  5EBW C;  4QNC A;  3E8G A;  2X7R B;  1LDK E;  1Q9X A;  1V55 B;  5BR8 B;  3E8H A;  5FNV A;  2ZE5 A;  3SYC A;  5BR8 O;  3WU2 Z;  1XMO B;  2Y0I A;  5EBL C;  4OX9 B;  2Y69 C;  4H37 A;  3MKS B;  2XUM A;  3BCC H;  1XMO O;  2R72 A;  3H1I H;  1FZ3 E;  3SGI A;  3CC2 V;  1SZT A;  1ZSP A;  2BTQ A;  2EZP A;  2QM7 A;  4QE7 A;  3QEP A;  4KHU A;  2WA3 A;  1AR1 B;  2GTA A;  4DTX A;  2DYS C;  2VS0 A;  1FXV A;  2IM9 A;  3ZMS A;  3ZHT A;  1EBO A;  2WLL B;  3ZN0 A;  4EP9 A;  3D36 A;  1NT2 B;  3SJQ C;  4FLX A;  1OHH G;  2N04 A;  1M56 B;  1PKX A;  1NR7 A;  1VIB A;  1M57 C;  4ZI7 A;  1DF4 A;  4DV5 B;  2QWQ B;  3N1E A;  4FJM A;  3BPZ A;  2A06 H;  1NJI W;  5DM6 V;  5LGU A;  1FFT B;  5IE9 A;  4I9W A;  4X89 A;  5KMG B;  4I9Q A;  5JWP A;  2E5L B;  2IW5 A;  2B8I A;  2DEB A;  2Q7H A;  2EX3 A;  2E5L O;  3AG1 C;  3ABM B;  2DE0 X;  2CGN A;  1CLQ A;  4U7N A;  4D6T H;  1Q3E A;  1YI2 V;  4XDK A;  4AKI A;  2WLH A;  4TV8 B;  4X1K A;  5IJ0 B;  2QDO A;  1N0J A;  4UV9 A;  2FL4 A;  4IIJ A;  1DF5 A;  3K04 A;  4FFB B;  3X2Q B;  5CA1 B;  1I5X A;  1THZ A;  5BZB A;  4BIU A;  4FLT A;  3QES A;  1IX9 A;  2JH9 A;  3ZBH A;  1VQ4 V;  2L35 A;  1QVG U;  3QG5 A;  2PY5 A;  3ZCC A;  4JYC A;  3FAV B;  1QLE B;  1HP8 A;  3RT3 C;  1WN7 A;  4LCU C;  2PYJ A;  3SYO A;  3RYH B;  2ITC C;  4X5M A;  1W0J G;  1GRJ A;  3K79 A;  3QEX A;  2F93 B;  4MW3 A;  5H5N A;  2AGA A;  3NGI A;  1VEW A;  4K8X A;  3CX5 F;  2LFR A;  2JK5 C;  1XNR B;  2GTS A;  2L6L A;  1VQ6 V;  4DXW A;  2YXY A;  5ITZ B;  2DMX A;  1XNR O;  3QNO A;  5TIS Z;  1IG9 A;  3OR6 C;  4O4H A;  1P84 F;  4WFF A;  4DTP A;  1URF A;  2AZ0 A;  4E4E A;  5BMV B;  4FJN A;  3BAA A;  3KZI Z;  2HR3 A;  4D7S A;  3T1Y B;  4DTR A;  4DR7 B;  3S9H A;  5CN0 A;  2Q9L A;  2QTO A;  2AZ2 A;  2P5O A;  2CH7 B;  4UUJ C;  1RM1 B;  4FPP A;  1CPY A;  3T4D A;  3OTO B;  4DR7 O;  4GX1 A;  5B1B C;  2DTU A;  1K3E A;  4DR2 B;  1HWY A;  4LF5 O;  3J27 A;  4KI4 A;  4O2A A;  3OTO O;  3WB0 A;  3N1B A;  4ZOL B;  4X1I A;  1IXB A;  2CAZ C;  4AIL C;  2A9H A;  5B3S B;  1OCR B;  2F1M A;  5JQG B;  3EFF K;  3CCR V;  1K73 W;  2EIK C;  4IHJ B;  2BOB C;  4DU3 A;  1VQM V;  3ASN B;  4FJH A;  4BW5 A;  1QHT A;  4B3M B;  1MSD A;  1Z2G A;  2FYO A;  4I6J B;  3RYI A;  4B3M O;  3JSL A;  3RWR D;  5CB4 A;  4GKJ B;  1QNM A;  4J42 A;  1WP8 A;  1TUB A;  3MD0 A;  3OUF A;  3K5L A;  3OGM B;  4QND A;  3ZHU A;  1FZ8 E;  4GKJ O;  2UXD B;  4QE9 A;  1N33 B;  1PNL A;  4O2B B;  2UXD O;  2Q7E A;  2HG5 C;  1PD3 A;  2B7M A;  3QER A;  4LF9 B;  4CH4 A;  2P90 A;  1XMH E;  1GN4 A;  3E4W A;  2LJ2 A;  3K3W A;  1OV9 A;  3K5M A;  2OWO A;  4LF9 O;  4KHS A;  4CH6 A;  2DY4 A;  1NEX B;  2ZE6 A;  1V54 C;  4QGP A;  4B3T B;  4DTU A;  3SPJ A;  3EHB B;  2QKS A;  1S5H C;  1MG1 A;  5JJN B;  5DEC A;  1IXM A;  4B3T O;  3IC7 A;  2ZE8 A;  1VMG A;  2XAF A;  3SVI A;  1XMG E;  1R6K A;  4FIP C;  3NE6 A;  3CFP A;  1NQT A;  3DXR B;  3L9D A;  3E22 B;  2QJ1 A;  4WCE V;  3RFR A;  4IL6 Z;  1BCC H;  1J95 A;  4HNA A;  4X64 B;  2X6A A;  2HJD A;  4JI3 B;  5LP6 A;  1S72 V;  2PTM A;  2RKH A;  1VQK V;  5L3B A;  4X64 O;  2JHP A;  1SER A;  4JI3 O;  2V4D A;  5DED A;  3E2E A;  3AG4 B;  4FK4 A;  2CTP A;  5H37 A;  1JVM A;  3WB2 A;  3CME V;  5LMU B;  2BOC C;  3P3P A;  1N32 B;  3ZHV A;  4I55 B;  5JH7 B;  1RP3 B;  4H13 B;  5LMU O;  1N32 O;  3HKB B;  3L1N A;  1IDS A;  2EBO A;  1HNZ B;  3TL8 B;  3VBB A;  5KHI A;  3JAW B;  4JZ2 A;  2B5U A;  3TJY A;  3VOU A;  1P22 A;  2XAQ A;  4GLX A;  3E89 A;  3KD1 E;  2E76 B;  2VQE B;  2YXH A;  3K0D A;  2ZE7 A;  2JGU A;  1YTF D;  2KG7 A;  4J2A A;  2LO1 A;  1YIT V;  2WA4 A;  4M41 A;  5C8Y B;  5FPR A;  4DO2 A;  4U3J B;  1FAF A;  2VQE O;  4JYB A;  4YJ3 B;  3L0M A;  4J7K A;  4O4L A;  4ZIB A;  5AG2 A;  2RJZ A;  1VQL V;  3T2M A;  4R50 A;  3BAB A;  3QEW A;  3LDE A;  3ETD A;  4FJ7 A;  4I0X B;  2K1E A;  4LFB B;  2QE7 G;  2E3C A;  4I5S A;  1GKF A;  5IY5 B;  1FZ6 E;  4GT1 A;  1CEZ A;  3ZED A;  2JS3 A;  3JD3 A;  4DU1 A;  1KQS U;  5F2V O;  3N27 A;  1QBZ A;  3LDS A;  4MVU A;  4TV9 A;  3ZHS A;  4I4T A;  3SJJ A;  2OTL V;  1BZK A;  2ARH A;  4TT3 G;  4YJ2 A;  2VJ5 A;  2ZQM A;  4HAM A;  4TQD A;  2QKA A;  3K58 A;  2P1M B;  3LSU A;  4MVZ A;  1H2S B;  4LWS B;  2BSK B;  2CK3 G;  4DW1 A;  4RWU A;  5GON B;  3HL8 A;  1JQ0 A;  4UCT A;  1QR8 A;  3JSN A;  1K92 A;  2CUG A;  5EZY B;  4I50 B;  2Q69 A;  3FYE B;  5BY1 A;  3HPL C;  3FB7 C;  4U7O A;  4FJK A;  5B1N A;  1VQ7 V;  3K5O A;  4J9Y B;  3HKD B;  4X5N A;  2VWK A;  4FZ1 A;  3B09 A;  3AG7 A;  1AJP A;  5B1A B;  1VQN V;  5KLV H;  3ZS8 C;  4XDJ A;  1AI6 A;  2YC0 A;  4O4I A;  1UFI A;  2Q0A A;  1XBL A;  2JGD A;  5J2U A;  3C90 A;  1GMG A;  2NR5 A;  5KX5 A;  4RO2 A;  2RCU A;  1GN2 A;  3CCV V;  1SF9 A;  5EYP B;  4PEL A;  3QET A;  3CFO A;  5IYC O;  1M56 C;  2VIX A;  4UB8 Z;  2XND G;  3JAR A;  5H2F Z;  2OVR B;  1IBK B;  3QEI A;  1BQ0 A;  3CFR A;  2E75 B;  1VQ5 V;  1IBK O;  4X65 O;  3OGI B;  3SQ2 A;  3G6B A;  2Q73 A;  4DR5 B;  5LYJ B;  2OYQ A;  4LH6 A;  1P7G A;  5GW7 A;  1OCO B;  1N34 B;  2MW2 A;  1VF7 A;  4NTY A;  2QTS A;  4DR5 O;  4JS4 A;  1XNQ B;  1W2B U;  1N34 O;  3QEV A;  4DR6 O;  4XDL A;  1RSO B;  2DOS A;  4P9O A;  1XNQ O;  1Q90 D;  5LXT A;  1TUE B;  4JTA B;  5KHJ A;  1YXB A;  1ZL8 B;  2BCC H;  4OPH A;  3M8A A;  4JV5 B;  1NI8 A;  3EVK A;  1YJW V;  1Q82 W;  3TAB A;  3OFN G;  1BGY H;  3X2Q C;  2EJ7 A;  3VQW A;  2ZDI A;  1XVB E;  4KL1 A;  3HKE A;  1FFX A;  3DSQ A;  3LZJ A;  3ASO B;  1SZX A;  4FMT A;  5CBF A;  4WF9 V;  2M7W A;  1QLE C;  2A3Q A;  3NAE A;  3F5W C;  4X8A A;  4LF6 B;  4YY3 O;  4OPA A;  2ZM6 B;  3SQ0 A;  3ZJZ A;  1B04 A;  1MHY G;  1VF5 B;  4JGS A;  4LF6 O;  4J10 A;  2HVJ C;  2ZM6 O;  1S3J A;  1Q6H A;  4TUY A;  4X62 B;  3AG2 C;  2VQF B;  1VQ9 V;  2Z0A A;  5J2T B;  4JRP A;  1S0V A;  1WB8 A;  1R73 A;  3RBZ A;  1QVF U;  1AJQ A;  4R8C A;  2VQF O;  1JFF B;  1LNQ A;  1E1R G; 
#chains in the Genus database with same CATH homology
 4J7Z A;  4RWU A;  2YS8 A;  1WJZ A;  2N04 A;  1XBL A;  1GH6 A;  2GUZ B;  2N05 A;  3UO3 A;  2CUG A;  2QWP B;  2CTR A;  3BVO A;  2QWR B;  1IUR A;  1FPO A;  2KQX A;  2GUZ A;  3UO2 A;  2M6Y A;  2CTQ A;  2PF4 E;  4J80 A;  3UCS C;  2YUA A;  2L6L A;  2CTP A;  2EJ7 A;  2QWQ B;  2Y4T A;  3APQ A;  2RKH A;  2DMX A;  3AG7 A;  2Y4U A;  2LGW A;  2CTW A;  1N4C A;  2OCH A;  4IT5 A;  1NZ6 A;  2LO1 A;  2DN9 A;  2QSA A;  3APO A;  1BQ0 A;  1BQZ A;  1HDJ A;  1FAF A;  1N1C A;  2QWO B;  2QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...