3UO3A

Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
174
structure length
174
Chain Sequence
RRFTSTFYELFPKTFPKKLPIWTIDQSRLRKEYRQLQAQHHPDMAQQGSEQSSTLNQAYHTLKDPLRRSQYMLKLLRNIDLTQEQTSNEVTTSDPQLLLKVLDIHDELSQMDDEAGVKLLEKQNKERIQDIEAQLGQCYNDKDYAAAVKLTVELKYWYNLAKAFKDWAPGKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords J-type co-chaperone JAC1, mitochondrial
publication title Interaction of j-protein co-chaperone jac1 with fe-s scaffold isu is indispensable in vivo and conserved in evolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Chaperone
total genus 64
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
A PF07743 HSCB_C HSCB C-terminal oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 3uo3A01
1.20.1280.20 Mainly Alpha Up-down Bundle Monooxygenase HscB, C-terminal domain 3uo3A02
2QWNB 4J80A 2CTPA 2DN9A 2QWQB 2CTQA 2GUZA 2Y4TA 3UCSC 3UO2A 2L6LA 2LGWA 1NZ6A 3BVOA 1IURA 2DMXA 1N4CA 3AG7A 1WJZA 2CUGA 2OCHA 2YUAA 2QWPB 2N04A 1FPOA 4J7ZA 2QWRB 2KQXA 2Y4UA 3UO3A 2YS8A 3APOA 1BQZA 2QWOB 2RKHA 2CTWA 2N05A 2CTRA 1XBLA 1BQ0A 1HDJA 3APQA 2QSAA 1FAFA 2PF4E 1GH6A 2EJ7A 2GUZB 2LO1A 4RWUA 4IT5A 1N1CA 2M6YA
chains in the Genus database with same CATH superfamily
3CSXA 4TQDA 1LUVA 4EB6A 5C8YB 2LGWA 1Q81W 3K3WA 3MAQA 1MA1A 3ZRWA 2ETNA 1KQSU 4DU1A 4J11A 2DW4A 3TAGA 1QNMA 4FM0A 4X8AA 3K04A 2FTKA 1L0NH 2Z0AA 1R6KA 4FLVA 4K0KB 2ZR3A 3E22A 4MW8A 3SPGA 4DU4A 2H3OA 4IHJB 1N1CA 4X9QA 1YITV 1IBLB 2YI9A 3DGEA 4DR4O 4DTJA 4DV1B 4TV8B 5JQGA 3OMAB 2IU0A 4I6JB 4DV0B 1FD9A 2E32A 3OAAG 3ZX6A 4DUZO 4DV4B 1FPOA 2ZKOA 1HNWB 3AK3A 3SI6A 3AK1A 4EEQA 1JFFA 2DYRB 4YJ2A 2L35A 4UVCA 1NQTA 2M7WA 4MTXA 1FXVA 1SC5B 2JS3A 5D5QA 1YHQV 1EZJA 1I5YA 4DXWA 3C3SA 2P6JA 4U7NA 4I4TB 4OGQB 4X20A 4UCRA 3EFFK 5JCOC 3VQWA 2ZM6B 2XOKG 2HFEC 1XNRB 4PDVA 2P4VA 4JI0B 1Q7YW 4B3MB 3H1IH 2KKWA 1ZAUA 1YIJV 4O4HA 3JD2A 4JI2O 1IXBA 1AILA 4JAVA 1RPOA 5FNVB 2JPNA 1M9NA 3FB7C 2L6LA 1M57B 2A79B 4CH6A 1PNLA 1G8MA 3K0GA 1I7FA 1JPXA 2HHHB 3CJHB 4DK0A 4R8CA 1NR1A 1YJ9V 3S3XA 3JALA 2JGDB 3CYOA 3HKCA 4QE7A 3THOA 4X65B 2W6JG 3CXCU 4I9QA 5GW7A 5EBMC 1BZKA 3CFPA 4LF5O 2V1DA 5CBFA 1SESA 2F1MA 3W7TA 4U3JA 1I94B 3H1LH 1E79G 3GWOA 5J9PC 3L9DA 3SVIA 2YUAA 4D7TA 3D8CA 3K57A 2MW2B 1R73A 2QWRB 1AROP 1MABG 4DV2O 1QCEA 5GONB 1CLQA 1XQ8A 2YSUB 1KKCA 4J9ZB 3FAVB 4JI4O 4RL5A 4E4EA 4OPHA 5E1AC 3L74H 3CCEV 2O57A 1FFTB 3P3PA 3KG2A 4TT3G 3TJYA 1HNZO 2DWDC 3K5MA 1YEWA 5L3BA 4LNUA 4JI3O 4YXWG 5KHHA 2HKOA 3E22B 1XOUA 1RM1B 4E4BA 5B5EZ 4DV7O 2CH7B 3K58A 2YXYA 3WB1A 5JQGB 4JGSA 1KP2A 4RWUA 3RMAA 3OGIB 3ZN0A 4ZI7A 4FK5C 4R50A 2OYQA 2GUZA 3HR0A 3LD8A 4FJ5A 3WG7B 4K8XA 1HNXO 1Q9YA 4J10A 2Y4UA 4LFCO 1Q6IA 1XL6A 3B8MA 2B7MA 1JVMA 5LGUA 2B8IA 1XBLA 4KHPO 5L3FA 1WAFA 3ABLC 2UUBO 2QGNA 4FJMA 3ZHQA 2H4TA 2P67A 4FJNA 2PY5A 5IYBO 3W7UA 4KXRA 3U10A 1XU3E 4M3UA 1K7DA 2YEVB 3G67A 2GHYA 4YY3O 4J42A 2R9IA 3JYCA 2GTAA 2QEXV 3O65A 3K06A 3QETA 4FJLA 4PI2A 4LF8O 2CTWA 2PI4A 3RYHA 3ABKB 1K5SA 3SUQA 1VIBA 3TJTA 3QEPA 2PFVA 3R65A 3CCUV 1Y74A 3H1HH 1L8DA 1EZVH 2ZD9A 5DN6G 3HKDA 3WSOA 5E79Z 5J2TA 3JALB 3HL8A 1P49A 3HKCB 3ZRXA 3RVZA 4IYHA 1KBHA 4WCEV 3ZHUA 3SUPA 2Z5UA 3C6NB 2WLLA 1RSOB 3LNMB 3CRAA 3OEEG 4DTUA 2OT5A 3DSQA 2P1MB 4DU3A 1N32O 5F2VO 3CCMV 4CZZA 1GO3F 4M3XA 1KP3A 4M3ZA 3FYEB 5IZ7A 4DTXA 4F4LA 1Y6XA 2PYLA 2Q7GA 1F51A 4HAMA 4RUFA 4DR6B 5IREA 2HEPA 1FZ1E 4DR5O 3OGCC 4J2AA 2IJHA 3TCUA 2ZE8A 2BTOA 1IBMB 4MSWC 4U7OA 1FZ2E 2Q69A 4P9PA 4I5SA 2LW1A 2BE3A 4AKGA 3ZHRA 5IY5B 4DR1O 4LF7B 4LFBO 5CN0A 2Q6AA 4X1KA 2DMXA 5LYJA 3T2MA 5H6QA 1MHYG 3SYPA 4CH5A 4YHHB 5IJ9B 2NLJC 3SNNA 4W4KA 4IL6Z 5B1AC 3H1KH 2GBOA 3OMIB 2Y4TA 4HBNA 5BR8O 3A0RA 4GT1A 5KHKA 3HKEA 3H01A 3JAWA 2GSMB 3OUFA 3T1CA 2RCVA 1WP7A 4WFHA 5D5PA 4GKKO 1OCCB 2EJ7A 2DWEC 4MTFA 4JI6B 3UM7A 2UXNA 4CS2A 3CFRA 4JF3A 1S72V 3B4SA 3E89A 3MDSA 5KA5A 4DR4B 1YVWA 4FJGA 2OTLV 5B1BB 4B3SO 2Y0IA 1H2MA 3D3QA 3E8HA 1R1BA 1EBOA 1UJWB 2PUSA 2IM9A 4J2DA 4X5NA 1I5XA 5LXTA 2BSKB 2EIMC 1KC8W 3CQ8A 1JQ0A 3HKBA 1SZTA 4RG8A 4EYWA 1Y74B 1YZBA 4FZ0A 3OMNB 1Z5WA 5J2TB 5L3EA 4NXNB 4LF9O 5JJJB 3AG2C 4B3TO 4BW9A 1YSCA 2UXCO 4PDLA 4M41A 2WLNA 1B04A 3K2OA 2WLLB 3ABTA 3Q4HA 4ZKIA 5LGNA 1BQZA 4FLTA 1SQXH 1F4MA 3CMAV 1IBKB 3IC7A 2OVRB 1GH6A 1H2NA 2YIBD 4O2BB 3G71V 1MG1A 4O4JA 4TWKA 3SGIA 4O2AA 1LNQA 4UCVA 4DV5B 2CUGA 1XU5E 5JCOA 1FFXA 1SA0B 1JJOA 1XMGE 3WB0A 1XMQO 2HVJC 1N33B 1ROPA 3R66A 1HDJA 2ITCC 1MZEA 2BOBC 2KSDA 1NVPD 1TUBA 4AQYO 4HCCA 4X1KB 5LYJB 3K5LA 4LF5B 1PNKA 3ASOB 3OUSA 3G6EV 4L8JA 2JQTA 3VQXA 4FJIA 1EN4A 4UVBA 3STZC 1SQVH 2WA3A 4DV2B 4FLWA 3ETGA 4DRXA 3UQ8A 1JR9A 3CCSV 2EIKC 1NH2D 1XNQB 4JI4B 5B66Z 4CS4A 2OVPB 2B1GA 1FJGO 3FB6C 1VARA 2EINB 5LHIA 3QO7A 2PGGA 3JAWB 1HNZB 3OR7C 3I55V 1NU1H 1L0LH 4FVMA 1FZIE 1MTYG 1FYJA 2UUCB 1GN3A 3L70H 5EBLC 1XREA 2QWOB 4DV7B 2F23A 2DOSA 5B1NA 2Q67A 1PPJH 4IGGA 4NXMO 5KAIZ 2PTMA 2RMKB 1AR4A 3RYIA 1GTOA 5L3CA 1NI8A 4JRQA 2IJKA 5DEDA 5LXTB 3VOUA 5JH7B 3U11A 2JH8A 1US6A 2OIEA 3HKBB 4KHSA 1HNXB 2ILMA 3CPWU 3N2KB 4LFCB 2A9HA 4PDRA 1CP9A 3FD9A 3BFRA 1XVEE 2LO1A 2QE7G 2XAHA 2LF6A 1XDCA 2D2CB 2UU9O 3BRCA 2DE0X 3Q4HB 2ZDIC 2HJFC 1AB3A 4YY3B 5ITZA 1BHAA 2E3CA 2P1NB 4QE9A 2XAGA 2JHCA 1HP8A 4LF6B 2Z3YA 4LF8B 1FXXA 1DGSA 5LOVB 1XL3C 1AP6A 1DTOA 3APQA 5BMVA 2UXXA 2F95B 1XHZA 1S5LZ 2H94A 4O2AB 3OFNG 3SPHA 1FFXB 1E1QG 4KI4A 2Q0OC 1AP5A 1NZ6A 1W2BU 1GN4A 2JDIG 3MKSB 1H2SB 2ZR2A 3HP9A 2A0LA 1EN5A 4MS2A 2C2AA 3RT3C 1IX9A 5IYCO 4XDKA 1Q82W 5IWAB 4P30A 5JVDA 2AGAA 2DJVA 1M5IA 4YIOA 1AI4A 3E8GA 3JCUZ 1N32B 4BIZA 4B3RB 4X64O 1XVBE 3UO2A 4I0XA 1S0VA 4DRXB 2AHZA 3JCZA 3CE2A 2P5OA 3E2EA 3OT7A 4DV6O 3O9OA 3CP1A 5LP6C 1NT2B 2P1PB 4X66O 1GM7A 3CMEV 1XVDE 1YJNV 3JSLA 1IG9A 5FPRA 1FXKA 2WLIA 4A5UB 1WLEA 2YDEA 3IFXA 2JHPA 4EKWA 2YIAA 1VF6C 4BW5A 4IYIA 2R70A 4JYAO 1PL0A 3G80A 1MSDA 3B09A 4JTAB 5IYZA 3ASNC 3K5OA 1GM9A 2OIGA 3BPZA 1NR7A 2DYSC 4D6TH 3ML0A 2MK3A 3OE7G 3QEIA 2DEBA 4X62O 1B3QA 1XMHE 1PV0A 2Q9LA 2F66C 4JI8O 2ZQMA 3SPIA 4MVQA 3LZJA 3NXSA 3D3IA 3MHSC 4LWSB 2E5LO 4GKKB 4DUYO 1QR8A 4TUYA 4WFFA 1XEQA 4CC5A 1LR1A 4Q20A 3C95A 2F4VO 2EBOA 4X89A 5EYPB 3JASB 4F6RA 4CC6A 4MVMA 4AI8A 3JARB 4HZ3A 4FK4A 4UCOA 3M7MX 3SJCC 1SQQH 1J5EB 3L72H 2WLJA 3FKSG 3E35A 4JAUA 2YIBA 1R3IC 5KLVH 5LMNO 4AKHA 4DR2O 1ZWIC 1MHZG 3OGMB 3T1YB 3VQYA 4QGPA 1OZ0A 5KHIA 3J2PA 3BY6A 2UXCB 1KKDA 1WB8A 1N4CA 1V55B 4UCUA 5JVDB 2OVQB 4JYBA 1AR5A 4MVRA 1RP3B 3UT5B 1BMFG 5JJEB 3J81N 1D5NA 4DV3O 1M56B 1P7BA 2QKSA 4UVAA 3JD3A 3ZHVA 3QVNA 2Y69C 3IC9A 4KI6A 3C6OB 3DC6A 3CC4V 1WA8A 2OCHA 4Z1VA 2JEXA 3BCCH 3E86A 1FXKB 4MT8A 4BAYA 1EN6A 2PZSA 1G6UA 3ZHSA 3C3TA 4LF4O 4EB6B 1U96A 3SQ1A 4FJ9A 4EP9A 4I50A 3ZRWB 2ZINA 1NKDA 1TGOA 1KYOF 1NBMG 2ZE7A 4QIWF 1IZ3A 2K1EA 3TXQA 2P7TC 3PN1A 4PA4A 3AG4C 1EFRG 4FJCC 4FJ8A 3K59A 2BTQA 3QG5A 4PV1B 2XT9A 1Q6HA 3ZMZA 2UUAO 3CRQA 1FJGB 4E2LA 3AK2A 2JHAA 1OCZB 4FJKA 2LQTA 4NTXA 2WLMA 4JTCB 2IW5A 4PD4F 1AR1B 1ZL8A 5EC1C 1LDKE 2PFTA 1NTZH 1R3KC 4TUYB 1JJ2U 1JFFB 4YJ2B 4D7SA 2E75B 3RMBA 3C90A 4NXMB 4QPJA 3T4ZA 3B2EE 1KU9A 1UPGA 4ADNA 3ETQA 4J9YB 2DYRC 4X20B 4FLUA 3WFVA 4PA3A 2YB5A 4WFAV 4DR7O 4C7UA 5L3GA 1CPYA 1OCOB 2QTSA 1HWYA 4XBFA 4JS4A 3OW2U 2B1EA 3SCXA 4O4HB 4J41A 2AZ2A 4JV5O 2HJDA 1Y67A 4R6ZA 2VWKA 4PA7A 2ZNIA 3CXHF 2KG7A 2W0FC 2EIMB 4P2ZA 2WSSG 1QBZA 1QLEC 5BZBA 1PL4A 3CRRA 3X2QC 2F43G 3J7AU 4EPHA 1NVPB 1N0JA 5HFLA 4F6EA 1M57C 1YF2A 5CA0A 4ZBMA 4JI5O 3BHPA 4FFBA 3E83A 1GK9A 1QVFU 4W4LA 4U3JB 2E76B 1SS3A 2QKAA 4FMTA 4FFKA 4IIJA 2R72A 2ZDIA 1XMOO 4OX9O 3L1NA 2FMLA 2B5UA 3GB7C 1VEWA 5B3SC 2BOCC 4DR3B 1NH2B 2VQFB 2P90A 3W7SA 1K9MW 3AG3C 3ZIAG 3EHBB 5C93A 3E8BA 4QNCA 1AJQA 3L8BA 1BHBA 3OD4A 2IBZH 1L1FA 3CHXA 3P32A 4X64B 4LNUB 2LJ2A 1H2KA 2FW3A 3SJAC 5KX5A 1N34O 3AG1C 3N27A 1ENVA 5IDJA 4JI7B 2ZT9B 4H37A 1WAZA 3WU2Z 4X66B 1SQGA 3A0BZ 1IH7A 1H8EG 3BAAA 3SPJA 4ZI7B 4ASUG 3N1EA 2UXBB 1FS0G 3MD0A 1BL8A 4KHQA 2GUZB 1RM1C 1H2GA 1ZL8B 1D5AA 2Q73A 5J2UA 4AKIA 4JYAB 4RAIA 4UV9A 4GZRB 1K4DC 2XUMA 2XAJA 2RKHA 3WG7C 2P1OB 1GRJA 2Q7HA 5LP6A 3KD5E 1F4NA 1CEZA 1GMGA 4TV9A 2QSAA 4K0KO 1KMIZ 3LNNA 2DTUA 3KD1E 1SRYA 3ZMUA 4GAMC 2A3QA 1VF6A 4GX5A 3SJBC 2RDCA 4QPKA 2ARHA 2HG5C 2YXLA 3NE6A 4LFAO 5K1XA 2KB1A 3QNEA 3K5NA 3JD1A 3CRCA 4DUZB 4DV4O 5LHGA 2RJZA 1S5JA 3RYHB 4RO2A 4PDMA 2MZWB 4DUYB 4J2EA 2KG7B 4GX0A 2GTSA 2Q4PA 1H38A 1FZHE 2IJIA 1PNMA 3JAMN 3QERA 4X1YA 3HKDB 4AHCA 2DY4A 3QNNA 3ABKC 1MSWD 2P4KA 2XHBA 4DTOA 4O4IA 2EILB 4P9OA 2OZSA 3CD6V 5LA6A 3OTOO 4FFBB 1O9HA 4FM1A 3TETA 4M3RA 2YC0A 1SQFA 1B06A 4PELA 1TAEA 2LGQA 1VMGA 3JAKA 4O4LA 3DTUB 3S3WA 1THZA 2RQ6A 2YXHA 4JI2B 1MMMA 1Z5VA 5KMGA 4KHNA 2QWQB 1BGYH 1K4CC 4L87A 2NNUA 3K79A 4FZ1A 4M3WA 3NAEA 4CH3A 2HHHO 5HFMA 1K33A 2IH3C 1SETA 2Y0PA 4X65O 4ICGC 4WBNA 1M1KW 2R9AA 4K8ZA 3SUNA 3E8FA 2B1IA 1VQ7V 1FZ3E 4J7KA 1ZUQA 3T4DA 2CTQA 2E74B 4YIPA 3P3NA 1GKFA 1BCCH 1I94O 5B1OA 4X1IA 2CGNA 5CB4A 3B8NA 3RYFA 2ZCEA 4J7ZA 1KB9F 2EIJC 1FZ4E 2K5SA 4MVSA 5J2UB 3OGKB 1GAXA 3S9HA 4LCUC 1WN7A 1TVKA 1S3JA 3RMDA 3ZS8C 1YI2V 3HKEB 3NHGA 3BVOA 3L2OB 5LP6B 1E1RG 4JI3B 1Q86W 1BT8A 4TV9B 3C6PB 1V54B 3L71H 2AW9A 1K5QA 1Q8IA 4FJ7A 1BS3A 4LC1A 3LDCA 4WF9V 4BR6A 1ZTEA 5A9GA 1SQBH 1OCCC 2LFSA 3ICXA 1NTKH 3A8TA 3VQVA 4UB6Z 4X5MA 4PHZA 2AHYA 2ZIOA 1HR0O 3SPYA 4BIOA 2WWWA 1D2DA 3ABMC 1COWG 3NGIA 1PM9A 1F23A 5B1BC 5C8YA 1PP9H 2JEUA 3APOA 5KA6A 4GCZA 1QHTA 4X1YB 1BSMA 4KHPB 5AG2A 2CAZC 2UUBB 1O9GA 4IT5A 5LA6B 1KUQA 5LMUO 4FPPA 4DR7B 4I55A 4MVZA 4HNAA 4N23A 4IHJA 4KHYA 4DO2A 3JAKB 2HD0A 4O4LB 2QM8A 3BA9A 3BEHA 2H8PC 3LDEA 1Q3EA 4FIPC 1R3JC 2FKXA 4YJ3A 1I0HA 4JV5B 3K9AA 1VF7A 4O4JB 3PJSK 2AZ0A 4U3FH 2WLKA 3FYIB 4GYCB 2FYOA 3F7VC 5KUMA 1VQ4V 2FL4A 4NTWA 2OCCC 1VP7A 1TUBB 5EIBC 4JI5B 1VQLV 3OEHG 4I4TA 1OJHA 3TAFA 4XDJA 3ETEA 4N21A 4GKJO 3SQ4A 1G1XB 3RYFB 3A0HZ 2QJ1A 1P84F 1VQ8V 4M3TA 4FK2A 5KHGA 2NN4A 2LP7A 1ZX3A 4MVUA 2VQEO 2A7WA 5KUKA 1TVKB 3QF7A 4DR5B 2W6IG 3CS5A 3FFQA 3RFRA 3L73H 1ZLZA 3CJHA 3W7WA 2ADQB 3F5WC 1QQCA 4DW1A 2M6YA 1OCRC 2XTAA 3IGAC 3RN4A 4J80A 4DR1B 4LFBB 4LF7O 3K03A 3SYQA 4JPRA 2PI5A 1HW7A 2ZE6A 1WJZA 1XVFE 5L3DA 2BCCH 4J7JA 1XHXA 1FZ7E 5EIBD 2IU3A 3RYIB 3CX5F 3TGUH 3QEWA 1K34A 2XAFA 3CEIA 3SJQC 4KL1A 1W0JG 3JSNA 2YIDA 3FAVA 1AI7A 3AG4B 1WNSA 5BR8B 4HYOA 2VWJA 2X6CA 3AG7A 2HR3A 1P7GA 2ZXWC 1UFIA 2P5GA 3GWKC 2RN9A 1JMKC 1MMOG 1M90W 2UXDO 1G4YB 5CA3A 3L75H 4AILC 4I55B 3ZJZA 5JJNB 4HNAB 4JI6O 4K35A 5ITZB 4PJ0Z 4I9WA 1PD3A 2CH7A 4UB8Z 4LFAB 4B3SB 5GTIZ 4TQFA 4YJ3B 3ABLB 1QLNA 5BMVB 4JYCA 2R9RB 1XMFE 5CA1A 1AJPA 3TXSA 2JRIA 4JI1O 4MW3A 3H9VA 2XASA 1Q6UA 4ZIBA 1Z2GA 2QXFA 4FK0A 2VIXA 2HP8A 3K9SA 4NXNO 1YTFD 4LF9B 4B3TB 2LW7A 3OTOB 1JW2A 4DYLA 1TUEB 1W0KG 1LUWA 5CBGA 4RUEA 4I9LA 2YEVA 2N05A 1VQNV 1FZ0E 1SF9A 1VQOV 2N74A 2WAMA 1IBKO 4EFBA 1QLEB 1K73W 4FLZA 4I0XB 1S77D 4DTPA 2A06H 2QDOA 3X2QB 4X88A 5FL7G 4OPAA 1S5HC 1AI6A 4QNHB 1VQ9V 2X7RB 1FZ5E 3QO5A 4DV5O 3OTFA 2QWPB 4NVPA 3CFOA 1XMQB 1N33O 2WLIB 3LZIA 2XAQA 4FLXA 2PF4E 3DXRA 3J80N 4Z1MG 1B6QA 1OHHG 4AQYB 3LSUA 3I5DA 5B3SB 2CDYA 2Q68A 5IYZB 1RSOA 1M4UA 3AG3B 1YJWV 3T1HO 2IJJA 1P4RA 3CCVV 1SZXA 3QESA 3RYCA 4ADOA 4NKGB 3SR2C 2DQ3A 2V7QG 1XNQO 3WB2A 3TK1A 3AG1B 3ZMVA 4ICGA 3AEIA 5FPOA 4ZHQA 3JD4A 2AXTZ 3TL8B 3TABA 4FJHA 2VJ5A 4JZ2A 2JK5C 1WAJA 1IURA 1XVCE 2V4DA 5EK0A 2ODMA 3ZMSA 4GLXA 2UUCO 3FB8C 2D3OW 3LDDA 1NTMH 4PA9A 2KQXA 3TAEA 4JAAA 3EVKA 4GUNA 2CTRA 5A2QN 1Y76A 3SPZA 3FB5C 5B1AB 2X6AA 3HGLA 2P1QB 3QEVA 2QM4A 4F6RB 2FYUH 2EX3A 3NCIA 3SQ0A 2QWNB 4CH4A 5IJ9A 2G38A 1WPXA 1HR0B 5CA1B 4KHUA 1Q5OA 1P22A 4DTRA 3DC5A 1H2LA 1XVGE 5CBHA 4LBEC 4LR3A 2VJ4A 3UIQA 1IVSA 1GM8A 4I7ZB 4M42A 3D36C 2Q8VA 5LL6Y 4H33A 4B7KA 2JJ2G 1DK1A 1N36O 2UU9B 3CRMA 5LMUB 4HCBA 4KHWA 1VQ5V 4JRPA 4NB5A 3QTCA 1NS1A 4CS3A 5KHJA 5LBQA 4ABMA 4LF6O 3ZMTA 3CC7V 1SKVA 5EBWC 1K92A 1V55C 2BSKA 1R3LC 1VQMV 3AG2B 4DW0A 4FLYA 1T5EA 1WA8B 3CCLV 5LGTA 2PYJA 1KECA 1M56C 1SQPH 3KKYA 3KCYA 5KAFZ 1S76D 1AVMA 3SPCA 2ITDC 2MMBA 1Q9XA 1K97A 3DXRB 4BWAA 1Y66A 2N04A 3ETDA 2YICA 1XUQA 2WA4A 2ZE5A 3A2FA 4UCSA 4WFBV 3JD0A 4I50B 4B08A 1JX9A 5IWAO 3K0DA 1FXKC 3U0ZA 4GKJB 3UKMA 2Y48A 4DTSA 4NTYA 2X0LA 3I56V 4B3RO 4Q6GA 2CTPA 4O2BA 3RYCB 3NDKA 4E3SA 1R6NA 1FZ6E 3ZN1A 2BTQB 4G2KA 3MHHC 4TOIA 3J27A 4UUJC 4KFMA 2VQEB 4H44B 1DF5A 3UO3A 2NR5A 4DV6B 1H8HG 4ZHQB 2QA4V 1BQ0A 2CGOA 1MOFA 4RQEA 2Q0AA 1SA0A 1V9PA 1GN6A 1VQKV 5DM6V 5K1PA 5IBKB 4LH6A 3LDBA 3CWBH 4KUMA 1MZFA 1U97A 3UCSC 3RWUA 2EIJB 3JATA 1OCZC 2ZNJA 3B40A 1Y76B 1K8AW 4H13B 4RNGA 2EIKB 1GN2A 5LHHA 2CK3G 1YCIA 5IJ0A 3F5TA 4WFGA 2QM7A 4X62B 4R7CA 3KZIZ 1J95A 4K3AA 5IYDO 2OZMA 5TISZ 4QJFB 1DF4A 2OWOA 4JI8B 1FYZE 1IXMA 1IBLO 1W59A 3BABA 3SYOA 2ZIMA 4DV1O 3ZRSA 2JVDA 2Q5ZA 4DV0O 5H5NA 2E5LB 1WPBA 4QNDA 1PKXA 1OCOC 2FB5A 2UXDB 5H6RA 1HNWO 2QTOA 4NYKA 5DECA 4WFEA 1SERA 1R6TA 3ABMB 1FXHA 2P22C 2XNDG 2F4VB 3IJ4A 2DQ0A 3GVMA 5JWPA 3H1JH 3B77A 2HLDG 5CA0B 4RQFA 1ZSPA 3K08A 5JH7A 3ZEDA 1X59A 2GV9A 2ZM6O 3OGLB 1XNRO 5GTHZ 1TA8A 1J5EO 1M93A 4JI1B 3L0MA 3N2KA 1JCHA 4JI0O 4IIJB 5LMNB 2VS0A 4LH7A 4B3MO 2ATKC 4DR2B 3V7DB 3SYAA 3LDSA 3T1YO 1FZ9E 2E31A 2DN9A 1XILA 1AJNA 3SQ2A 3HB3B 4KP4A 3IAYA 3E4YA 2VRZA 4BIUA 1VF5B 3HPLC 3N1BA 3SDLA 1VQ6V 5KX5B 1CXZB 3CC2V 3EXAA 4DV3B 5LOVA 4MTGA 3G6BA 4G28B 5FLXN 2RCUA 1FKAO 4DTMA 2RNBA 4TSFG 4AI6A 2OCCB 3N2GA 1ORQC 1QU7A 4XDLA 1WB7A 5BXZA 2JS5A 3CB2A 1DLBA 4JS5A 2LF3A 3RBZA 5IY5C 1NEXB 2X6BA 4JTDB 3OM3B 4H0LB 1XI1A 1Y4MA 4PI0A 4GX1A 4M45A 4EFEA 5IE9A 3JATB 4LF4B 2EZOA 4FJJA 2WPDG 2QKCA 3T1HB 2CE4A 4JYYA 4M3YA 3LSQA 1Q90D 3ZRVA 3RVYA 2JJ1G 4MTOA 4PA6A 3SYCA 1QR9A 3KCXA 5IJ0B 2EULA 3C94A 2EZPA 5H37A 1BE3H 1X4TA 1OCRB 2UUAB 4CBCA 3G4SV 4UCTA 3OR6C 3CCQV 1RPRA 2ADPA 5EZYA 3VBBA 3ASNB 4ZOLA 3RWRD 3ZBHA 5EC2C 2DYSB 2YI8A 3CCJV 4UXNA 1YDXA 3E4WA 1A32A 4NR1A 3RW0A 3RMCA 4UFZA 1YTFB 4DTNA 4O4IB 1N0NA 2EJRA 1AI5A 2K9PA 2QR4A 3BA8A 3ZHTA 3QNOA 4LP8A 2ZXWB 1F7YA 2ATQA 1KD1W 1NJIW 2OTJV 3F7YC 4FM2A 2W0XA 2JH9A 3W7XA 1WP8A 1K3EA 1N8RW 3NR7A 4MVOA 5H9CA 2EILC 5IT9N 4TV8A 3HGKE 2Q7EA 1VQPV 3STLC 4LWSA 5KMGB 1IDSA 4OXSA 1N36B 2P06A 4G27B 1FS1A 4Z2WA 1FZ8E 4FJXA 4B7EA 3M8AA 4UV8A 3M99B 3SJJA 3P30A 4JASA 3LUTB 4J2BA 3SUOA 1I08A 5EYPA 1MNGA 1JOYA 2YS8A 3JASA 4WBNB 3RGBA 4JZGA 3JARA 3D36A 3N2GB 4X1IB 5CB4B 2LFRA 4GX2A 1XMOB 5BY1A 3QO8A 4OX9B 2HVKC 1OV9A 3ASOC 4DR3O 2VQFO 1Q43A 3ZCCA 1URFA 5FNVA 2F93B 3ABUA 4DR6O 2B9ZA 1FAFA 2IH1C 2WLHA 3FX7A 1YXBA 2Y69B 1IBMO 3UT5A 1RFYA 1JA8A 3QEXA 1N34B 2JIZG 2JGDA 2GDSA 3CCRV 1XL4A 4JI7O 2EINC 1EM1A 3LSSA 5EZYB 2UXBO 4ZOLB 1V54C 5H2FZ 2MW2A 1QVGU 2JGUA 4YHHO 5CMUA 5GONA 4DK1A
chains in the Genus database with same CATH topology
2QWNB 4J80A 2CTPA 2DN9A 2QWQB 2CTQA 2GUZA 2Y4TA 3UCSC 3UO2A 2L6LA 2LGWA 1NZ6A 3BVOA 1IURA 2DMXA 1N4CA 3AG7A 1WJZA 2CUGA 2OCHA 2YUAA 2QWPB 2N04A 1FPOA 4J7ZA 2QWRB 2KQXA 2Y4UA 3UO3A 2YS8A 3APOA 1BQZA 2QWOB 2RKHA 2CTWA 2N05A 2CTRA 1XBLA 1BQ0A 1HDJA 3APQA 2QSAA 1FAFA 2PF4E 1GH6A 2EJ7A 2GUZB 2LO1A 4RWUA 4IT5A 1N1CA 2M6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWN B;  4J80 A;  2CTP A;  2DN9 A;  2QWQ B;  2CTQ A;  2GUZ A;  2Y4T A;  3UCS C;  3UO2 A;  2L6L A;  2LGW A;  1NZ6 A;  3BVO A;  1IUR A;  2DMX A;  1N4C A;  3AG7 A;  1WJZ A;  2CUG A;  2OCH A;  2YUA A;  2QWP B;  2N04 A;  1FPO A;  4J7Z A;  2QWR B;  2KQX A;  2Y4U A;  3UO3 A;  2YS8 A;  3APO A;  1BQZ A;  2QWO B;  2RKH A;  2CTW A;  2N05 A;  2CTR A;  1XBL A;  1BQ0 A;  1HDJ A;  3APQ A;  2QSA A;  1FAF A;  2PF4 E;  1GH6 A;  2EJ7 A;  2GUZ B;  2LO1 A;  4RWU A;  4IT5 A;  1N1C A;  2M6Y A; 
#chains in the Genus database with same CATH topology
 3CSX A;  4TQD A;  1LUV A;  4EB6 A;  5C8Y B;  2LGW A;  1Q81 W;  3K3W A;  3MAQ A;  1MA1 A;  3ZRW A;  2ETN A;  1KQS U;  4DU1 A;  4J11 A;  2DW4 A;  3TAG A;  1QNM A;  4FM0 A;  4X8A A;  3K04 A;  2FTK A;  1L0N H;  2Z0A A;  1R6K A;  4FLV A;  4K0K B;  2ZR3 A;  3E22 A;  4MW8 A;  3SPG A;  4DU4 A;  2H3O A;  4IHJ B;  1N1C A;  4X9Q A;  1YIT V;  1IBL B;  2YI9 A;  3DGE A;  4DR4 O;  4DTJ A;  4DV1 B;  4TV8 B;  5JQG A;  3OMA B;  2IU0 A;  4I6J B;  4DV0 B;  1FD9 A;  2E32 A;  3OAA G;  3ZX6 A;  4DUZ O;  4DV4 B;  1FPO A;  2ZKO A;  1HNW B;  3AK3 A;  3SI6 A;  3AK1 A;  4EEQ A;  1JFF A;  2DYR B;  4YJ2 A;  2L35 A;  4UVC A;  1NQT A;  2M7W A;  4MTX A;  1FXV A;  1SC5 B;  2JS3 A;  5D5Q A;  1YHQ V;  1EZJ A;  1I5Y A;  4DXW A;  3C3S A;  2P6J A;  4U7N A;  4I4T B;  4OGQ B;  4X20 A;  4UCR A;  3EFF K;  5JCO C;  3VQW A;  2ZM6 B;  2XOK G;  2HFE C;  1XNR B;  4PDV A;  2P4V A;  4JI0 B;  1Q7Y W;  4B3M B;  3H1I H;  2KKW A;  1ZAU A;  1YIJ V;  4O4H A;  3JD2 A;  4JI2 O;  1IXB A;  1AIL A;  4JAV A;  1RPO A;  5FNV B;  2JPN A;  1M9N A;  3FB7 C;  2L6L A;  1M57 B;  2A79 B;  4CH6 A;  1PNL A;  1G8M A;  3K0G A;  1I7F A;  1JPX A;  2HHH B;  3CJH B;  4DK0 A;  4R8C A;  1NR1 A;  1YJ9 V;  3S3X A;  3JAL A;  2JGD B;  3CYO A;  3HKC A;  4QE7 A;  3THO A;  4X65 B;  2W6J G;  3CXC U;  4I9Q A;  5GW7 A;  5EBM C;  1BZK A;  3CFP A;  4LF5 O;  2V1D A;  5CBF A;  1SES A;  2F1M A;  3W7T A;  4U3J A;  1I94 B;  3H1L H;  1E79 G;  3GWO A;  5J9P C;  3L9D A;  3SVI A;  2YUA A;  4D7T A;  3D8C A;  3K57 A;  2MW2 B;  1R73 A;  2QWR B;  1ARO P;  1MAB G;  4DV2 O;  1QCE A;  5GON B;  1CLQ A;  1XQ8 A;  2YSU B;  1KKC A;  4J9Z B;  3FAV B;  4JI4 O;  4RL5 A;  4E4E A;  4OPH A;  5E1A C;  3L74 H;  3CCE V;  2O57 A;  1FFT B;  3P3P A;  3KG2 A;  4TT3 G;  3TJY A;  1HNZ O;  2DWD C;  3K5M A;  1YEW A;  5L3B A;  4LNU A;  4JI3 O;  4YXW G;  5KHH A;  2HKO A;  3E22 B;  1XOU A;  1RM1 B;  4E4B A;  5B5E Z;  4DV7 O;  2CH7 B;  3K58 A;  2YXY A;  3WB1 A;  5JQG B;  4JGS A;  1KP2 A;  4RWU A;  3RMA A;  3OGI B;  3ZN0 A;  4ZI7 A;  4FK5 C;  4R50 A;  2OYQ A;  2GUZ A;  3HR0 A;  3LD8 A;  4FJ5 A;  3WG7 B;  4K8X A;  1HNX O;  1Q9Y A;  4J10 A;  2Y4U A;  4LFC O;  1Q6I A;  1XL6 A;  3B8M A;  2B7M A;  1JVM A;  5LGU A;  2B8I A;  1XBL A;  4KHP O;  5L3F A;  1WAF A;  3ABL C;  2UUB O;  2QGN A;  4FJM A;  3ZHQ A;  2H4T A;  2P67 A;  4FJN A;  2PY5 A;  5IYB O;  3W7U A;  4KXR A;  3U10 A;  1XU3 E;  4M3U A;  1K7D A;  2YEV B;  3G67 A;  2GHY A;  4YY3 O;  4J42 A;  2R9I A;  3JYC A;  2GTA A;  2QEX V;  3O65 A;  3K06 A;  3QET A;  4FJL A;  4PI2 A;  4LF8 O;  2CTW A;  2PI4 A;  3RYH A;  3ABK B;  1K5S A;  3SUQ A;  1VIB A;  3TJT A;  3QEP A;  2PFV A;  3R65 A;  3CCU V;  1Y74 A;  3H1H H;  1L8D A;  1EZV H;  2ZD9 A;  5DN6 G;  3HKD A;  3WSO A;  5E79 Z;  5J2T A;  3JAL B;  3HL8 A;  1P49 A;  3HKC B;  3ZRX A;  3RVZ A;  4IYH A;  1KBH A;  4WCE V;  3ZHU A;  3SUP A;  2Z5U A;  3C6N B;  2WLL A;  1RSO B;  3LNM B;  3CRA A;  3OEE G;  4DTU A;  2OT5 A;  3DSQ A;  2P1M B;  4DU3 A;  1N32 O;  5F2V O;  3CCM V;  4CZZ A;  1GO3 F;  4M3X A;  1KP3 A;  4M3Z A;  3FYE B;  5IZ7 A;  4DTX A;  4F4L A;  1Y6X A;  2PYL A;  2Q7G A;  1F51 A;  4HAM A;  4RUF A;  4DR6 B;  5IRE A;  2HEP A;  1FZ1 E;  4DR5 O;  3OGC C;  4J2A A;  2IJH A;  3TCU A;  2ZE8 A;  2BTO A;  1IBM B;  4MSW C;  4U7O A;  1FZ2 E;  2Q69 A;  4P9P A;  4I5S A;  2LW1 A;  2BE3 A;  4AKG A;  3ZHR A;  5IY5 B;  4DR1 O;  4LF7 B;  4LFB O;  5CN0 A;  2Q6A A;  4X1K A;  2DMX A;  5LYJ A;  3T2M A;  5H6Q A;  1MHY G;  3SYP A;  4CH5 A;  4YHH B;  5IJ9 B;  2NLJ C;  3SNN A;  4W4K A;  4IL6 Z;  5B1A C;  3H1K H;  2GBO A;  3OMI B;  2Y4T A;  4HBN A;  5BR8 O;  3A0R A;  4GT1 A;  5KHK A;  3HKE A;  3H01 A;  3JAW A;  2GSM B;  3OUF A;  3T1C A;  2RCV A;  1WP7 A;  4WFH A;  5D5P A;  4GKK O;  1OCC B;  2EJ7 A;  2DWE C;  4MTF A;  4JI6 B;  3UM7 A;  2UXN A;  4CS2 A;  3CFR A;  4JF3 A;  1S72 V;  3B4S A;  3E89 A;  3MDS A;  5KA5 A;  4DR4 B;  1YVW A;  4FJG A;  2OTL V;  5B1B B;  4B3S O;  2Y0I A;  1H2M A;  3D3Q A;  3E8H A;  1R1B A;  1EBO A;  1UJW B;  2PUS A;  2IM9 A;  4J2D A;  4X5N A;  1I5X A;  5LXT A;  2BSK B;  2EIM C;  1KC8 W;  3CQ8 A;  1JQ0 A;  3HKB A;  1SZT A;  4RG8 A;  4EYW A;  1Y74 B;  1YZB A;  4FZ0 A;  3OMN B;  1Z5W A;  5J2T B;  5L3E A;  4NXN B;  4LF9 O;  5JJJ B;  3AG2 C;  4B3T O;  4BW9 A;  1YSC A;  2UXC O;  4PDL A;  4M41 A;  2WLN A;  1B04 A;  3K2O A;  2WLL B;  3ABT A;  3Q4H A;  4ZKI A;  5LGN A;  1BQZ A;  4FLT A;  1SQX H;  1F4M A;  3CMA V;  1IBK B;  3IC7 A;  2OVR B;  1GH6 A;  1H2N A;  2YIB D;  4O2B B;  3G71 V;  1MG1 A;  4O4J A;  4TWK A;  3SGI A;  4O2A A;  1LNQ A;  4UCV A;  4DV5 B;  2CUG A;  1XU5 E;  5JCO A;  1FFX A;  1SA0 B;  1JJO A;  1XMG E;  3WB0 A;  1XMQ O;  2HVJ C;  1N33 B;  1ROP A;  3R66 A;  1HDJ A;  2ITC C;  1MZE A;  2BOB C;  2KSD A;  1NVP D;  1TUB A;  4AQY O;  4HCC A;  4X1K B;  5LYJ B;  3K5L A;  4LF5 B;  1PNK A;  3ASO B;  3OUS A;  3G6E V;  4L8J A;  2JQT A;  3VQX A;  4FJI A;  1EN4 A;  4UVB A;  3STZ C;  1SQV H;  2WA3 A;  4DV2 B;  4FLW A;  3ETG A;  4DRX A;  3UQ8 A;  1JR9 A;  3CCS V;  2EIK C;  1NH2 D;  1XNQ B;  4JI4 B;  5B66 Z;  4CS4 A;  2OVP B;  2B1G A;  1FJG O;  3FB6 C;  1VAR A;  2EIN B;  5LHI A;  3QO7 A;  2PGG A;  3JAW B;  1HNZ B;  3OR7 C;  3I55 V;  1NU1 H;  1L0L H;  4FVM A;  1FZI E;  1MTY G;  1FYJ A;  2UUC B;  1GN3 A;  3L70 H;  5EBL C;  1XRE A;  2QWO B;  4DV7 B;  2F23 A;  2DOS A;  5B1N A;  2Q67 A;  1PPJ H;  4IGG A;  4NXM O;  5KAI Z;  2PTM A;  2RMK B;  1AR4 A;  3RYI A;  1GTO A;  5L3C A;  1NI8 A;  4JRQ A;  2IJK A;  5DED A;  5LXT B;  3VOU A;  5JH7 B;  3U11 A;  2JH8 A;  1US6 A;  2OIE A;  3HKB B;  4KHS A;  1HNX B;  2ILM A;  3CPW U;  3N2K B;  4LFC B;  2A9H A;  4PDR A;  1CP9 A;  3FD9 A;  3BFR A;  1XVE E;  2LO1 A;  2QE7 G;  2XAH A;  2LF6 A;  1XDC A;  2D2C B;  2UU9 O;  3BRC A;  2DE0 X;  3Q4H B;  2ZDI C;  2HJF C;  1AB3 A;  4YY3 B;  5ITZ A;  1BHA A;  2E3C A;  2P1N B;  4QE9 A;  2XAG A;  2JHC A;  1HP8 A;  4LF6 B;  2Z3Y A;  4LF8 B;  1FXX A;  1DGS A;  5LOV B;  1XL3 C;  1AP6 A;  1DTO A;  3APQ A;  5BMV A;  2UXX A;  2F95 B;  1XHZ A;  1S5L Z;  2H94 A;  4O2A B;  3OFN G;  3SPH A;  1FFX B;  1E1Q G;  4KI4 A;  2Q0O C;  1AP5 A;  1NZ6 A;  1W2B U;  1GN4 A;  2JDI G;  3MKS B;  1H2S B;  2ZR2 A;  3HP9 A;  2A0L A;  1EN5 A;  4MS2 A;  2C2A A;  3RT3 C;  1IX9 A;  5IYC O;  4XDK A;  1Q82 W;  5IWA B;  4P30 A;  5JVD A;  2AGA A;  2DJV A;  1M5I A;  4YIO A;  1AI4 A;  3E8G A;  3JCU Z;  1N32 B;  4BIZ A;  4B3R B;  4X64 O;  1XVB E;  3UO2 A;  4I0X A;  1S0V A;  4DRX B;  2AHZ A;  3JCZ A;  3CE2 A;  2P5O A;  3E2E A;  3OT7 A;  4DV6 O;  3O9O A;  3CP1 A;  5LP6 C;  1NT2 B;  2P1P B;  4X66 O;  1GM7 A;  3CME V;  1XVD E;  1YJN V;  3JSL A;  1IG9 A;  5FPR A;  1FXK A;  2WLI A;  4A5U B;  1WLE A;  2YDE A;  3IFX A;  2JHP A;  4EKW A;  2YIA A;  1VF6 C;  4BW5 A;  4IYI A;  2R70 A;  4JYA O;  1PL0 A;  3G80 A;  1MSD A;  3B09 A;  4JTA B;  5IYZ A;  3ASN C;  3K5O A;  1GM9 A;  2OIG A;  3BPZ A;  1NR7 A;  2DYS C;  4D6T H;  3ML0 A;  2MK3 A;  3OE7 G;  3QEI A;  2DEB A;  4X62 O;  1B3Q A;  1XMH E;  1PV0 A;  2Q9L A;  2F66 C;  4JI8 O;  2ZQM A;  3SPI A;  4MVQ A;  3LZJ A;  3NXS A;  3D3I A;  3MHS C;  4LWS B;  2E5L O;  4GKK B;  4DUY O;  1QR8 A;  4TUY A;  4WFF A;  1XEQ A;  4CC5 A;  1LR1 A;  4Q20 A;  3C95 A;  2F4V O;  2EBO A;  4X89 A;  5EYP B;  3JAS B;  4F6R A;  4CC6 A;  4MVM A;  4AI8 A;  3JAR B;  4HZ3 A;  4FK4 A;  4UCO A;  3M7M X;  3SJC C;  1SQQ H;  1J5E B;  3L72 H;  2WLJ A;  3FKS G;  3E35 A;  4JAU A;  2YIB A;  1R3I C;  5KLV H;  5LMN O;  4AKH A;  4DR2 O;  1ZWI C;  1MHZ G;  3OGM B;  3T1Y B;  3VQY A;  4QGP A;  1OZ0 A;  5KHI A;  3J2P A;  3BY6 A;  2UXC B;  1KKD A;  1WB8 A;  1N4C A;  1V55 B;  4UCU A;  5JVD B;  2OVQ B;  4JYB A;  1AR5 A;  4MVR A;  1RP3 B;  3UT5 B;  1BMF G;  5JJE B;  3J81 N;  1D5N A;  4DV3 O;  1M56 B;  1P7B A;  2QKS A;  4UVA A;  3JD3 A;  3ZHV A;  3QVN A;  2Y69 C;  3IC9 A;  4KI6 A;  3C6O B;  3DC6 A;  3CC4 V;  1WA8 A;  2OCH A;  4Z1V A;  2JEX A;  3BCC H;  3E86 A;  1FXK B;  4MT8 A;  4BAY A;  1EN6 A;  2PZS A;  1G6U A;  3ZHS A;  3C3T A;  4LF4 O;  4EB6 B;  1U96 A;  3SQ1 A;  4FJ9 A;  4EP9 A;  4I50 A;  3ZRW B;  2ZIN A;  1NKD A;  1TGO A;  1KYO F;  1NBM G;  2ZE7 A;  4QIW F;  1IZ3 A;  2K1E A;  3TXQ A;  2P7T C;  3PN1 A;  4PA4 A;  3AG4 C;  1EFR G;  4FJC C;  4FJ8 A;  3K59 A;  2BTQ A;  3QG5 A;  4PV1 B;  2XT9 A;  1Q6H A;  3ZMZ A;  2UUA O;  3CRQ A;  1FJG B;  4E2L A;  3AK2 A;  2JHA A;  1OCZ B;  4FJK A;  2LQT A;  4NTX A;  2WLM A;  4JTC B;  2IW5 A;  4PD4 F;  1AR1 B;  1ZL8 A;  5EC1 C;  1LDK E;  2PFT A;  1NTZ H;  1R3K C;  4TUY B;  1JJ2 U;  1JFF B;  4YJ2 B;  4D7S A;  2E75 B;  3RMB A;  3C90 A;  4NXM B;  4QPJ A;  3T4Z A;  3B2E E;  1KU9 A;  1UPG A;  4ADN A;  3ETQ A;  4J9Y B;  2DYR C;  4X20 B;  4FLU A;  3WFV A;  4PA3 A;  2YB5 A;  4WFA V;  4DR7 O;  4C7U A;  5L3G A;  1CPY A;  1OCO B;  2QTS A;  1HWY A;  4XBF A;  4JS4 A;  3OW2 U;  2B1E A;  3SCX A;  4O4H B;  4J41 A;  2AZ2 A;  4JV5 O;  2HJD A;  1Y67 A;  4R6Z A;  2VWK A;  4PA7 A;  2ZNI A;  3CXH F;  2KG7 A;  2W0F C;  2EIM B;  4P2Z A;  2WSS G;  1QBZ A;  1QLE C;  5BZB A;  1PL4 A;  3CRR A;  3X2Q C;  2F43 G;  3J7A U;  4EPH A;  1NVP B;  1N0J A;  5HFL A;  4F6E A;  1M57 C;  1YF2 A;  5CA0 A;  4ZBM A;  4JI5 O;  3BHP A;  4FFB A;  3E83 A;  1GK9 A;  1QVF U;  4W4L A;  4U3J B;  2E76 B;  1SS3 A;  2QKA A;  4FMT A;  4FFK A;  4IIJ A;  2R72 A;  2ZDI A;  1XMO O;  4OX9 O;  3L1N A;  2FML A;  2B5U A;  3GB7 C;  1VEW A;  5B3S C;  2BOC C;  4DR3 B;  1NH2 B;  2VQF B;  2P90 A;  3W7S A;  1K9M W;  3AG3 C;  3ZIA G;  3EHB B;  5C93 A;  3E8B A;  4QNC A;  1AJQ A;  3L8B A;  1BHB A;  3OD4 A;  2IBZ H;  1L1F A;  3CHX A;  3P32 A;  4X64 B;  4LNU B;  2LJ2 A;  1H2K A;  2FW3 A;  3SJA C;  5KX5 A;  1N34 O;  3AG1 C;  3N27 A;  1ENV A;  5IDJ A;  4JI7 B;  2ZT9 B;  4H37 A;  1WAZ A;  3WU2 Z;  4X66 B;  1SQG A;  3A0B Z;  1IH7 A;  1H8E G;  3BAA A;  3SPJ A;  4ZI7 B;  4ASU G;  3N1E A;  2UXB B;  1FS0 G;  3MD0 A;  1BL8 A;  4KHQ A;  2GUZ B;  1RM1 C;  1H2G A;  1ZL8 B;  1D5A A;  2Q73 A;  5J2U A;  4AKI A;  4JYA B;  4RAI A;  4UV9 A;  4GZR B;  1K4D C;  2XUM A;  2XAJ A;  2RKH A;  3WG7 C;  2P1O B;  1GRJ A;  2Q7H A;  5LP6 A;  3KD5 E;  1F4N A;  1CEZ A;  1GMG A;  4TV9 A;  2QSA A;  4K0K O;  1KMI Z;  3LNN A;  2DTU A;  3KD1 E;  1SRY A;  3ZMU A;  4GAM C;  2A3Q A;  1VF6 A;  4GX5 A;  3SJB C;  2RDC A;  4QPK A;  2ARH A;  2HG5 C;  2YXL A;  3NE6 A;  4LFA O;  5K1X A;  2KB1 A;  3QNE A;  3K5N A;  3JD1 A;  3CRC A;  4DUZ B;  4DV4 O;  5LHG A;  2RJZ A;  1S5J A;  3RYH B;  4RO2 A;  4PDM A;  2MZW B;  4DUY B;  4J2E A;  2KG7 B;  4GX0 A;  2GTS A;  2Q4P A;  1H38 A;  1FZH E;  2IJI A;  1PNM A;  3JAM N;  3QER A;  4X1Y A;  3HKD B;  4AHC A;  2DY4 A;  3QNN A;  3ABK C;  1MSW D;  2P4K A;  2XHB A;  4DTO A;  4O4I A;  2EIL B;  4P9O A;  2OZS A;  3CD6 V;  5LA6 A;  3OTO O;  4FFB B;  1O9H A;  4FM1 A;  3TET A;  4M3R A;  2YC0 A;  1SQF A;  1B06 A;  4PEL A;  1TAE A;  2LGQ A;  1VMG A;  3JAK A;  4O4L A;  3DTU B;  3S3W A;  1THZ A;  2RQ6 A;  2YXH A;  4JI2 B;  1MMM A;  1Z5V A;  5KMG A;  4KHN A;  2QWQ B;  1BGY H;  1K4C C;  4L87 A;  2NNU A;  3K79 A;  4FZ1 A;  4M3W A;  3NAE A;  4CH3 A;  2HHH O;  5HFM A;  1K33 A;  2IH3 C;  1SET A;  2Y0P A;  4X65 O;  4ICG C;  4WBN A;  1M1K W;  2R9A A;  4K8Z A;  3SUN A;  3E8F A;  2B1I A;  1VQ7 V;  1FZ3 E;  4J7K A;  1ZUQ A;  3T4D A;  2CTQ A;  2E74 B;  4YIP A;  3P3N A;  1GKF A;  1BCC H;  1I94 O;  5B1O A;  4X1I A;  2CGN A;  5CB4 A;  3B8N A;  3RYF A;  2ZCE A;  4J7Z A;  1KB9 F;  2EIJ C;  1FZ4 E;  2K5S A;  4MVS A;  5J2U B;  3OGK B;  1GAX A;  3S9H A;  4LCU C;  1WN7 A;  1TVK A;  1S3J A;  3RMD A;  3ZS8 C;  1YI2 V;  3HKE B;  3NHG A;  3BVO A;  3L2O B;  5LP6 B;  1E1R G;  4JI3 B;  1Q86 W;  1BT8 A;  4TV9 B;  3C6P B;  1V54 B;  3L71 H;  2AW9 A;  1K5Q A;  1Q8I A;  4FJ7 A;  1BS3 A;  4LC1 A;  3LDC A;  4WF9 V;  4BR6 A;  1ZTE A;  5A9G A;  1SQB H;  1OCC C;  2LFS A;  3ICX A;  1NTK H;  3A8T A;  3VQV A;  4UB6 Z;  4X5M A;  4PHZ A;  2AHY A;  2ZIO A;  1HR0 O;  3SPY A;  4BIO A;  2WWW A;  1D2D A;  3ABM C;  1COW G;  3NGI A;  1PM9 A;  1F23 A;  5B1B C;  5C8Y A;  1PP9 H;  2JEU A;  3APO A;  5KA6 A;  4GCZ A;  1QHT A;  4X1Y B;  1BSM A;  4KHP B;  5AG2 A;  2CAZ C;  2UUB B;  1O9G A;  4IT5 A;  5LA6 B;  1KUQ A;  5LMU O;  4FPP A;  4DR7 B;  4I55 A;  4MVZ A;  4HNA A;  4N23 A;  4IHJ A;  4KHY A;  4DO2 A;  3JAK B;  2HD0 A;  4O4L B;  2QM8 A;  3BA9 A;  3BEH A;  2H8P C;  3LDE A;  1Q3E A;  4FIP C;  1R3J C;  2FKX A;  4YJ3 A;  1I0H A;  4JV5 B;  3K9A A;  1VF7 A;  4O4J B;  3PJS K;  2AZ0 A;  4U3F H;  2WLK A;  3FYI B;  4GYC B;  2FYO A;  3F7V C;  5KUM A;  1VQ4 V;  2FL4 A;  4NTW A;  2OCC C;  1VP7 A;  1TUB B;  5EIB C;  4JI5 B;  1VQL V;  3OEH G;  4I4T A;  1OJH A;  3TAF A;  4XDJ A;  3ETE A;  4N21 A;  4GKJ O;  3SQ4 A;  1G1X B;  3RYF B;  3A0H Z;  2QJ1 A;  1P84 F;  1VQ8 V;  4M3T A;  4FK2 A;  5KHG A;  2NN4 A;  2LP7 A;  1ZX3 A;  4MVU A;  2VQE O;  2A7W A;  5KUK A;  1TVK B;  3QF7 A;  4DR5 B;  2W6I G;  3CS5 A;  3FFQ A;  3RFR A;  3L73 H;  1ZLZ A;  3CJH A;  3W7W A;  2ADQ B;  3F5W C;  1QQC A;  4DW1 A;  2M6Y A;  1OCR C;  2XTA A;  3IGA C;  3RN4 A;  4J80 A;  4DR1 B;  4LFB B;  4LF7 O;  3K03 A;  3SYQ A;  4JPR A;  2PI5 A;  1HW7 A;  2ZE6 A;  1WJZ A;  1XVF E;  5L3D A;  2BCC H;  4J7J A;  1XHX A;  1FZ7 E;  5EIB D;  2IU3 A;  3RYI B;  3CX5 F;  3TGU H;  3QEW A;  1K34 A;  2XAF A;  3CEI A;  3SJQ C;  4KL1 A;  1W0J G;  3JSN A;  2YID A;  3FAV A;  1AI7 A;  3AG4 B;  1WNS A;  5BR8 B;  4HYO A;  2VWJ A;  2X6C A;  3AG7 A;  2HR3 A;  1P7G A;  2ZXW C;  1UFI A;  2P5G A;  3GWK C;  2RN9 A;  1JMK C;  1MMO G;  1M90 W;  2UXD O;  1G4Y B;  5CA3 A;  3L75 H;  4AIL C;  4I55 B;  3ZJZ A;  5JJN B;  4HNA B;  4JI6 O;  4K35 A;  5ITZ B;  4PJ0 Z;  4I9W A;  1PD3 A;  2CH7 A;  4UB8 Z;  4LFA B;  4B3S B;  5GTI Z;  4TQF A;  4YJ3 B;  3ABL B;  1QLN A;  5BMV B;  4JYC A;  2R9R B;  1XMF E;  5CA1 A;  1AJP A;  3TXS A;  2JRI A;  4JI1 O;  4MW3 A;  3H9V A;  2XAS A;  1Q6U A;  4ZIB A;  1Z2G A;  2QXF A;  4FK0 A;  2VIX A;  2HP8 A;  3K9S A;  4NXN O;  1YTF D;  4LF9 B;  4B3T B;  2LW7 A;  3OTO B;  1JW2 A;  4DYL A;  1TUE B;  1W0K G;  1LUW A;  5CBG A;  4RUE A;  4I9L A;  2YEV A;  2N05 A;  1VQN V;  1FZ0 E;  1SF9 A;  1VQO V;  2N74 A;  2WAM A;  1IBK O;  4EFB A;  1QLE B;  1K73 W;  4FLZ A;  4I0X B;  1S77 D;  4DTP A;  2A06 H;  2QDO A;  3X2Q B;  4X88 A;  5FL7 G;  4OPA A;  1S5H C;  1AI6 A;  4QNH B;  1VQ9 V;  2X7R B;  1FZ5 E;  3QO5 A;  4DV5 O;  3OTF A;  2QWP B;  4NVP A;  3CFO A;  1XMQ B;  1N33 O;  2WLI B;  3LZI A;  2XAQ A;  4FLX A;  2PF4 E;  3DXR A;  3J80 N;  4Z1M G;  1B6Q A;  1OHH G;  4AQY B;  3LSU A;  3I5D A;  5B3S B;  2CDY A;  2Q68 A;  5IYZ B;  1RSO A;  1M4U A;  3AG3 B;  1YJW V;  3T1H O;  2IJJ A;  1P4R A;  3CCV V;  1SZX A;  3QES A;  3RYC A;  4ADO A;  4NKG B;  3SR2 C;  2DQ3 A;  2V7Q G;  1XNQ O;  3WB2 A;  3TK1 A;  3AG1 B;  3ZMV A;  4ICG A;  3AEI A;  5FPO A;  4ZHQ A;  3JD4 A;  2AXT Z;  3TL8 B;  3TAB A;  4FJH A;  2VJ5 A;  4JZ2 A;  2JK5 C;  1WAJ A;  1IUR A;  1XVC E;  2V4D A;  5EK0 A;  2ODM A;  3ZMS A;  4GLX A;  2UUC O;  3FB8 C;  2D3O W;  3LDD A;  1NTM H;  4PA9 A;  2KQX A;  3TAE A;  4JAA A;  3EVK A;  4GUN A;  2CTR A;  5A2Q N;  1Y76 A;  3SPZ A;  3FB5 C;  5B1A B;  2X6A A;  3HGL A;  2P1Q B;  3QEV A;  2QM4 A;  4F6R B;  2FYU H;  2EX3 A;  3NCI A;  3SQ0 A;  2QWN B;  4CH4 A;  5IJ9 A;  2G38 A;  1WPX A;  1HR0 B;  5CA1 B;  4KHU A;  1Q5O A;  1P22 A;  4DTR A;  3DC5 A;  1H2L A;  1XVG E;  5CBH A;  4LBE C;  4LR3 A;  2VJ4 A;  3UIQ A;  1IVS A;  1GM8 A;  4I7Z B;  4M42 A;  3D36 C;  2Q8V A;  5LL6 Y;  4H33 A;  4B7K A;  2JJ2 G;  1DK1 A;  1N36 O;  2UU9 B;  3CRM A;  5LMU B;  4HCB A;  4KHW A;  1VQ5 V;  4JRP A;  4NB5 A;  3QTC A;  1NS1 A;  4CS3 A;  5KHJ A;  5LBQ A;  4ABM A;  4LF6 O;  3ZMT A;  3CC7 V;  1SKV A;  5EBW C;  1K92 A;  1V55 C;  2BSK A;  1R3L C;  1VQM V;  3AG2 B;  4DW0 A;  4FLY A;  1T5E A;  1WA8 B;  3CCL V;  5LGT A;  2PYJ A;  1KEC A;  1M56 C;  1SQP H;  3KKY A;  3KCY A;  5KAF Z;  1S76 D;  1AVM A;  3SPC A;  2ITD C;  2MMB A;  1Q9X A;  1K97 A;  3DXR B;  4BWA A;  1Y66 A;  2N04 A;  3ETD A;  2YIC A;  1XUQ A;  2WA4 A;  2ZE5 A;  3A2F A;  4UCS A;  4WFB V;  3JD0 A;  4I50 B;  4B08 A;  1JX9 A;  5IWA O;  3K0D A;  1FXK C;  3U0Z A;  4GKJ B;  3UKM A;  2Y48 A;  4DTS A;  4NTY A;  2X0L A;  3I56 V;  4B3R O;  4Q6G A;  2CTP A;  4O2B A;  3RYC B;  3NDK A;  4E3S A;  1R6N A;  1FZ6 E;  3ZN1 A;  2BTQ B;  4G2K A;  3MHH C;  4TOI A;  3J27 A;  4UUJ C;  4KFM A;  2VQE B;  4H44 B;  1DF5 A;  3UO3 A;  2NR5 A;  4DV6 B;  1H8H G;  4ZHQ B;  2QA4 V;  1BQ0 A;  2CGO A;  1MOF A;  4RQE A;  2Q0A A;  1SA0 A;  1V9P A;  1GN6 A;  1VQK V;  5DM6 V;  5K1P A;  5IBK B;  4LH6 A;  3LDB A;  3CWB H;  4KUM A;  1MZF A;  1U97 A;  3UCS C;  3RWU A;  2EIJ B;  3JAT A;  1OCZ C;  2ZNJ A;  3B40 A;  1Y76 B;  1K8A W;  4H13 B;  4RNG A;  2EIK B;  1GN2 A;  5LHH A;  2CK3 G;  1YCI A;  5IJ0 A;  3F5T A;  4WFG A;  2QM7 A;  4X62 B;  4R7C A;  3KZI Z;  1J95 A;  4K3A A;  5IYD O;  2OZM A;  5TIS Z;  4QJF B;  1DF4 A;  2OWO A;  4JI8 B;  1FYZ E;  1IXM A;  1IBL O;  1W59 A;  3BAB A;  3SYO A;  2ZIM A;  4DV1 O;  3ZRS A;  2JVD A;  2Q5Z A;  4DV0 O;  5H5N A;  2E5L B;  1WPB A;  4QND A;  1PKX A;  1OCO C;  2FB5 A;  2UXD B;  5H6R A;  1HNW O;  2QTO A;  4NYK A;  5DEC A;  4WFE A;  1SER A;  1R6T A;  3ABM B;  1FXH A;  2P22 C;  2XND G;  2F4V B;  3IJ4 A;  2DQ0 A;  3GVM A;  5JWP A;  3H1J H;  3B77 A;  2HLD G;  5CA0 B;  4RQF A;  1ZSP A;  3K08 A;  5JH7 A;  3ZED A;  1X59 A;  2GV9 A;  2ZM6 O;  3OGL B;  1XNR O;  5GTH Z;  1TA8 A;  1J5E O;  1M93 A;  4JI1 B;  3L0M A;  3N2K A;  1JCH A;  4JI0 O;  4IIJ B;  5LMN B;  2VS0 A;  4LH7 A;  4B3M O;  2ATK C;  4DR2 B;  3V7D B;  3SYA A;  3LDS A;  3T1Y O;  1FZ9 E;  2E31 A;  2DN9 A;  1XIL A;  1AJN A;  3SQ2 A;  3HB3 B;  4KP4 A;  3IAY A;  3E4Y A;  2VRZ A;  4BIU A;  1VF5 B;  3HPL C;  3N1B A;  3SDL A;  1VQ6 V;  5KX5 B;  1CXZ B;  3CC2 V;  3EXA A;  4DV3 B;  5LOV A;  4MTG A;  3G6B A;  4G28 B;  5FLX N;  2RCU A;  1FKA O;  4DTM A;  2RNB A;  4TSF G;  4AI6 A;  2OCC B;  3N2G A;  1ORQ C;  1QU7 A;  4XDL A;  1WB7 A;  5BXZ A;  2JS5 A;  3CB2 A;  1DLB A;  4JS5 A;  2LF3 A;  3RBZ A;  5IY5 C;  1NEX B;  2X6B A;  4JTD B;  3OM3 B;  4H0L B;  1XI1 A;  1Y4M A;  4PI0 A;  4GX1 A;  4M45 A;  4EFE A;  5IE9 A;  3JAT B;  4LF4 B;  2EZO A;  4FJJ A;  2WPD G;  2QKC A;  3T1H B;  2CE4 A;  4JYY A;  4M3Y A;  3LSQ A;  1Q90 D;  3ZRV A;  3RVY A;  2JJ1 G;  4MTO A;  4PA6 A;  3SYC A;  1QR9 A;  3KCX A;  5IJ0 B;  2EUL A;  3C94 A;  2EZP A;  5H37 A;  1BE3 H;  1X4T A;  1OCR B;  2UUA B;  4CBC A;  3G4S V;  4UCT A;  3OR6 C;  3CCQ V;  1RPR A;  2ADP A;  5EZY A;  3VBB A;  3ASN B;  4ZOL A;  3RWR D;  3ZBH A;  5EC2 C;  2DYS B;  2YI8 A;  3CCJ V;  4UXN A;  1YDX A;  3E4W A;  1A32 A;  4NR1 A;  3RW0 A;  3RMC A;  4UFZ A;  1YTF B;  4DTN A;  4O4I B;  1N0N A;  2EJR A;  1AI5 A;  2K9P A;  2QR4 A;  3BA8 A;  3ZHT A;  3QNO A;  4LP8 A;  2ZXW B;  1F7Y A;  2ATQ A;  1KD1 W;  1NJI W;  2OTJ V;  3F7Y C;  4FM2 A;  2W0X A;  2JH9 A;  3W7X A;  1WP8 A;  1K3E A;  1N8R W;  3NR7 A;  4MVO A;  5H9C A;  2EIL C;  5IT9 N;  4TV8 A;  3HGK E;  2Q7E A;  1VQP V;  3STL C;  4LWS A;  5KMG B;  1IDS A;  4OXS A;  1N36 B;  2P06 A;  4G27 B;  1FS1 A;  4Z2W A;  1FZ8 E;  4FJX A;  4B7E A;  3M8A A;  4UV8 A;  3M99 B;  3SJJ A;  3P30 A;  4JAS A;  3LUT B;  4J2B A;  3SUO A;  1I08 A;  5EYP A;  1MNG A;  1JOY A;  2YS8 A;  3JAS A;  4WBN B;  3RGB A;  4JZG A;  3JAR A;  3D36 A;  3N2G B;  4X1I B;  5CB4 B;  2LFR A;  4GX2 A;  1XMO B;  5BY1 A;  3QO8 A;  4OX9 B;  2HVK C;  1OV9 A;  3ASO C;  4DR3 O;  2VQF O;  1Q43 A;  3ZCC A;  1URF A;  5FNV A;  2F93 B;  3ABU A;  4DR6 O;  2B9Z A;  1FAF A;  2IH1 C;  2WLH A;  3FX7 A;  1YXB A;  2Y69 B;  1IBM O;  3UT5 A;  1RFY A;  1JA8 A;  3QEX A;  1N34 B;  2JIZ G;  2JGD A;  2GDS A;  3CCR V;  1XL4 A;  4JI7 O;  2EIN C;  1EM1 A;  3LSS A;  5EZY B;  2UXB O;  4ZOL B;  1V54 C;  5H2F Z;  2MW2 A;  1QVG U;  2JGU A;  4YHH O;  5CMU A;  5GON A;  4DK1 A; 
#chains in the Genus database with same CATH homology
 2QWN B;  4J80 A;  2CTP A;  2DN9 A;  2QWQ B;  2CTQ A;  2GUZ A;  2Y4T A;  3UCS C;  3UO2 A;  2L6L A;  2LGW A;  1NZ6 A;  3BVO A;  1IUR A;  2DMX A;  1N4C A;  3AG7 A;  1WJZ A;  2CUG A;  2OCH A;  2YUA A;  2QWP B;  2N04 A;  1FPO A;  4J7Z A;  2QWR B;  2KQX A;  2Y4U A;  3UO3 A;  2YS8 A;  3APO A;  1BQZ A;  2QWO B;  2RKH A;  2CTW A;  2N05 A;  2CTR A;  1XBL A;  1BQ0 A;  1HDJ A;  3APQ A;  2QSA A;  1FAF A;  2PF4 E;  1GH6 A;  2EJ7 A;  2GUZ B;  2LO1 A;  4RWU A;  4IT5 A;  1N1C A;  2M6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...