1XL3C

Complex structure of y.pestis virulence factors yopn and tyea
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
88
Chain Sequence
AYDLSEFMGDIVALVDRWAGIHDIEHLANAFSLPTPEIVRFYQDLRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretion control protein
publication title Three-dimensional structure of a macromolecular assembly that regulates type III secretion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
total genus 28
structure length 88
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09059 TyeA TyeA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.80 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xl3C00
1XL3C
chains in the Genus database with same CATH superfamily
2RKHA 4DTUA 4KI6A 3UIQA 3UO3A 1FZHE 4EYWA 4DTJA 2VJ4A 3RMBA 3J2PA 4AKGA 2PFTA 4EPHA 2B8IA 3QEPA 2JHPA 3E4WA 4EP9A 4FVMA 1FZIE 1FZ1E 2JHCA 4RL5A 3SI6A 4FJ5A 3HP9A 1FZ6E 2E31A 2QXFA 4DTMA 2OVPB 2DY4A 4AKHA 3NGIA 3CFRA 4AI6A 1XU3E 3TAGA 1XL3C 2JH9A 2B7MA 4FJHA 3QERA 3SUOA 4FJ7A 3BVOA 3LZIA 1XU5E 4I9LA 4KI4A 2HD0A 4FJKA 4M3WA 3TABA 1MMOG 2P1OB 3C94A 2H4TA 3SQ4A 3S9HA 2P5OA 4FJMA 2K5SA 3CFOA 4QNDA 4KHNA 4KHSA 4X5MA 4M42A 3J27A 2OYQA 3SUNA 4GAMC 4M3RA 4DTOA 1FYZE 3N1BA 4FJ8A 4M3UA 4M3YA 3SPZA 3NHGA 4ICGC 4M3TA 5IBKB 5IREA 1XVDE 2VJ5A 1MTYG 1IH7A 3UO2A 3RMAA 3RMCA 3LDBA 4KHUA 4QNCA 2P1PB 3L1NA 3TJYA 1XMGE 3HL8A 4FJLA 3HGKE 4J2AA 1FZ3E 3RMDA 4M3ZA 3N1EA 2OVQB 5H37A 2OZSA 4J2DA 4FK0A 3SQ2A 2DTUA 4FJIA 2RCUA 2P1QB 4E4BA 1WAJA 3L0MA 3SCXA 4I9QA 1XVBE 4J2BA 3OGMB 3C6PB 1P22A 3TAFA 3QEIA 2P5GA 2B1EA 2ATQA 4IT5A 2MW2A 1WAFA 1FZ4E 1FZ2E 5IZ7A 4M45A 3NDKA 1FZ7E 2DEBA 3V7DB 1FZ9E 1MHYG 4RG8A 2FW3A 4KHQA 1FPOA 4X5NA 4M3XA 3QNNA 1FZ8E 2YB5A 4HCBA 3OGKB 4FJGA 1FXXA 4FJ9A 4RNGA 3C95A 3SVIA 3QEXA 1CLQA 1Q9XA 2OZMA 1NEXB 2P1NB 2LF3A 4ADNA 4DU3A 3QESA 1LDKE 3LZJA 3KD1E 4FK4A 1XVGE 3TAEA 1XVFE 3C6OB 1Q9YA 3KD5E 3SPYA 4AKIA 3TL8B 3SQ1A 4KHYA 1XVCE 2LF6A 3SQ0A 1XMFE 1FZ5E 4DU4A 2JQTA 3QEVA 4DTRA 4FJJA 2OVRB 3QETA 3WSOA 4J2EA 2VIXA 4KHWA 2E32A 3SNNA 1MHZG 4JS5A 4FK2A 3SUPA 3SJJA 3OGLB 3L8BA 4FJXA 3C6NB 2FYOA 2MZWB 1FZ0E 3HGLA 3LD8A 4E3SA 4FJNA 2JH8A 1IG9A 4DU1A 2P1MB 4DTPA 2MMBA 1XMHE 4ADOA 3RWUA 1N1CA 4DTNA 3QEWA 1XVEE 1JW2A 3NAEA 3QNOA 3LDSA 4JRQA 3NE6A 2JHAA 4DTSA 3MKSB 4M41A 4B08A 4JS4A 4DTXA 4I6JB 3SUQA 3E4YA 3L2OB 3NCIA 2PFVA 4HCCA 4JRPA 1FS1A 3CFPA 2JPNA 3CQ8A 3K2OA
chains in the Genus database with same CATH topology
4DTUA 4KI6A 3UIQA 1FZHE 4EYWA 4DTJA 2VJ4A 3RMBA 3J2PA 4AKGA 2PFTA 4EPHA 2B8IA 3QEPA 2JHPA 3E4WA 4EP9A 4FVMA 1FZIE 1FZ1E 2JHCA 4RL5A 3SI6A 4FJ5A 3HP9A 1FZ6E 2E31A 2QXFA 4DTMA 2OVPB 2DY4A 4AKHA 3NGIA 3CFRA 4AI6A 1XU3E 3TAGA 1XL3C 2JH9A 2B7MA 4FJHA 3QERA 3SUOA 4FJ7A 3LZIA 1XU5E 4I9LA 4KI4A 2HD0A 4FJKA 4M3WA 3TABA 1MMOG 2P1OB 3C94A 2H4TA 3SQ4A 3S9HA 2P5OA 4FJMA 3CFOA 4QNDA 4KHNA 4KHSA 4X5MA 4M42A 3J27A 2OYQA 3SUNA 4GAMC 4M3RA 4DTOA 1FYZE 3N1BA 4FJ8A 4M3UA 4M3YA 3SPZA 3NHGA 4M3TA 5IBKB 5IREA 1XVDE 2VJ5A 1MTYG 1IH7A 3RMAA 3RMCA 3LDBA 4KHUA 4QNCA 2P1PB 3L1NA 3TJYA 1XMGE 3HL8A 4FJLA 3HGKE 4J2AA 1FZ3E 3RMDA 4M3ZA 3N1EA 2OVQB 5H37A 2OZSA 4J2DA 4FK0A 3SQ2A 2DTUA 4FJIA 2RCUA 2P1QB 4E4BA 1WAJA 3L0MA 3SCXA 4I9QA 1XVBE 4J2BA 3OGMB 3C6PB 1P22A 3TAFA 3QEIA 2P5GA 2B1EA 2ATQA 1WAFA 1FZ4E 1FZ2E 5IZ7A 4M45A 3NDKA 1FZ7E 2DEBA 3V7DB 1FZ9E 1MHYG 4RG8A 2FW3A 4KHQA 4X5NA 4M3XA 3QNNA 1FZ8E 2YB5A 4HCBA 3OGKB 4FJGA 1FXXA 4FJ9A 4RNGA 3C95A 3SVIA 3QEXA 1CLQA 1Q9XA 2OZMA 1NEXB 2P1NB 2LF3A 4ADNA 4DU3A 3QESA 1LDKE 3LZJA 3KD1E 4FK4A 1XVGE 3TAEA 1XVFE 3C6OB 1Q9YA 3KD5E 3SPYA 4AKIA 3TL8B 3SQ1A 4KHYA 1XVCE 2LF6A 3SQ0A 1XMFE 1FZ5E 4DU4A 3QEVA 4DTRA 4FJJA 2OVRB 3QETA 3WSOA 4J2EA 2VIXA 4KHWA 2E32A 3SNNA 1MHZG 4JS5A 4FK2A 3SUPA 3SJJA 3OGLB 3L8BA 4FJXA 3C6NB 2FYOA 2MZWB 1FZ0E 3HGLA 3LD8A 4E3SA 4FJNA 2JH8A 1IG9A 4DU1A 2P1MB 4DTPA 2MMBA 1XMHE 4ADOA 3RWUA 4DTNA 3QEWA 1XVEE 3NAEA 3QNOA 3LDSA 4JRQA 3NE6A 2JHAA 4DTSA 3MKSB 4M41A 4B08A 4JS4A 4DTXA 4I6JB 3SUQA 3E4YA 3L2OB 3NCIA 2PFVA 4HCCA 4JRPA 1FS1A 3CFPA 2JPNA 3CQ8A 3K2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XL3 C; 
#chains in the Genus database with same CATH topology
 2RKH A;  4DTU A;  4KI6 A;  3UIQ A;  3UO3 A;  1FZH E;  4EYW A;  4DTJ A;  2VJ4 A;  3RMB A;  3J2P A;  4AKG A;  2PFT A;  4EPH A;  2B8I A;  3QEP A;  2JHP A;  3E4W A;  4EP9 A;  4FVM A;  1FZI E;  1FZ1 E;  2JHC A;  4RL5 A;  3SI6 A;  4FJ5 A;  3HP9 A;  1FZ6 E;  2E31 A;  2QXF A;  4DTM A;  2OVP B;  2DY4 A;  4AKH A;  3NGI A;  3CFR A;  4AI6 A;  1XU3 E;  3TAG A;  1XL3 C;  2JH9 A;  2B7M A;  4FJH A;  3QER A;  3SUO A;  4FJ7 A;  3BVO A;  3LZI A;  1XU5 E;  4I9L A;  4KI4 A;  2HD0 A;  4FJK A;  4M3W A;  3TAB A;  1MMO G;  2P1O B;  3C94 A;  2H4T A;  3SQ4 A;  3S9H A;  2P5O A;  4FJM A;  2K5S A;  3CFO A;  4QND A;  4KHN A;  4KHS A;  4X5M A;  4M42 A;  3J27 A;  2OYQ A;  3SUN A;  4GAM C;  4M3R A;  4DTO A;  1FYZ E;  3N1B A;  4FJ8 A;  4M3U A;  4M3Y A;  3SPZ A;  3NHG A;  4ICG C;  4M3T A;  5IBK B;  5IRE A;  1XVD E;  2VJ5 A;  1MTY G;  1IH7 A;  3UO2 A;  3RMA A;  3RMC A;  3LDB A;  4KHU A;  4QNC A;  2P1P B;  3L1N A;  3TJY A;  1XMG E;  3HL8 A;  4FJL A;  3HGK E;  4J2A A;  1FZ3 E;  3RMD A;  4M3Z A;  3N1E A;  2OVQ B;  5H37 A;  2OZS A;  4J2D A;  4FK0 A;  3SQ2 A;  2DTU A;  4FJI A;  2RCU A;  2P1Q B;  4E4B A;  1WAJ A;  3L0M A;  3SCX A;  4I9Q A;  1XVB E;  4J2B A;  3OGM B;  3C6P B;  1P22 A;  3TAF A;  3QEI A;  2P5G A;  2B1E A;  2ATQ A;  4IT5 A;  2MW2 A;  1WAF A;  1FZ4 E;  1FZ2 E;  5IZ7 A;  4M45 A;  3NDK A;  1FZ7 E;  2DEB A;  3V7D B;  1FZ9 E;  1MHY G;  4RG8 A;  2FW3 A;  4KHQ A;  1FPO A;  4X5N A;  4M3X A;  3QNN A;  1FZ8 E;  2YB5 A;  4HCB A;  3OGK B;  4FJG A;  1FXX A;  4FJ9 A;  4RNG A;  3C95 A;  3SVI A;  3QEX A;  1CLQ A;  1Q9X A;  2OZM A;  1NEX B;  2P1N B;  2LF3 A;  4ADN A;  4DU3 A;  3QES A;  1LDK E;  3LZJ A;  3KD1 E;  4FK4 A;  1XVG E;  3TAE A;  1XVF E;  3C6O B;  1Q9Y A;  3KD5 E;  3SPY A;  4AKI A;  3TL8 B;  3SQ1 A;  4KHY A;  1XVC E;  2LF6 A;  3SQ0 A;  1XMF E;  1FZ5 E;  4DU4 A;  2JQT A;  3QEV A;  4DTR A;  4FJJ A;  2OVR B;  3QET A;  3WSO A;  4J2E A;  2VIX A;  4KHW A;  2E32 A;  3SNN A;  1MHZ G;  4JS5 A;  4FK2 A;  3SUP A;  3SJJ A;  3OGL B;  3L8B A;  4FJX A;  3C6N B;  2FYO A;  2MZW B;  1FZ0 E;  3HGL A;  3LD8 A;  4E3S A;  4FJN A;  2JH8 A;  1IG9 A;  4DU1 A;  2P1M B;  4DTP A;  2MMB A;  1XMH E;  4ADO A;  3RWU A;  1N1C A;  4DTN A;  3QEW A;  1XVE E;  1JW2 A;  3NAE A;  3QNO A;  3LDS A;  4JRQ A;  3NE6 A;  2JHA A;  4DTS A;  3MKS B;  4M41 A;  4B08 A;  4JS4 A;  4DTX A;  4I6J B;  3SUQ A;  3E4Y A;  3L2O B;  3NCI A;  2PFV A;  4HCC A;  4JRP A;  1FS1 A;  3CFP A;  2JPN A;  3CQ8 A;  3K2O A; 
#chains in the Genus database with same CATH homology
 4DTU A;  4KI6 A;  3UIQ A;  1FZH E;  4EYW A;  4DTJ A;  2VJ4 A;  3RMB A;  3J2P A;  4AKG A;  2PFT A;  4EPH A;  2B8I A;  3QEP A;  2JHP A;  3E4W A;  4EP9 A;  4FVM A;  1FZI E;  1FZ1 E;  2JHC A;  4RL5 A;  3SI6 A;  4FJ5 A;  3HP9 A;  1FZ6 E;  2E31 A;  2QXF A;  4DTM A;  2OVP B;  2DY4 A;  4AKH A;  3NGI A;  3CFR A;  4AI6 A;  1XU3 E;  3TAG A;  1XL3 C;  2JH9 A;  2B7M A;  4FJH A;  3QER A;  3SUO A;  4FJ7 A;  3LZI A;  1XU5 E;  4I9L A;  4KI4 A;  2HD0 A;  4FJK A;  4M3W A;  3TAB A;  1MMO G;  2P1O B;  3C94 A;  2H4T A;  3SQ4 A;  3S9H A;  2P5O A;  4FJM A;  3CFO A;  4QND A;  4KHN A;  4KHS A;  4X5M A;  4M42 A;  3J27 A;  2OYQ A;  3SUN A;  4GAM C;  4M3R A;  4DTO A;  1FYZ E;  3N1B A;  4FJ8 A;  4M3U A;  4M3Y A;  3SPZ A;  3NHG A;  4M3T A;  5IBK B;  5IRE A;  1XVD E;  2VJ5 A;  1MTY G;  1IH7 A;  3RMA A;  3RMC A;  3LDB A;  4KHU A;  4QNC A;  2P1P B;  3L1N A;  3TJY A;  1XMG E;  3HL8 A;  4FJL A;  3HGK E;  4J2A A;  1FZ3 E;  3RMD A;  4M3Z A;  3N1E A;  2OVQ B;  5H37 A;  2OZS A;  4J2D A;  4FK0 A;  3SQ2 A;  2DTU A;  4FJI A;  2RCU A;  2P1Q B;  4E4B A;  1WAJ A;  3L0M A;  3SCX A;  4I9Q A;  1XVB E;  4J2B A;  3OGM B;  3C6P B;  1P22 A;  3TAF A;  3QEI A;  2P5G A;  2B1E A;  2ATQ A;  1WAF A;  1FZ4 E;  1FZ2 E;  5IZ7 A;  4M45 A;  3NDK A;  1FZ7 E;  2DEB A;  3V7D B;  1FZ9 E;  1MHY G;  4RG8 A;  2FW3 A;  4KHQ A;  4X5N A;  4M3X A;  3QNN A;  1FZ8 E;  2YB5 A;  4HCB A;  3OGK B;  4FJG A;  1FXX A;  4FJ9 A;  4RNG A;  3C95 A;  3SVI A;  3QEX A;  1CLQ A;  1Q9X A;  2OZM A;  1NEX B;  2P1N B;  2LF3 A;  4ADN A;  4DU3 A;  3QES A;  1LDK E;  3LZJ A;  3KD1 E;  4FK4 A;  1XVG E;  3TAE A;  1XVF E;  3C6O B;  1Q9Y A;  3KD5 E;  3SPY A;  4AKI A;  3TL8 B;  3SQ1 A;  4KHY A;  1XVC E;  2LF6 A;  3SQ0 A;  1XMF E;  1FZ5 E;  4DU4 A;  3QEV A;  4DTR A;  4FJJ A;  2OVR B;  3QET A;  3WSO A;  4J2E A;  2VIX A;  4KHW A;  2E32 A;  3SNN A;  1MHZ G;  4JS5 A;  4FK2 A;  3SUP A;  3SJJ A;  3OGL B;  3L8B A;  4FJX A;  3C6N B;  2FYO A;  2MZW B;  1FZ0 E;  3HGL A;  3LD8 A;  4E3S A;  4FJN A;  2JH8 A;  1IG9 A;  4DU1 A;  2P1M B;  4DTP A;  2MMB A;  1XMH E;  4ADO A;  3RWU A;  4DTN A;  3QEW A;  1XVE E;  3NAE A;  3QNO A;  3LDS A;  4JRQ A;  3NE6 A;  2JHA A;  4DTS A;  3MKS B;  4M41 A;  4B08 A;  4JS4 A;  4DTX A;  4I6J B;  3SUQ A;  3E4Y A;  3L2O B;  3NCI A;  2PFV A;  4HCC A;  4JRP A;  1FS1 A;  3CFP A;  2JPN A;  3CQ8 A;  3K2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...