1XL3C

Complex structure of y.pestis virulence factors yopn and tyea
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
88
Chain Sequence
AYDLSEFMGDIVALVDRWAGIHDIEHLANAFSLPTPEIVRFYQDLRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secretion control protein
publication title Three-dimensional structure of a macromolecular assembly that regulates type III secretion in Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell invasion
total genus 28
structure length 88
sequence length 91
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09059 TyeA TyeA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.80 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 1xl3C00
1XL3C
chains in the Genus database with same CATH superfamily
3J2PA 4X5NA 4J2DA 2JH9A 3UO2A 4FJMA 1FS1A 2B8IA 4DTUA 3RMAA 3QEVA 3BVOA 4EP9A 4DTXA 3SNNA 2P1MB 3HGLA 3N1BA 1XVEE 4KHUA 1FZ1E 2PFVA 3C6PB 4ADOA 2OZMA 2E32A 3MKSB 3CQ8A 3C6OB 4KI6A 4FJ7A 2P1PB 4KHQA 5IBKB 1FZ3E 2VIXA 4AKHA 3SUPA 1MMOG 3NE6A 4RG8A 4FJGA 2FW3A 4M41A 4FJNA 1FPOA 4DTJA 4M3TA 3C95A 4M3WA 4E3SA 3NDKA 3QNOA 4FJLA 4B08A 1FZ6E 2RCUA 2JHAA 4M45A 3V7DB 3SUOA 4AI6A 3E4WA 2LF6A 1MHZG 2QXFA 1XMHE 4I9LA 5H37A 3QNNA 3QEXA 3KD1E 4IT5A 2MMBA 1XL3C 4FJ8A 4GAMC 3OGLB 3C94A 4AKIA 3OGMB 3NCIA 2P5GA 3SQ0A 3QEWA 1WAFA 3LD8A 4RL5A 3KD5E 2DTUA 2K5SA 2OVRB 2DEBA 4ICGC 2OVQB 2HD0A 4FJKA 2P1QB 3HP9A 5IREA 3SVIA 4JS5A 4DTMA 3SJJA 2OYQA 4EYWA 4HCBA 3SPZA 1XMGE 4KHNA 4M3UA 1FZ9E 1XVDE 2JHCA 3SUNA 3TJYA 3CFRA 3SUQA 4EPHA 1Q9XA 1XU5E 3NHGA 3NGIA 4J2AA 3LDSA 4J2EA 4RNGA 3LZIA 2VJ5A 1FZ8E 4DTNA 4I6JB 2P1NB 3RMDA 3L1NA 2P5OA 4DTOA 4KI4A 3E4YA 1FZHE 4QNDA 4JS4A 4M3ZA 3S9HA 1FZ2E 2JQTA 4X5MA 1XVCE 4FJIA 2JPNA 4DU4A 2PFTA 5IZ7A 1XVGE 3WSOA 1XVBE 3LDBA 3QETA 1MHYG 4DTRA 4DU1A 3SPYA 1FZIE 4FVMA 4HCCA 3RMCA 3L0MA 3TABA 4DTPA 3UIQA 2YB5A 4FJJA 2DY4A 1XU3E 2MW2A 3SQ4A 2FYOA 3SQ1A 4KHYA 4AKGA 2B1EA 3N1EA 3NAEA 3TAFA 2JH8A 3L8BA 2E31A 4J2BA 3RMBA 4M42A 3J27A 4JRQA 3QEPA 4FK0A 3SQ2A 4FJXA 3TAGA 2H4TA 2ATQA 1N1CA 3HGKE 4ADNA 2VJ4A 3LZJA 3SI6A 4KHWA 2P1OB 1JW2A 4JRPA 2LF3A 4FK2A 3QEIA 3C6NB 2JHPA 1P22A 1FZ7E 2B7MA 1FZ0E 3QESA 4FJ9A 1FXXA 3UO3A 1LDKE 4DTSA 1FYZE 3TL8B 4QNCA 3CFOA 4M3YA 3HL8A 4FJHA 3RWUA 4FJ5A 4KHSA 3QERA 2MZWB 4DU3A 3SCXA 4M3XA 4FK4A 1CLQA 3TAEA 1WAJA 1XVFE 1NEXB 1IG9A 1FZ4E 1FZ5E 3OGKB 2OZSA 3K2OA 2RKHA 1MTYG 1Q9YA 3CFPA 2OVPB 4M3RA 4I9QA 4E4BA 1IH7A 3L2OB 1XMFE
chains in the Genus database with same CATH topology
3J2PA 4X5NA 4J2DA 2JH9A 4FJMA 1FS1A 2B8IA 4DTUA 3RMAA 3QEVA 4EP9A 4DTXA 3SNNA 2P1MB 3HGLA 3N1BA 1XVEE 4KHUA 1FZ1E 2PFVA 3C6PB 4ADOA 2OZMA 2E32A 3MKSB 3CQ8A 3C6OB 4KI6A 4FJ7A 2P1PB 4KHQA 5IBKB 1FZ3E 2VIXA 4AKHA 3SUPA 1MMOG 3NE6A 4RG8A 4FJGA 2FW3A 4M41A 4FJNA 4DTJA 4M3TA 3C95A 4M3WA 4E3SA 3NDKA 3QNOA 4FJLA 4B08A 1FZ6E 2RCUA 2JHAA 4M45A 3V7DB 3SUOA 4AI6A 3E4WA 2LF6A 1MHZG 2QXFA 1XMHE 4I9LA 5H37A 3QNNA 3QEXA 3KD1E 2MMBA 1XL3C 4FJ8A 4GAMC 3OGLB 3C94A 4AKIA 3OGMB 3NCIA 2P5GA 3SQ0A 3QEWA 1WAFA 3LD8A 4RL5A 3KD5E 2DTUA 2OVQB 2OVRB 2DEBA 2HD0A 4FJKA 2P1QB 3HP9A 5IREA 3SVIA 4JS5A 4DTMA 3SJJA 2OYQA 4EYWA 4HCBA 3SPZA 1XMGE 4KHNA 4M3UA 1FZ9E 1XVDE 2JHCA 3SUNA 3TJYA 3CFRA 3SUQA 4EPHA 1Q9XA 1XU5E 3NHGA 3NGIA 4J2AA 3LDSA 4J2EA 4RNGA 3LZIA 2VJ5A 1FZ8E 4DTNA 4I6JB 2P1NB 3RMDA 3L1NA 2P5OA 4DTOA 4KI4A 3E4YA 1FZHE 4QNDA 4JS4A 4M3ZA 3S9HA 1FZ2E 4X5MA 1XVCE 4FJIA 2JPNA 4DU4A 2PFTA 5IZ7A 1XVGE 3WSOA 1XVBE 3LDBA 3QETA 1MHYG 4DTRA 4DU1A 3SPYA 1FZIE 4FVMA 4HCCA 3RMCA 3L0MA 3TABA 4DTPA 3UIQA 2YB5A 4FJJA 2DY4A 1XU3E 3SQ4A 3SQ1A 2FYOA 4KHYA 4AKGA 2B1EA 3N1EA 3NAEA 3TAFA 2JH8A 3L8BA 2E31A 4J2BA 3RMBA 4M42A 3J27A 4JRQA 3QEPA 4FK0A 3SQ2A 4FJXA 3TAGA 2H4TA 2ATQA 3HGKE 4ADNA 2VJ4A 3LZJA 3SI6A 4KHWA 2P1OB 4JRPA 2LF3A 4FK2A 3QEIA 3C6NB 2JHPA 1P22A 1FZ7E 2B7MA 1FZ0E 3QESA 4FJ9A 1FXXA 1LDKE 4DTSA 1FYZE 3TL8B 4QNCA 3CFOA 4M3YA 3HL8A 4FJHA 3RWUA 4FJ5A 4KHSA 3QERA 2MZWB 4DU3A 3SCXA 4M3XA 4FK4A 1CLQA 3TAEA 1WAJA 1XVFE 1NEXB 1IG9A 1FZ4E 1FZ5E 3OGKB 2OZSA 3K2OA 1MTYG 1Q9YA 3CFPA 2OVPB 4M3RA 4I9QA 4E4BA 1IH7A 3L2OB 1XMFE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XL3 C; 
#chains in the Genus database with same CATH topology
 3J2P A;  4X5N A;  4J2D A;  2JH9 A;  3UO2 A;  4FJM A;  1FS1 A;  2B8I A;  4DTU A;  3RMA A;  3QEV A;  3BVO A;  4EP9 A;  4DTX A;  3SNN A;  2P1M B;  3HGL A;  3N1B A;  1XVE E;  4KHU A;  1FZ1 E;  2PFV A;  3C6P B;  4ADO A;  2OZM A;  2E32 A;  3MKS B;  3CQ8 A;  3C6O B;  4KI6 A;  4FJ7 A;  2P1P B;  4KHQ A;  5IBK B;  1FZ3 E;  2VIX A;  4AKH A;  3SUP A;  1MMO G;  3NE6 A;  4RG8 A;  4FJG A;  2FW3 A;  4M41 A;  4FJN A;  1FPO A;  4DTJ A;  4M3T A;  3C95 A;  4M3W A;  4E3S A;  3NDK A;  3QNO A;  4FJL A;  4B08 A;  1FZ6 E;  2RCU A;  2JHA A;  4M45 A;  3V7D B;  3SUO A;  4AI6 A;  3E4W A;  2LF6 A;  1MHZ G;  2QXF A;  1XMH E;  4I9L A;  5H37 A;  3QNN A;  3QEX A;  3KD1 E;  4IT5 A;  2MMB A;  1XL3 C;  4FJ8 A;  4GAM C;  3OGL B;  3C94 A;  4AKI A;  3OGM B;  3NCI A;  2P5G A;  3SQ0 A;  3QEW A;  1WAF A;  3LD8 A;  4RL5 A;  3KD5 E;  2DTU A;  2K5S A;  2OVR B;  2DEB A;  4ICG C;  2OVQ B;  2HD0 A;  4FJK A;  2P1Q B;  3HP9 A;  5IRE A;  3SVI A;  4JS5 A;  4DTM A;  3SJJ A;  2OYQ A;  4EYW A;  4HCB A;  3SPZ A;  1XMG E;  4KHN A;  4M3U A;  1FZ9 E;  1XVD E;  2JHC A;  3SUN A;  3TJY A;  3CFR A;  3SUQ A;  4EPH A;  1Q9X A;  1XU5 E;  3NHG A;  3NGI A;  4J2A A;  3LDS A;  4J2E A;  4RNG A;  3LZI A;  2VJ5 A;  1FZ8 E;  4DTN A;  4I6J B;  2P1N B;  3RMD A;  3L1N A;  2P5O A;  4DTO A;  4KI4 A;  3E4Y A;  1FZH E;  4QND A;  4JS4 A;  4M3Z A;  3S9H A;  1FZ2 E;  2JQT A;  4X5M A;  1XVC E;  4FJI A;  2JPN A;  4DU4 A;  2PFT A;  5IZ7 A;  1XVG E;  3WSO A;  1XVB E;  3LDB A;  3QET A;  1MHY G;  4DTR A;  4DU1 A;  3SPY A;  1FZI E;  4FVM A;  4HCC A;  3RMC A;  3L0M A;  3TAB A;  4DTP A;  3UIQ A;  2YB5 A;  4FJJ A;  2DY4 A;  1XU3 E;  2MW2 A;  3SQ4 A;  2FYO A;  3SQ1 A;  4KHY A;  4AKG A;  2B1E A;  3N1E A;  3NAE A;  3TAF A;  2JH8 A;  3L8B A;  2E31 A;  4J2B A;  3RMB A;  4M42 A;  3J27 A;  4JRQ A;  3QEP A;  4FK0 A;  3SQ2 A;  4FJX A;  3TAG A;  2H4T A;  2ATQ A;  1N1C A;  3HGK E;  4ADN A;  2VJ4 A;  3LZJ A;  3SI6 A;  4KHW A;  2P1O B;  1JW2 A;  4JRP A;  2LF3 A;  4FK2 A;  3QEI A;  3C6N B;  2JHP A;  1P22 A;  1FZ7 E;  2B7M A;  1FZ0 E;  3QES A;  4FJ9 A;  1FXX A;  3UO3 A;  1LDK E;  4DTS A;  1FYZ E;  3TL8 B;  4QNC A;  3CFO A;  4M3Y A;  3HL8 A;  4FJH A;  3RWU A;  4FJ5 A;  4KHS A;  3QER A;  2MZW B;  4DU3 A;  3SCX A;  4M3X A;  4FK4 A;  1CLQ A;  3TAE A;  1WAJ A;  1XVF E;  1NEX B;  1IG9 A;  1FZ4 E;  1FZ5 E;  3OGK B;  2OZS A;  3K2O A;  2RKH A;  1MTY G;  1Q9Y A;  3CFP A;  2OVP B;  4M3R A;  4I9Q A;  4E4B A;  1IH7 A;  3L2O B;  1XMF E; 
#chains in the Genus database with same CATH homology
 3J2P A;  4X5N A;  4J2D A;  2JH9 A;  4FJM A;  1FS1 A;  2B8I A;  4DTU A;  3RMA A;  3QEV A;  4EP9 A;  4DTX A;  3SNN A;  2P1M B;  3HGL A;  3N1B A;  1XVE E;  4KHU A;  1FZ1 E;  2PFV A;  3C6P B;  4ADO A;  2OZM A;  2E32 A;  3MKS B;  3CQ8 A;  3C6O B;  4KI6 A;  4FJ7 A;  2P1P B;  4KHQ A;  5IBK B;  1FZ3 E;  2VIX A;  4AKH A;  3SUP A;  1MMO G;  3NE6 A;  4RG8 A;  4FJG A;  2FW3 A;  4M41 A;  4FJN A;  4DTJ A;  4M3T A;  3C95 A;  4M3W A;  4E3S A;  3NDK A;  3QNO A;  4FJL A;  4B08 A;  1FZ6 E;  2RCU A;  2JHA A;  4M45 A;  3V7D B;  3SUO A;  4AI6 A;  3E4W A;  2LF6 A;  1MHZ G;  2QXF A;  1XMH E;  4I9L A;  5H37 A;  3QNN A;  3QEX A;  3KD1 E;  2MMB A;  1XL3 C;  4FJ8 A;  4GAM C;  3OGL B;  3C94 A;  4AKI A;  3OGM B;  3NCI A;  2P5G A;  3SQ0 A;  3QEW A;  1WAF A;  3LD8 A;  4RL5 A;  3KD5 E;  2DTU A;  2OVQ B;  2OVR B;  2DEB A;  2HD0 A;  4FJK A;  2P1Q B;  3HP9 A;  5IRE A;  3SVI A;  4JS5 A;  4DTM A;  3SJJ A;  2OYQ A;  4EYW A;  4HCB A;  3SPZ A;  1XMG E;  4KHN A;  4M3U A;  1FZ9 E;  1XVD E;  2JHC A;  3SUN A;  3TJY A;  3CFR A;  3SUQ A;  4EPH A;  1Q9X A;  1XU5 E;  3NHG A;  3NGI A;  4J2A A;  3LDS A;  4J2E A;  4RNG A;  3LZI A;  2VJ5 A;  1FZ8 E;  4DTN A;  4I6J B;  2P1N B;  3RMD A;  3L1N A;  2P5O A;  4DTO A;  4KI4 A;  3E4Y A;  1FZH E;  4QND A;  4JS4 A;  4M3Z A;  3S9H A;  1FZ2 E;  4X5M A;  1XVC E;  4FJI A;  2JPN A;  4DU4 A;  2PFT A;  5IZ7 A;  1XVG E;  3WSO A;  1XVB E;  3LDB A;  3QET A;  1MHY G;  4DTR A;  4DU1 A;  3SPY A;  1FZI E;  4FVM A;  4HCC A;  3RMC A;  3L0M A;  3TAB A;  4DTP A;  3UIQ A;  2YB5 A;  4FJJ A;  2DY4 A;  1XU3 E;  3SQ4 A;  3SQ1 A;  2FYO A;  4KHY A;  4AKG A;  2B1E A;  3N1E A;  3NAE A;  3TAF A;  2JH8 A;  3L8B A;  2E31 A;  4J2B A;  3RMB A;  4M42 A;  3J27 A;  4JRQ A;  3QEP A;  4FK0 A;  3SQ2 A;  4FJX A;  3TAG A;  2H4T A;  2ATQ A;  3HGK E;  4ADN A;  2VJ4 A;  3LZJ A;  3SI6 A;  4KHW A;  2P1O B;  4JRP A;  2LF3 A;  4FK2 A;  3QEI A;  3C6N B;  2JHP A;  1P22 A;  1FZ7 E;  2B7M A;  1FZ0 E;  3QES A;  4FJ9 A;  1FXX A;  1LDK E;  4DTS A;  1FYZ E;  3TL8 B;  4QNC A;  3CFO A;  4M3Y A;  3HL8 A;  4FJH A;  3RWU A;  4FJ5 A;  4KHS A;  3QER A;  2MZW B;  4DU3 A;  3SCX A;  4M3X A;  4FK4 A;  1CLQ A;  3TAE A;  1WAJ A;  1XVF E;  1NEX B;  1IG9 A;  1FZ4 E;  1FZ5 E;  3OGK B;  2OZS A;  3K2O A;  1MTY G;  1Q9Y A;  3CFP A;  2OVP B;  4M3R A;  4I9Q A;  4E4B A;  1IH7 A;  3L2O B;  1XMF E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...