1XL3C

Complex structure of y.pestis virulence factors yopn and tyea
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
88
Chain Sequence
AYDLSEFMGDIVALVDRWAGIHDIEHLANAFSLPTPEIVRFYQDLRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell invasion
molecule keywords Secretion control protein
publication title Three-dimensional structure of a macromolecular assembly that regulates type III secretion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
total genus 28
structure length 88
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09059 TyeA TyeA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.80 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xl3C00
1XL3C
chains in the Genus database with same CATH superfamily
4AKHA 3QESA 1XVBE 4DTPA 1WAFA 4FVMA 3MKSB 4RG8A 1WAJA 4M45A 3CQ8A 3LZJA 3UIQA 2P1NB 4AKIA 2JHPA 3QNNA 2DTUA 1MTYG 5H37A 4FJ8A 3CFRA 2VIXA 3OGKB 1XL3C 4IT5A 3NHGA 4KHQA 1XMHE 1FXXA 4E3SA 3SI6A 3HGKE 2OZMA 3NCIA 2MZWB 2JH9A 1FZ6E 4M3TA 1XVGE 3WSOA 2K5SA 4AI6A 4DTSA 2OVPB 2JHAA 4EPHA 4DU1A 4DTUA 4HCBA 4JS5A 1FZ8E 2DEBA 2E31A 4X5NA 4M3YA 3TABA 1FYZE 3SQ2A 2QXFA 4KHNA 2B1EA 1LDKE 4FJKA 3CFOA 1FZ9E 4GAMC 4FJ7A 3UO2A 2DY4A 1P22A 3KD5E 2YB5A 2P1PB 4DU3A 3N1BA 3LD8A 3SNNA 2OVQB 3SCXA 2OZSA 5IREA 1N1CA 3C6NB 3SPYA 4KHWA 4FJIA 3J27A 1FZ2E 1XMFE 2JPNA 3K2OA 2FW3A 3LDSA 3TAGA 3C6PB 3SUQA 3C6OB 3BVOA 3QEVA 1FZ0E 3L2OB 4J2DA 4ICGC 1FZ7E 3HP9A 4HCCA 2E32A 4FJ5A 2OVRB 3TL8B 3OGMB 4DTOA 4FK4A 3LZIA 4AKGA 2P1QB 4I6JB 3L1NA 2OYQA 4KHYA 1MMOG 4DTMA 3HGLA 3L0MA 4DTXA 3LDBA 4FK0A 3C95A 4RNGA 3SQ4A 3S9HA 2VJ4A 4I9QA 4M41A 5IZ7A 4FJHA 1FZ1E 2RCUA 3C94A 4X5MA 4FJXA 4M42A 3J2PA 3SUPA 5IBKB 1FZ3E 2P5GA 4E4BA 3RMAA 1CLQA 3QNOA 1FZ4E 4J2EA 4EP9A 3E4YA 3SPZA 3QEIA 4B08A 4J2BA 2FYOA 4M3XA 3RMCA 4EYWA 3SUOA 4KHSA 3TAEA 2B7MA 4DU4A 4FK2A 4KI4A 1JW2A 2B8IA 1IH7A 4JRQA 1XU3E 2MW2A 3NE6A 1XU5E 4FJLA 1FZ5E 4M3WA 1FZHE 3RMDA 2MMBA 1XVCE 1FPOA 4M3RA 4ADOA 4FJJA 4DTNA 2P1MB 1XMGE 2LF3A 2VJ5A 3V7DB 4ADNA 3QETA 3SUNA 3SQ1A 2PFTA 4M3ZA 3QEPA 4DTJA 3SJJA 4DTRA 3RMBA 3KD1E 1MHYG 4RL5A 3SVIA 3RWUA 2JHCA 3HL8A 2RKHA 3NDKA 3TAFA 3SQ0A 1Q9XA 4FJGA 2H4TA 4QNCA 3QEWA 2P5OA 3E4WA 3UO3A 1XVEE 2PFVA 1Q9YA 2ATQA 1XVFE 4QNDA 4KI6A 1NEXB 4FJMA 4M3UA 3QEXA 3OGLB 2HD0A 1IG9A 3NAEA 2JQTA 2LF6A 3CFPA 3NGIA 1FZIE 1XVDE 2P1OB 4J2AA 4KHUA 3N1EA 4JRPA 1FS1A 3L8BA 3TJYA 4JS4A 4FJ9A 4FJNA 4I9LA 1MHZG 2JH8A 3QERA
chains in the Genus database with same CATH topology
4AKHA 3QESA 1XVBE 4DTPA 1WAFA 4FVMA 3MKSB 4RG8A 1WAJA 4M45A 3CQ8A 3LZJA 3UIQA 2P1NB 4AKIA 2JHPA 3QNNA 2DTUA 1MTYG 5H37A 4FJ8A 3CFRA 2VIXA 3OGKB 1XL3C 3NHGA 4KHQA 1XMHE 1FXXA 4E3SA 3SI6A 3HGKE 2OZMA 3NCIA 2MZWB 2JH9A 1FZ6E 4M3TA 1XVGE 3WSOA 4AI6A 4DTSA 2OVPB 2JHAA 4EPHA 4DU1A 4DTUA 4HCBA 4JS5A 1FZ8E 2DEBA 2E31A 4X5NA 4M3YA 3TABA 1FYZE 3SQ2A 2QXFA 4KHNA 2B1EA 1LDKE 4FJKA 3CFOA 1FZ9E 4GAMC 4FJ7A 2DY4A 1P22A 3KD5E 2YB5A 2P1PB 4DU3A 3N1BA 3LD8A 3SNNA 2OVQB 3SCXA 2OZSA 5IREA 3SPYA 3C6NB 4KHWA 4FJIA 3J27A 1FZ2E 1XMFE 2JPNA 3K2OA 2FW3A 3LDSA 3TAGA 3C6PB 3SUQA 3C6OB 3QEVA 4J2DA 1FZ0E 3L2OB 1FZ7E 3HP9A 4HCCA 2E32A 4FJ5A 2OVRB 3TL8B 3OGMB 4DTOA 4FK4A 3LZIA 4AKGA 2P1QB 4I6JB 3L1NA 2OYQA 4KHYA 1MMOG 4DTMA 3HGLA 3L0MA 4DTXA 3LDBA 4FK0A 3C95A 4RNGA 3SQ4A 3S9HA 2VJ4A 4I9QA 4M41A 5IZ7A 4FJHA 1FZ1E 2RCUA 3C94A 4X5MA 4FJXA 4M42A 3J2PA 3SUPA 5IBKB 1FZ3E 2P5GA 4E4BA 3RMAA 1CLQA 3QNOA 1FZ4E 4J2EA 4EP9A 3E4YA 3SPZA 3QEIA 4B08A 4J2BA 2FYOA 4M3XA 3RMCA 4EYWA 3SUOA 4KHSA 3TAEA 2B7MA 4DU4A 4FK2A 4KI4A 2B8IA 1IH7A 4JRQA 1XU3E 3NE6A 1XU5E 4FJLA 1FZ5E 4M3WA 1FZHE 3RMDA 2MMBA 1XVCE 4M3RA 4ADOA 4FJJA 4DTNA 2P1MB 1XMGE 2LF3A 2VJ5A 3V7DB 4ADNA 3QETA 3SUNA 3SQ1A 2PFTA 4M3ZA 3QEPA 4DTJA 3SJJA 4DTRA 3RMBA 3KD1E 1MHYG 4RL5A 3SVIA 3RWUA 2JHCA 3HL8A 3NDKA 3TAFA 3SQ0A 1Q9XA 4FJGA 2H4TA 4QNCA 3QEWA 2P5OA 3E4WA 1XVEE 2PFVA 1Q9YA 2ATQA 1XVFE 4QNDA 4KI6A 1NEXB 4FJMA 4M3UA 3QEXA 3OGLB 2HD0A 1IG9A 3NAEA 2LF6A 3CFPA 3NGIA 1FZIE 1XVDE 2P1OB 4J2AA 4KHUA 3N1EA 4JRPA 1FS1A 3L8BA 3TJYA 4JS4A 4FJ9A 4FJNA 4I9LA 1MHZG 2JH8A 3QERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XL3 C; 
#chains in the Genus database with same CATH topology
 4AKH A;  3QES A;  1XVB E;  4DTP A;  1WAF A;  4FVM A;  3MKS B;  4RG8 A;  1WAJ A;  4M45 A;  3CQ8 A;  3LZJ A;  3UIQ A;  2P1N B;  4AKI A;  2JHP A;  3QNN A;  2DTU A;  1MTY G;  5H37 A;  4FJ8 A;  3CFR A;  2VIX A;  3OGK B;  1XL3 C;  4IT5 A;  3NHG A;  4KHQ A;  1XMH E;  1FXX A;  4E3S A;  3SI6 A;  3HGK E;  2OZM A;  3NCI A;  2MZW B;  2JH9 A;  1FZ6 E;  4M3T A;  1XVG E;  3WSO A;  2K5S A;  4AI6 A;  4DTS A;  2OVP B;  2JHA A;  4EPH A;  4DU1 A;  4DTU A;  4HCB A;  4JS5 A;  1FZ8 E;  2DEB A;  2E31 A;  4X5N A;  4M3Y A;  3TAB A;  1FYZ E;  3SQ2 A;  2QXF A;  4KHN A;  2B1E A;  1LDK E;  4FJK A;  3CFO A;  1FZ9 E;  4GAM C;  4FJ7 A;  3UO2 A;  2DY4 A;  1P22 A;  3KD5 E;  2YB5 A;  2P1P B;  4DU3 A;  3N1B A;  3LD8 A;  3SNN A;  2OVQ B;  3SCX A;  2OZS A;  5IRE A;  1N1C A;  3C6N B;  3SPY A;  4KHW A;  4FJI A;  3J27 A;  1FZ2 E;  1XMF E;  2JPN A;  3K2O A;  2FW3 A;  3LDS A;  3TAG A;  3C6P B;  3SUQ A;  3C6O B;  3BVO A;  3QEV A;  1FZ0 E;  3L2O B;  4J2D A;  4ICG C;  1FZ7 E;  3HP9 A;  4HCC A;  2E32 A;  4FJ5 A;  2OVR B;  3TL8 B;  3OGM B;  4DTO A;  4FK4 A;  3LZI A;  4AKG A;  2P1Q B;  4I6J B;  3L1N A;  2OYQ A;  4KHY A;  1MMO G;  4DTM A;  3HGL A;  3L0M A;  4DTX A;  3LDB A;  4FK0 A;  3C95 A;  4RNG A;  3SQ4 A;  3S9H A;  2VJ4 A;  4I9Q A;  4M41 A;  5IZ7 A;  4FJH A;  1FZ1 E;  2RCU A;  3C94 A;  4X5M A;  4FJX A;  4M42 A;  3J2P A;  3SUP A;  5IBK B;  1FZ3 E;  2P5G A;  4E4B A;  3RMA A;  1CLQ A;  3QNO A;  1FZ4 E;  4J2E A;  4EP9 A;  3E4Y A;  3SPZ A;  3QEI A;  4B08 A;  4J2B A;  2FYO A;  4M3X A;  3RMC A;  4EYW A;  3SUO A;  4KHS A;  3TAE A;  2B7M A;  4DU4 A;  4FK2 A;  4KI4 A;  1JW2 A;  2B8I A;  1IH7 A;  4JRQ A;  1XU3 E;  2MW2 A;  3NE6 A;  1XU5 E;  4FJL A;  1FZ5 E;  4M3W A;  1FZH E;  3RMD A;  2MMB A;  1XVC E;  1FPO A;  4M3R A;  4ADO A;  4FJJ A;  4DTN A;  2P1M B;  1XMG E;  2LF3 A;  2VJ5 A;  3V7D B;  4ADN A;  3QET A;  3SUN A;  3SQ1 A;  2PFT A;  4M3Z A;  3QEP A;  4DTJ A;  3SJJ A;  4DTR A;  3RMB A;  3KD1 E;  1MHY G;  4RL5 A;  3SVI A;  3RWU A;  2JHC A;  3HL8 A;  2RKH A;  3NDK A;  3TAF A;  3SQ0 A;  1Q9X A;  4FJG A;  2H4T A;  4QNC A;  3QEW A;  2P5O A;  3E4W A;  3UO3 A;  1XVE E;  2PFV A;  1Q9Y A;  2ATQ A;  1XVF E;  4QND A;  4KI6 A;  1NEX B;  4FJM A;  4M3U A;  3QEX A;  3OGL B;  2HD0 A;  1IG9 A;  3NAE A;  2JQT A;  2LF6 A;  3CFP A;  3NGI A;  1FZI E;  1XVD E;  2P1O B;  4J2A A;  4KHU A;  3N1E A;  4JRP A;  1FS1 A;  3L8B A;  3TJY A;  4JS4 A;  4FJ9 A;  4FJN A;  4I9L A;  1MHZ G;  2JH8 A;  3QER A; 
#chains in the Genus database with same CATH homology
 4AKH A;  3QES A;  1XVB E;  4DTP A;  1WAF A;  4FVM A;  3MKS B;  4RG8 A;  1WAJ A;  4M45 A;  3CQ8 A;  3LZJ A;  3UIQ A;  2P1N B;  4AKI A;  2JHP A;  3QNN A;  2DTU A;  1MTY G;  5H37 A;  4FJ8 A;  3CFR A;  2VIX A;  3OGK B;  1XL3 C;  3NHG A;  4KHQ A;  1XMH E;  1FXX A;  4E3S A;  3SI6 A;  3HGK E;  2OZM A;  3NCI A;  2MZW B;  2JH9 A;  1FZ6 E;  4M3T A;  1XVG E;  3WSO A;  4AI6 A;  4DTS A;  2OVP B;  2JHA A;  4EPH A;  4DU1 A;  4DTU A;  4HCB A;  4JS5 A;  1FZ8 E;  2DEB A;  2E31 A;  4X5N A;  4M3Y A;  3TAB A;  1FYZ E;  3SQ2 A;  2QXF A;  4KHN A;  2B1E A;  1LDK E;  4FJK A;  3CFO A;  1FZ9 E;  4GAM C;  4FJ7 A;  2DY4 A;  1P22 A;  3KD5 E;  2YB5 A;  2P1P B;  4DU3 A;  3N1B A;  3LD8 A;  3SNN A;  2OVQ B;  3SCX A;  2OZS A;  5IRE A;  3SPY A;  3C6N B;  4KHW A;  4FJI A;  3J27 A;  1FZ2 E;  1XMF E;  2JPN A;  3K2O A;  2FW3 A;  3LDS A;  3TAG A;  3C6P B;  3SUQ A;  3C6O B;  3QEV A;  4J2D A;  1FZ0 E;  3L2O B;  1FZ7 E;  3HP9 A;  4HCC A;  2E32 A;  4FJ5 A;  2OVR B;  3TL8 B;  3OGM B;  4DTO A;  4FK4 A;  3LZI A;  4AKG A;  2P1Q B;  4I6J B;  3L1N A;  2OYQ A;  4KHY A;  1MMO G;  4DTM A;  3HGL A;  3L0M A;  4DTX A;  3LDB A;  4FK0 A;  3C95 A;  4RNG A;  3SQ4 A;  3S9H A;  2VJ4 A;  4I9Q A;  4M41 A;  5IZ7 A;  4FJH A;  1FZ1 E;  2RCU A;  3C94 A;  4X5M A;  4FJX A;  4M42 A;  3J2P A;  3SUP A;  5IBK B;  1FZ3 E;  2P5G A;  4E4B A;  3RMA A;  1CLQ A;  3QNO A;  1FZ4 E;  4J2E A;  4EP9 A;  3E4Y A;  3SPZ A;  3QEI A;  4B08 A;  4J2B A;  2FYO A;  4M3X A;  3RMC A;  4EYW A;  3SUO A;  4KHS A;  3TAE A;  2B7M A;  4DU4 A;  4FK2 A;  4KI4 A;  2B8I A;  1IH7 A;  4JRQ A;  1XU3 E;  3NE6 A;  1XU5 E;  4FJL A;  1FZ5 E;  4M3W A;  1FZH E;  3RMD A;  2MMB A;  1XVC E;  4M3R A;  4ADO A;  4FJJ A;  4DTN A;  2P1M B;  1XMG E;  2LF3 A;  2VJ5 A;  3V7D B;  4ADN A;  3QET A;  3SUN A;  3SQ1 A;  2PFT A;  4M3Z A;  3QEP A;  4DTJ A;  3SJJ A;  4DTR A;  3RMB A;  3KD1 E;  1MHY G;  4RL5 A;  3SVI A;  3RWU A;  2JHC A;  3HL8 A;  3NDK A;  3TAF A;  3SQ0 A;  1Q9X A;  4FJG A;  2H4T A;  4QNC A;  3QEW A;  2P5O A;  3E4W A;  1XVE E;  2PFV A;  1Q9Y A;  2ATQ A;  1XVF E;  4QND A;  4KI6 A;  1NEX B;  4FJM A;  4M3U A;  3QEX A;  3OGL B;  2HD0 A;  1IG9 A;  3NAE A;  2LF6 A;  3CFP A;  3NGI A;  1FZI E;  1XVD E;  2P1O B;  4J2A A;  4KHU A;  3N1E A;  4JRP A;  1FS1 A;  3L8B A;  3TJY A;  4JS4 A;  4FJ9 A;  4FJN A;  4I9L A;  1MHZ G;  2JH8 A;  3QER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...