2OVQB

Structure of the skp1-fbw7-cyclinedegc complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
444
structure length
444
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
total genus 126
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovqB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovqB02
2CN3A 4J8GA 3B7FA 4D0KA 3SHFA 3BWSA 3AFCA 4GM9A 3SN6B 3GFCA 5AJAA 1SHYB 5TDHB 3BG1A 5C2WB 3MMYA 1B9XA 5EALA 2XU7A 3EI4A 4PC0A 2AQ5A 2AH0A 5IBKB 1R5MA 4ERYA 3SLED 3RN0D 3PXTD 4JT5C 3RSEC 4E5ZA 4BH6A 3WSOA 4GMBA 4JSXC 3UVKA 3DXKC 4KFMB 3PE7A 5C9ZB 4A08B 3OGKB 1PGUA 3I7HA 4ZOYA 3C99A 4QT8A 4X3EA 4J82A 4PXWA 1XKSA 3UVLA 4A0AB 2OIZA 3RN1D 4J77A 4CC9A 3L2OB 4UI9R 3EWEA 5K19A 2OJYA 3EI1A 3OGMB 2E32A 4X63B 3NVNA 4PNKB 3UVMA 3C75H 2PM6B 4PSWB 2H9NA 2O9KA 3SMRA 1OMWB 5KDOB 4GZ8A 1K32A 3JZGA 1GP2B 3OL2A 3MXXA 2Z2OA 2IUVA 4HDJA 2B5NA 2P9SC 4QQEA 1PI6A 5AMSA 4A2MA 3FGBA 2TRCB 5HQGA 5CXBA 2XL2A 4AOWA 4JSPC 2AGZA 4QRJA 3L4OD 3MKSB 3I2NA 2P1NB 3A0FA 1TYQC 2MTAH 4U7AA 4JT6C 4FA4D 4QL1A 4K3ID 3JZHA 3EI4B 1MG3A 4R7AB 2W18A 4FA5D 4LG9A 3JRPA 3SWSD 2GC7A 5GMKn 4ZOVA 4TZ4A 3L4MD 3OKTA 2H6QA 4ZOZA 3I7NA 2IURA 2OVRB 4A09A 5IJ8E 2PBIB 3P4FA 3AL8A 4ERZA 4J79A 4J78A 5SXMA 1L0QA 2I0SA 1SQJA 4L9OA 4PSXB 3EI1B 3IIWA 4CY3A 3V5WB 4I79A 4XYIA 5GXHA 3NVXA 3OKYA 2HJBA 5IJ7E 3W15A 4J0XA 2B5MA 4PBZA 1RI6A 2CE8A 4CY2A 4ZN4A 3EI2A 2OVQB 3PVUB 3EI3A 1Q47A 4CY5A 5FKSA 5I5MA 2HESX 3RFGA 3I7KA 3UKRC 5EMKB 1MG2A 1B9YA 2CO0A 3OTTA 3IKOA 4GGCA 4BL0A 2EBSA 3BG0A 1N6DA 3MKQA 4A0BA 4GGAA 2QC5A 5B4WA 4FA1D 3I7OA 3HFQA 4O1QD 5I5IA 4IMMA 3KRWB 3SCYA 5FKQA 1PBYB 5FKRA 3IJ1A 2YB8B 4K3JB 4CI3A 2J56H 5GSAA 4LG8A 4A09B 3RFHA 5EAMA 3AL8B 2IAAA 1P22A 4GM3A 3VH0A 1LDKE 3PSCB 2H13A 3OKYB 2AGYA 1NEXB 1YFQA 5FA5B 2HKRA 3AL9A 2H3XA 4BUJC 3EI2B 4J8BA 5EARA 5H14A 2YNOA 4OZUA 2OVPB 4CI2A 2HXCA 4XYHA 4CZXA 3IIYA 1JMXB 3SVWD 4E54A 4JSVC 2IUPA 3IJ0A 3I7LA 5CYKA 5EMJB 1N6EA 5IT9g 5I5JA 5K1CC 2B4EA 3FRXA 3NVQA 2AGXA 4GM8A 4YVDA 3SBRA 2YBAA 1U4CA 5FXYA 2HJ4A 2UZYB 2XL3A 2Q7QA 4L3GD 2CO0C 4GGDA 3JAMg 5EM2A 5TEFA 4GQBB 3V9FA 4E5ZB 1SQ9A 3V7DB 2E31A 4FHLA 2H68A 3SBPA 2G9AA 5IGOA 2GC4A 2AGWA 4X60B 1JOFA 2J55H 2H9MA 4GQ2P 3K26A 3F3PA 2P9UC 5AFU3 4I6JB 2I0TA 3E0CA 1N6FA 5GXIA 4ES0A 1GOTB 3F3GA 4J0WA 3SXTD 2P1QB 2B5LA 3DXMC 2P1MB 2GNQA 2OK6A 2H9PA 4FB1D 1GXRA 2YNPA 4FAND 3OL2B 2I3TA 2BBKH 4L1QD 4ZOXA 4FAVD 2HYEA 3VA6A 3N0DA 3PSLA 4CI1A 4J87A 2P9IC 2P1PB 4E54B 3I8EA 5CYKB 4EWRA 4J84A 3I8CA 3OGLB 5CXBB 5TF2A 3ULEC 4JSNC 3DSMA 1NR0A 1QNIA 5EMMB 3I89A 2I3SA 4FWWA 3RRMC 4J86A 2BCJB 3EMHA 3ODTA 3UVNA 1S4UX 4CZVA 4LGNA 2CE9A 3JB9L 4NSXA 3SBQA 5EM2B 3DM0A 2OK4A 5CXCA 3EG6A 3MZLA 5FLXg 5TEEA 2H6KA 1K8KC 2P9KC 3UVOA 1A0RB 1JMZB 4FA9D 4N14A 5EMLB 2PM7B 1XHMA 3C5MA 1ERJA 3PXSD 3U4YA 1GG2B 3C6PB 1FS1A 4JD2C 5HE0B 2PM9A 5HE1B 5H17A 4ESGA 2P9PC 2H47A 3JZNA 4A11A 4CI8A 3EU7A 2P9LC 2I0RA 3EI3B 3CFVA 4A7JA 3UR4A 2QXVA 4OWRA 5FKTA 4H5JA 3C6NB 3C6OB 3RMZD 5IC7A 2P1OB 2CNXA 4A0BB 2G99A 4J81A 3JPXA 4A2LA 3ORVD 1OLZA 3PVWB 3GREA 3UKUC 3ZWLB 1MDAH 5EAPA 5FQDA 2YMUA 2CN2A 3FM0A 5CXCB 3I7PA 4O3UB 5THAA 5HYNB 3CFSB 3CIKB 4H5IA 3SFZA 4CZYA 4GQ1A 5JWZA 4U1EI 4PBYA 2HKMA 2AH1A 3KRXB 3VGZA 4IA9A 2XYIA 4O9DA 1FWXA 2P9NC 4XEIC 1PEVA 4MK0B 5C2VB 2H14A 2PM9B 3N0EA 4D6VA 3RLMD 3AH8B 4AEZA 4G56B 1VYHC 2IWFA 3MZKA 5HE3B 5H1MA 3JROA 1TBGA 4A11B 4ERQA 4J73A 3C9CA 4Z8LA 2J57G 4O45A 4A08A 1XIPA 2AGLA 4X61B 5HE2B 5IGQA 2IUQA 2YNNA 4A0AA 4CY1A 1U2VC 2Z2NA 4Y7RA 5A2Qg 3SJLD 2UZXB 2Z2PA 3J81g 3IJCA 3OKWA 3OW8A 3J80g 4L3HD 3F3FA 1JJUB 2IWKA 3DWLC 4Y5RD 4JXMA 4O3TB 2H9LA 3PXWD 2H6NA 3K27A
chains in the Genus database with same CATH superfamily
2CN3A 3MVDK 4J8GA 3ZDXA 1T2XA 3B7FA 3HGKE 4D0KA 4DTRA 4KHNA 3SHFA 4M3YA 3BWSA 3AFCA 4GM9A 5E6RA 3SN6B 1K3IA 3GFCA 5AJAA 2VDKA 3BVOA 3QEXA 2P5OA 1SHYB 4O2WA 3BG1A 3LD8A 3NIGA 5TDHB 3O4JA 2FW3A 2LF6A 1Q9YA 1QFMA 5C2WB 3NAEA 3MMYA 3IJEA 1B9XA 4RE6A 2XU7A 5EALA 3EI4A 4PC0A 2AQ5A 1WAFA 2AH0A 1WAJA 5IBKB 4JHPC 1R5MA 4ERYA 3QERA 3SLED 3RN0D 3PXTD 4JT5C 4X5MA 3RSEC 4E5ZA 2K5SA 4BH6A 3WSOA 4GMBA 4JSXC 2VDNA 3UVKA 3DXKC 4KFMB 3PE7A 4WK4A 5C9ZB 3OGKB 1PGUA 3I7HA 2VZ1A 3T3MA 3C99A 4QT8A 4X3EA 4ZOYA 4J82A 4DTPA 4PXWA 4JRPA 3SI6A 1XVCE 1XKSA 3UVLA 3QEIA 2OIZA 4A0AB 3RN1D 3IUNA 2EIEA 4J77A 4CC9A 3L2OB 4UI9R 2VZ3A 3EWEA 2QR5A 4M3UA 2OJYA 5K19A 3EI1A 3SQ0A 3V4PA 3OGMB 1IH7A 2E32A 2XE4A 4X63B 3NVNA 4M3ZA 4MMXA 4PNKB 4GAMC 3E4YA 3UVMA 3C75H 4QNDA 4KHSA 4HCCA 4FJKA 2PM6B 4PSWB 2H9NA 5IZ7A 2O9KA 4IRZA 3SMRA 1OMWB 5KDOB 2EIBA 4GZ8A 3N1BA 2YB5A 3QESA 1GP2B 1K32A 3QEWA 3JZGA 3MXXA 3OL2A 4JHNA 2Z2OA 4BP8A 1FZHE 2EIDA 2VC2A 2IUVA 4EP9A 3KD1E 2VDQA 3J27A 4HDJA 4DNUA 2B5NA 5IREA 1C9LA 2P9SC 4QQEA 1PI6A 5AMSA 4A2MA 3FGBA 4DNVA 2TRCB 5HQGA 4I9QA 1E8NA 1O6GA 5CXBA 2XL2A 3TJYA 4KHWA 3K72A 4AOWA 4JSPC 4J2EA 2AGZA 4QRJA 3L4OD 3TAFA 3MKSB 4KHUA 3I2NA 2HU7A 4WK0A 2P1NB 3A0FA 1TYQC 2MTAH 4U7AA 4JT6C 4FA4D 4QL1A 4B08A 3JZHA 3EI4B 4G1MA 4K3ID 1MG3A 2B8IA 2MMBA 4R7AB 2JPNA 3IULA 3TABA 2W18A 4FA5D 1GOFA 4LG9A 3JRPA 5FFGA 3SWSD 4FJ9A 4FJMA 2GC7A 5GMKn 4ZOVA 4DTXA 4TZ4A 3L4MD 4Z7OA 3OKTA 3LZIA 2H6QA 4ZOZA 3I7NA 2IURA 4EYWA 2OVRB 4JRQA 4A09A 3TAEA 2JHCA 5IJ8E 2PBIB 3P4FA 3AL8A 4FJJA 4ERZA 4J79A 4FVMA 1XVGE 4J78A 5SXMA 1FZ6E 1L0QA 3VI4A 2I0SA 1SQJA 1FPOA 4L9OA 4PSXB 4FJ7A 5M5TA 3EI1B 3TL8B 3IIWA 4CY3A 4ADNA 1I2MB 4M3WA 3V5WB 4I79A 4XYIA 3SCXA 1GOHA 1MMOG 2VDRA 3HP9A 3NVXA 3OKYA 5GXHA 1O6FA 1VE7A 2HJBA 5M61A 5IJ7E 3W15A 4J0XA 2B5MA 1UOPA 1RI6A 2OZSA 2CE8A 2JKXA 2VDLA 3IUMA 4PBZA 4CY2A 4ZN4A 3EI2A 2OVQB 3PVUB 3EI3A 1Q47A 1H2XA 4CY5A 1M1XA 5FKSA 5I5MA 2HESX 3RFGA 3I7KA 2LF3A 3UKRC 5EMKB 1VZ3A 1H2YA 1MG2A 1FZ8E 1B9YA 2CO0A 4ADOA 3OTTA 3IKOA 2JHAA 5E6SA 5HDBA 4GGCA 4BL0A 2EBSA 3BG0A 1N6DA 3MKQA 4NC4A 4A0BA 4GGAA 2QC5A 3EQ9A 1CLQA 1TYEA 4UM9A 5B4WA 3V4VA 4FA1D 3I7OA 3SUPA 3HFQA 4O1QD 4WJKA 4AI6A 3SNNA 4JS4A 5I5IA 4IMMA 3KRWB 3SCYA 5FKQA 4J2AA 5E6UA 3TAGA 4DTMA 4AKHA 1E8MA 1PBYB 5FKRA 4FJNA 1Q9XA 3IJ1A 2YB8B 4G55A 4K3JB 4CI3A 2J56H 5GSAA 4LG8A 4A09B 3RFHA 5EAMA 4AKGA 4DNWA 3AL8B 3ZE1A 3LZJA 2IAAA 1P22A 1FYZE 4AMYA 4GM3A 3VH0A 1XVBE 1LDKE 3N1EA 3NDKA 3PSCB 5M5VA 4QAMA 3UO3A 2H13A 4DU3A 4KHQA 3OKYB 5H37A 2AGYA 1NEXB 3SQ2A 2HD0A 4IT5A 2PFTA 1UOOA 1YFQA 5FA5B 3SUOA 3SVIA 2H3XA 2HKRA 3AL9A 4BUJC 1VZ2A 3EI2B 5C86A 4G1EA 3C94A 4J8BA 5EARA 5H14A 1H2WA 3CFPA 2YNOA 4OZUA 2OVPB 4FK0A 2OYQA 4CI2A 4E4BA 3CQ8A 2HXCA 4XYHA 4CZXA 3IIYA 4DTJA 4JS5A 4J2DA 4NAAA 1JMXB 2RCUA 3SVWD 2JH8A 4E54A 4JSVC 2IUPA 3IJ0A 3I7LA 5CYKA 2PFVA 5EMJB 1N6EA 5IT9g 3ZE2A 4RL5A 3OF7A 5I5JA 3LDSA 5K1CC 4MMYA 2B4EA 2VDPA 3T3PA 4M3RA 4BCDA 3FRXA 2VDOA 3NVQA 2AGXA 2XZGA 4GM8A 3CFRA 4YVDA 4RG8A 3SBRA 1FZ2E 4FJ5A 2YBAA 3SPYA 3KCIA 1U4CA 5FXYA 2HJ4A 2UZYB 2XL3A 2Q7QA 4L3GD 2CO0C 4GGDA 3IUJA 3NIFA 3JAMg 1U8CA 4DTOA 1VE6A 4AX4A 3QHYB 5EM2A 4I9LA 4GQBB 5TEFA 3V9FA 4E5ZB 1SQ9A 4RNGA 3QI0A 3V7DB 2E31A 4FHLA 2H68A 3SBPA 1JV2A 1GOGA 2FYOA 2G9AA 4WK2A 5IGOA 2GC4A 2AGWA 3IUQA 4X60B 1JOFA 4NENA 2J55H 2H9MA 4GQ2P 3GC3B 5M5RA 3K26A 4ICGC 3GD1I 2MZWB 3F3PA 2P9UC 5FFOA 2HU8A 5AFU3 4I6JB 2I0TA 3E0CA 4M41A 2HU5A 1FZIE 4DTUA 1N6FA 5GXIA 1FZ3E 3UIQA 2ATQA 1GOTB 4ES0A 1A12A 4KI4A 3F3GA 4J0WA 3SXTD 2P1QB 4DTSA 2B5LA 3DXMC 2P1MB 2GNQA 2OK6A 2H9PA 3NE6A 1GXRA 4FB1D 4HCBA 4L1MA 1JTDB 2OZMA 2YNPA 4UM8A 4FAND 3OL2B 2I3TA 1FZ0E 4FJ8A 4M3XA 1FZ5E 2BBKH 4L1QD 4ZOXA 1QFSA 4FAVD 3SQ1A 3VA6A 2HYEA 3N0DA 3PSLA 3UO2A 4AN1A 1FZ7E 3L1NA 4CI1A 4J87A 3O4HA 4J2BA 2P9IC 1FZ4E 2P1PB 4E54B 3DDUA 3I8EA 2DTUA 5CYKB 4EWRA 4DU4A 1FZ9E 4J84A 1XMGE 3HGLA 3I8CA 2DY4A 3OGLB 3E4WA 5CXBB 5TF2A 4JSNC 3ULEC 3DSMA 1NR0A 2XDWA 1QNIA 2WQ8A 4RE5A 3I89A 5EMMB 2DEBA 2I3SA 4FWWA 3RRMC 1YR2A 4AKIA 4FJXA 2P5GA 3IURA 3K2OA 3QNNA 2VJ4A 4E3SA 4J86A 2BCJB 3EMHA 3ODTA 3UVNA 1S4UX 4CZVA 4LGNA 2QXFA 2JH9A 4EPHA 4FJHA 2CE9A 4M45A 3JB9L 4NBMA 4NSXA 3SBQA 5EM2B 3DM0A 2OK4A 5CXCA 3EG6A 2EICA 3MZLA 5FLXg 1XVDE 5TEEA 2H6KA 1K8KC 2P9KC 3UVOA 1A0RB 1JMZB 3S9HA 4FA9D 4N14A 2JQTA 4FK4A 5EMLB 2PM7B 1XHMA 3CFOA 3C5MA 3HL8A 3QEVA 1MHYG 1XVEE 3SPZA 1ERJA 3PXSD 1GG2B 3U4YA 1XMFE 3C6PB 1FS1A 4JD2C 5HE0B 1XU3E 3IVMA 2PM9A 5HE1B 5H17A 3FCUA 4ESGA 2P9PC 1FXXA 2H47A 3JZNA 3RMBA 3QEPA 4DTNA 4A11A 2MW2A 4CI8A 3MUNA 3EU7A 2P9LC 3L8BA 2I0RA 3EI3B 1XL3C 3NHGA 3CFVA 4A7JA 4X5NA 3UR4A 3FCSA 2QXVA 3SUNA 4OWRA 5FKTA 4H5JA 1FZ1E 3C6NB 3C6OB 1IG9A 3RMZD 5IC7A 5M5SA 2P1OB 1L5GA 2CNXA 3RWUA 2JHPA 4A0BB 2G99A 4J81A 3JPXA 1N1CA 4A2LA 4AMZA 3ORVD 3RMDA 4M42A 1OLZA 3PVWB 3GREA 3UKUC 3ZWLB 1MDAH 2B1EA 5EAPA 5FQDA 3VI3A 1XMHE 2YMUA 4AN0A 3K6SA 1MHZG 2CN2A 5C92A 3FM0A 3QETA 3SQ4A 1H2ZA 3NGIA 1BPOA 5CXCB 3I7PA 4O3UB 5THAA 4DU1A 3CFSB 3CIKB 5HYNB 4Z7QA 4H5IA 3SUQA 4FJGA 3SFZA 4CZYA 1UTCA 4GQ1A 3ZE0A 3ZDYA 5JWZA 4U1EI 4PBYA 4BP9A 3J2PA 2HKMA 2QZPA 2AH1A 1XVFE 4M3TA 2BKLA 3KRXB 3O4GA 3VGZA 3C95A 4BCBA 4BCCA 2VIXA 4FJIA 3MUOA 3O4IA 4QNCA 4IA9A 2XYIA 4O9DA 1FWXA 2P9NC 4XEIC 1PEVA 1JW2A 4MK0B 5C2VB 2H14A 2PM9B 3N0EA 1XU5E 3NIDA 3RLMD 4D6VA 3AH8B 4AEZA 4G56B 1VYHC 2IWFA 3MZKA 5HE3B 5H1MA 3JROA 1TBGA 3ZDZA 4A11B 4ERQA 1MTYG 4J73A 3C9CA 4Z8LA 2VJ5A 3EQ8A 3SJJA 2J57G 2VDMA 3LDBA 4Z7NA 4O45A 4D9SA 3RMCA 4O02A 5M5UA 4A08A 2B7MA 1XIPA 3RMAA 2AGLA 4X61B 5HE2B 5IGQA 2IUQA 2YNNA 3L0MA 4A0AA 4CY1A 4A08B 2RKHA 3K71A 3NCIA 1U2VC 2Z2NA 4Y7RA 5A2Qg 3SJLD 2UZXB 3KD5E 3QNOA 4MMZA 2Z2PA 3J81g 3IJCA 3OKWA 3OW8A 4FK2A 3J80g 1C9IA 4L3HD 3F3FA 1JJUB 2IWKA 3DWLC 4FJLA 4Y5RD 4JXMA 1E5TA 4KI6A 2H4TA 4O3TB 2H9LA 4KHYA 1UOQA 3PXWD 3EQ7A 2H6NA 3K27A
chains in the Genus database with same CATH topology
2CN3A 4J8GA 3B7FA 3HGKE 4D0KA 4DTRA 4KHNA 3SHFA 4M3YA 3BWSA 3AFCA 4GM9A 3SN6B 3GFCA 5AJAA 3QEXA 2P5OA 1SHYB 5TDHB 3BG1A 3LD8A 2FW3A 2LF6A 1Q9YA 5C2WB 3NAEA 3MMYA 1B9XA 5EALA 2XU7A 3EI4A 4PC0A 2AQ5A 1WAFA 2AH0A 1WAJA 5IBKB 1R5MA 4ERYA 3QERA 3SLED 3RN0D 3PXTD 4JT5C 4X5MA 3RSEC 4E5ZA 4BH6A 3WSOA 4GMBA 4JSXC 3UVKA 3DXKC 4KFMB 3PE7A 5C9ZB 4A08B 3OGKB 1PGUA 3I7HA 4ZOYA 3C99A 4QT8A 4X3EA 4J82A 4DTPA 4PXWA 4JRPA 3SI6A 1XVCE 1XKSA 3UVLA 3QEIA 2OIZA 4A0AB 3RN1D 4J77A 4CC9A 3L2OB 4UI9R 3EWEA 5K19A 4M3UA 2OJYA 3EI1A 3SQ0A 3OGMB 1IH7A 2E32A 4X63B 3NVNA 4M3ZA 4PNKB 4GAMC 3E4YA 3UVMA 3C75H 4QNDA 4KHSA 4HCCA 4FJKA 2PM6B 4PSWB 2H9NA 5IZ7A 2O9KA 3SMRA 1OMWB 5KDOB 4GZ8A 3N1BA 2YB5A 3QESA 1GP2B 1K32A 3QEWA 3JZGA 3MXXA 3OL2A 2Z2OA 1FZHE 2IUVA 4EP9A 3KD1E 3J27A 4HDJA 2B5NA 5IREA 2P9SC 4QQEA 1PI6A 5AMSA 4A2MA 3FGBA 2TRCB 5HQGA 4I9QA 5CXBA 2XL2A 3TJYA 4KHWA 4AOWA 4JSPC 4J2EA 2AGZA 4QRJA 3L4OD 3TAFA 3MKSB 4KHUA 3I2NA 2P1NB 3A0FA 1TYQC 2MTAH 4U7AA 4JT6C 4FA4D 4QL1A 4B08A 3JZHA 3EI4B 4K3ID 1MG3A 2B8IA 2MMBA 4R7AB 2JPNA 3TABA 2W18A 4FA5D 4LG9A 3JRPA 3SWSD 4FJ9A 4FJMA 2GC7A 5GMKn 4ZOVA 4DTXA 4TZ4A 3L4MD 3OKTA 3LZIA 2H6QA 4ZOZA 3I7NA 2IURA 4EYWA 2OVRB 4JRQA 4A09A 3TAEA 2JHCA 5IJ8E 2PBIB 3P4FA 3AL8A 4FJJA 4ERZA 4J79A 4FVMA 1XVGE 4J78A 5SXMA 1FZ6E 1L0QA 2I0SA 1SQJA 4L9OA 4PSXB 4FJ7A 3EI1B 3TL8B 3IIWA 4CY3A 4ADNA 4M3WA 3V5WB 4I79A 4XYIA 3SCXA 5GXHA 1MMOG 3HP9A 3NVXA 3OKYA 2HJBA 5IJ7E 3W15A 4J0XA 2B5MA 4PBZA 1RI6A 2OZSA 2CE8A 4CY2A 4ZN4A 3EI2A 2OVQB 3PVUB 3EI3A 1Q47A 4CY5A 5FKSA 5I5MA 2HESX 3RFGA 3I7KA 2LF3A 3UKRC 5EMKB 1MG2A 1FZ8E 1B9YA 2CO0A 4ADOA 3OTTA 3IKOA 2JHAA 4GGCA 4BL0A 2EBSA 3BG0A 1N6DA 3MKQA 4A0BA 4GGAA 2QC5A 1CLQA 5B4WA 4FA1D 3I7OA 3SUPA 3HFQA 4O1QD 4AI6A 3SNNA 4JS4A 5I5IA 4IMMA 3KRWB 3SCYA 5FKQA 4J2AA 3TAGA 4DTMA 4AKHA 1PBYB 5FKRA 4FJNA 1Q9XA 3IJ1A 2YB8B 4K3JB 4CI3A 2J56H 5GSAA 4LG8A 4A09B 3RFHA 5EAMA 4AKGA 3AL8B 3LZJA 2IAAA 1P22A 1FYZE 4GM3A 3VH0A 1XVBE 1LDKE 3N1EA 3NDKA 3PSCB 2H13A 4DU3A 4KHQA 3OKYB 5H37A 2AGYA 1NEXB 3SQ2A 2HD0A 1YFQA 2PFTA 5FA5B 3SUOA 3SVIA 2H3XA 2HKRA 3AL9A 4BUJC 3EI2B 3C94A 4J8BA 5EARA 5H14A 3CFPA 2YNOA 4OZUA 2OVPB 4FK0A 2OYQA 4CI2A 4E4BA 3CQ8A 2HXCA 4XYHA 4CZXA 3IIYA 4DTJA 4JS5A 4J2DA 1JMXB 2RCUA 3SVWD 2JH8A 4E54A 4JSVC 2IUPA 3IJ0A 3I7LA 5CYKA 2PFVA 5EMJB 1N6EA 5IT9g 4RL5A 5I5JA 3LDSA 5K1CC 2B4EA 4M3RA 3FRXA 3NVQA 2AGXA 4GM8A 3CFRA 4YVDA 4RG8A 3SBRA 1FZ2E 4FJ5A 2YBAA 3SPYA 1U4CA 5FXYA 2HJ4A 2UZYB 2XL3A 2Q7QA 4L3GD 2CO0C 4GGDA 3JAMg 4DTOA 5EM2A 5TEFA 4I9LA 4GQBB 3V9FA 4E5ZB 1SQ9A 4RNGA 3V7DB 2E31A 4FHLA 2H68A 3SBPA 2FYOA 2G9AA 5IGOA 2GC4A 2AGWA 4X60B 1JOFA 2J55H 2H9MA 4GQ2P 3K26A 2MZWB 3F3PA 2P9UC 5AFU3 4I6JB 2I0TA 3E0CA 4M41A 1FZIE 4DTUA 1N6FA 5GXIA 1FZ3E 3UIQA 2ATQA 1GOTB 4ES0A 4KI4A 3F3GA 4J0WA 3SXTD 2P1QB 4DTSA 2B5LA 3DXMC 2P1MB 2GNQA 2OK6A 2H9PA 3NE6A 1GXRA 4FB1D 4HCBA 2OZMA 2YNPA 4FAND 3OL2B 2I3TA 1FZ0E 4FJ8A 4M3XA 1FZ5E 2BBKH 4L1QD 4ZOXA 4FAVD 2HYEA 3SQ1A 3VA6A 3N0DA 3PSLA 1FZ7E 3L1NA 4CI1A 4J87A 4J2BA 2P9IC 1FZ4E 2P1PB 4E54B 3I8EA 2DTUA 5CYKB 4EWRA 4DU4A 1FZ9E 4J84A 1XMGE 3HGLA 3I8CA 2DY4A 3OGLB 3E4WA 5CXBB 5TF2A 4JSNC 3ULEC 3DSMA 1NR0A 1QNIA 5EMMB 3I89A 2DEBA 2I3SA 4FWWA 3RRMC 4AKIA 4FJXA 2P5GA 3K2OA 3QNNA 2VJ4A 4E3SA 4J86A 2BCJB 3EMHA 3ODTA 3UVNA 1S4UX 4CZVA 4LGNA 2QXFA 2JH9A 4EPHA 4FJHA 2CE9A 4M45A 3JB9L 4NSXA 3SBQA 5EM2B 3DM0A 2OK4A 5CXCA 3EG6A 3MZLA 5FLXg 1XVDE 5TEEA 2H6KA 1K8KC 2P9KC 3UVOA 1A0RB 1JMZB 3S9HA 4FA9D 4N14A 4FK4A 5EMLB 2PM7B 1XHMA 3CFOA 3C5MA 3HL8A 3QEVA 1MHYG 1XVEE 3SPZA 1ERJA 3PXSD 1GG2B 3U4YA 1XMFE 3C6PB 1FS1A 4JD2C 5HE0B 1XU3E 2PM9A 5HE1B 5H17A 4ESGA 2P9PC 1FXXA 2H47A 3JZNA 3RMBA 3QEPA 4DTNA 4A11A 4CI8A 3EU7A 2P9LC 3L8BA 2I0RA 3EI3B 1XL3C 3NHGA 3CFVA 4A7JA 4X5NA 3UR4A 2QXVA 3SUNA 4OWRA 5FKTA 4H5JA 1FZ1E 3C6NB 3C6OB 1IG9A 3RMZD 5IC7A 2P1OB 2CNXA 3RWUA 2JHPA 4A0BB 2G99A 4J81A 3JPXA 4A2LA 3ORVD 3RMDA 4M42A 1OLZA 3PVWB 3GREA 3UKUC 3ZWLB 1MDAH 2B1EA 5EAPA 5FQDA 1XMHE 2YMUA 1MHZG 2CN2A 3FM0A 3QETA 3SQ4A 3NGIA 5CXCB 3I7PA 4O3UB 5THAA 4DU1A 3CFSB 3CIKB 5HYNB 4H5IA 3SUQA 4FJGA 3SFZA 4CZYA 4GQ1A 5JWZA 4U1EI 4PBYA 3J2PA 2HKMA 2AH1A 1XVFE 4M3TA 3KRXB 3VGZA 3C95A 2VIXA 4FJIA 4QNCA 4IA9A 2XYIA 4O9DA 1FWXA 2P9NC 4XEIC 1PEVA 4MK0B 5C2VB 2H14A 2PM9B 3N0EA 1XU5E 3RLMD 4D6VA 3AH8B 4AEZA 4G56B 1VYHC 2IWFA 3MZKA 5HE3B 5H1MA 3JROA 1TBGA 4A11B 4ERQA 1MTYG 4J73A 3C9CA 4Z8LA 2VJ5A 3SJJA 2J57G 3LDBA 4O45A 3RMCA 4A08A 2B7MA 1XIPA 3RMAA 2AGLA 4X61B 5HE2B 5IGQA 2IUQA 2YNNA 3L0MA 4A0AA 4CY1A 3NCIA 1U2VC 2Z2NA 4Y7RA 5A2Qg 3SJLD 2UZXB 3KD5E 3QNOA 2Z2PA 3J81g 3IJCA 3OKWA 3OW8A 4FK2A 3J80g 4L3HD 3F3FA 1JJUB 2IWKA 3DWLC 4FJLA 4Y5RD 4JXMA 4KI6A 2H4TA 4O3TB 2H9LA 4KHYA 3PXWD 2H6NA 3K27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CN3 A;  4J8G A;  3B7F A;  4D0K A;  3SHF A;  3BWS A;  3AFC A;  4GM9 A;  3SN6 B;  3GFC A;  5AJA A;  1SHY B;  5TDH B;  3BG1 A;  5C2W B;  3MMY A;  1B9X A;  5EAL A;  2XU7 A;  3EI4 A;  4PC0 A;  2AQ5 A;  2AH0 A;  5IBK B;  1R5M A;  4ERY A;  3SLE D;  3RN0 D;  3PXT D;  4JT5 C;  3RSE C;  4E5Z A;  4BH6 A;  3WSO A;  4GMB A;  4JSX C;  3UVK A;  3DXK C;  4KFM B;  3PE7 A;  5C9Z B;  4A08 B;  3OGK B;  1PGU A;  3I7H A;  4ZOY A;  3C99 A;  4QT8 A;  4X3E A;  4J82 A;  4PXW A;  1XKS A;  3UVL A;  4A0A B;  2OIZ A;  3RN1 D;  4J77 A;  4CC9 A;  3L2O B;  4UI9 R;  3EWE A;  5K19 A;  2OJY A;  3EI1 A;  3OGM B;  2E32 A;  4X63 B;  3NVN A;  4PNK B;  3UVM A;  3C75 H;  2PM6 B;  4PSW B;  2H9N A;  2O9K A;  3SMR A;  1OMW B;  5KDO B;  4GZ8 A;  1K32 A;  3JZG A;  1GP2 B;  3OL2 A;  3MXX A;  2Z2O A;  2IUV A;  4HDJ A;  2B5N A;  2P9S C;  4QQE A;  1PI6 A;  5AMS A;  4A2M A;  3FGB A;  2TRC B;  5HQG A;  5CXB A;  2XL2 A;  4AOW A;  4JSP C;  2AGZ A;  4QRJ A;  3L4O D;  3MKS B;  3I2N A;  2P1N B;  3A0F A;  1TYQ C;  2MTA H;  4U7A A;  4JT6 C;  4FA4 D;  4QL1 A;  4K3I D;  3JZH A;  3EI4 B;  1MG3 A;  4R7A B;  2W18 A;  4FA5 D;  4LG9 A;  3JRP A;  3SWS D;  2GC7 A;  5GMK n;  4ZOV A;  4TZ4 A;  3L4M D;  3OKT A;  2H6Q A;  4ZOZ A;  3I7N A;  2IUR A;  2OVR B;  4A09 A;  5IJ8 E;  2PBI B;  3P4F A;  3AL8 A;  4ERZ A;  4J79 A;  4J78 A;  5SXM A;  1L0Q A;  2I0S A;  1SQJ A;  4L9O A;  4PSX B;  3EI1 B;  3IIW A;  4CY3 A;  3V5W B;  4I79 A;  4XYI A;  5GXH A;  3NVX A;  3OKY A;  2HJB A;  5IJ7 E;  3W15 A;  4J0X A;  2B5M A;  4PBZ A;  1RI6 A;  2CE8 A;  4CY2 A;  4ZN4 A;  3EI2 A;  2OVQ B;  3PVU B;  3EI3 A;  1Q47 A;  4CY5 A;  5FKS A;  5I5M A;  2HES X;  3RFG A;  3I7K A;  3UKR C;  5EMK B;  1MG2 A;  1B9Y A;  2CO0 A;  3OTT A;  3IKO A;  4GGC A;  4BL0 A;  2EBS A;  3BG0 A;  1N6D A;  3MKQ A;  4A0B A;  4GGA A;  2QC5 A;  5B4W A;  4FA1 D;  3I7O A;  3HFQ A;  4O1Q D;  5I5I A;  4IMM A;  3KRW B;  3SCY A;  5FKQ A;  1PBY B;  5FKR A;  3IJ1 A;  2YB8 B;  4K3J B;  4CI3 A;  2J56 H;  5GSA A;  4LG8 A;  4A09 B;  3RFH A;  5EAM A;  3AL8 B;  2IAA A;  1P22 A;  4GM3 A;  3VH0 A;  1LDK E;  3PSC B;  2H13 A;  3OKY B;  2AGY A;  1NEX B;  1YFQ A;  5FA5 B;  2HKR A;  3AL9 A;  2H3X A;  4BUJ C;  3EI2 B;  4J8B A;  5EAR A;  5H14 A;  2YNO A;  4OZU A;  2OVP B;  4CI2 A;  2HXC A;  4XYH A;  4CZX A;  3IIY A;  1JMX B;  3SVW D;  4E54 A;  4JSV C;  2IUP A;  3IJ0 A;  3I7L A;  5CYK A;  5EMJ B;  1N6E A;  5IT9 g;  5I5J A;  5K1C C;  2B4E A;  3FRX A;  3NVQ A;  2AGX A;  4GM8 A;  4YVD A;  3SBR A;  2YBA A;  1U4C A;  5FXY A;  2HJ4 A;  2UZY B;  2XL3 A;  2Q7Q A;  4L3G D;  2CO0 C;  4GGD A;  3JAM g;  5EM2 A;  5TEF A;  4GQB B;  3V9F A;  4E5Z B;  1SQ9 A;  3V7D B;  2E31 A;  4FHL A;  2H68 A;  3SBP A;  2G9A A;  5IGO A;  2GC4 A;  2AGW A;  4X60 B;  1JOF A;  2J55 H;  2H9M A;  4GQ2 P;  3K26 A;  3F3P A;  2P9U C;  5AFU 3;  4I6J B;  2I0T A;  3E0C A;  1N6F A;  5GXI A;  4ES0 A;  1GOT B;  3F3G A;  4J0W A;  3SXT D;  2P1Q B;  2B5L A;  3DXM C;  2P1M B;  2GNQ A;  2OK6 A;  2H9P A;  4FB1 D;  1GXR A;  2YNP A;  4FAN D;  3OL2 B;  2I3T A;  2BBK H;  4L1Q D;  4ZOX A;  4FAV D;  2HYE A;  3VA6 A;  3N0D A;  3PSL A;  4CI1 A;  4J87 A;  2P9I C;  2P1P B;  4E54 B;  3I8E A;  5CYK B;  4EWR A;  4J84 A;  3I8C A;  3OGL B;  5CXB B;  5TF2 A;  3ULE C;  4JSN C;  3DSM A;  1NR0 A;  1QNI A;  5EMM B;  3I89 A;  2I3S A;  4FWW A;  3RRM C;  4J86 A;  2BCJ B;  3EMH A;  3ODT A;  3UVN A;  1S4U X;  4CZV A;  4LGN A;  2CE9 A;  3JB9 L;  4NSX A;  3SBQ A;  5EM2 B;  3DM0 A;  2OK4 A;  5CXC A;  3EG6 A;  3MZL A;  5FLX g;  5TEE A;  2H6K A;  1K8K C;  2P9K C;  3UVO A;  1A0R B;  1JMZ B;  4FA9 D;  4N14 A;  5EML B;  2PM7 B;  1XHM A;  3C5M A;  1ERJ A;  3PXS D;  3U4Y A;  1GG2 B;  3C6P B;  1FS1 A;  4JD2 C;  5HE0 B;  2PM9 A;  5HE1 B;  5H17 A;  4ESG A;  2P9P C;  2H47 A;  3JZN A;  4A11 A;  4CI8 A;  3EU7 A;  2P9L C;  2I0R A;  3EI3 B;  3CFV A;  4A7J A;  3UR4 A;  2QXV A;  4OWR A;  5FKT A;  4H5J A;  3C6N B;  3C6O B;  3RMZ D;  5IC7 A;  2P1O B;  2CNX A;  4A0B B;  2G99 A;  4J81 A;  3JPX A;  4A2L A;  3ORV D;  1OLZ A;  3PVW B;  3GRE A;  3UKU C;  3ZWL B;  1MDA H;  5EAP A;  5FQD A;  2YMU A;  2CN2 A;  3FM0 A;  5CXC B;  3I7P A;  4O3U B;  5THA A;  5HYN B;  3CFS B;  3CIK B;  4H5I A;  3SFZ A;  4CZY A;  4GQ1 A;  5JWZ A;  4U1E I;  4PBY A;  2HKM A;  2AH1 A;  3KRX B;  3VGZ A;  4IA9 A;  2XYI A;  4O9D A;  1FWX A;  2P9N C;  4XEI C;  1PEV A;  4MK0 B;  5C2V B;  2H14 A;  2PM9 B;  3N0E A;  4D6V A;  3RLM D;  3AH8 B;  4AEZ A;  4G56 B;  1VYH C;  2IWF A;  3MZK A;  5HE3 B;  5H1M A;  3JRO A;  1TBG A;  4A11 B;  4ERQ A;  4J73 A;  3C9C A;  4Z8L A;  2J57 G;  4O45 A;  4A08 A;  1XIP A;  2AGL A;  4X61 B;  5HE2 B;  5IGQ A;  2IUQ A;  2YNN A;  4A0A A;  4CY1 A;  1U2V C;  2Z2N A;  4Y7R A;  5A2Q g;  3SJL D;  2UZX B;  2Z2P A;  3J81 g;  3IJC A;  3OKW A;  3OW8 A;  3J80 g;  4L3H D;  3F3F A;  1JJU B;  2IWK A;  3DWL C;  4Y5R D;  4JXM A;  4O3T B;  2H9L A;  3PXW D;  2H6N A;  3K27 A; 
#chains in the Genus database with same CATH topology
 2CN3 A;  3MVD K;  4J8G A;  3ZDX A;  1T2X A;  3B7F A;  3HGK E;  4D0K A;  4DTR A;  4KHN A;  3SHF A;  4M3Y A;  3BWS A;  3AFC A;  4GM9 A;  5E6R A;  3SN6 B;  1K3I A;  3GFC A;  5AJA A;  2VDK A;  3BVO A;  3QEX A;  2P5O A;  1SHY B;  4O2W A;  3BG1 A;  3LD8 A;  3NIG A;  5TDH B;  3O4J A;  2FW3 A;  2LF6 A;  1Q9Y A;  1QFM A;  5C2W B;  3NAE A;  3MMY A;  3IJE A;  1B9X A;  4RE6 A;  2XU7 A;  5EAL A;  3EI4 A;  4PC0 A;  2AQ5 A;  1WAF A;  2AH0 A;  1WAJ A;  5IBK B;  4JHP C;  1R5M A;  4ERY A;  3QER A;  3SLE D;  3RN0 D;  3PXT D;  4JT5 C;  4X5M A;  3RSE C;  4E5Z A;  2K5S A;  4BH6 A;  3WSO A;  4GMB A;  4JSX C;  2VDN A;  3UVK A;  3DXK C;  4KFM B;  3PE7 A;  4WK4 A;  5C9Z B;  3OGK B;  1PGU A;  3I7H A;  2VZ1 A;  3T3M A;  3C99 A;  4QT8 A;  4X3E A;  4ZOY A;  4J82 A;  4DTP A;  4PXW A;  4JRP A;  3SI6 A;  1XVC E;  1XKS A;  3UVL A;  3QEI A;  2OIZ A;  4A0A B;  3RN1 D;  3IUN A;  2EIE A;  4J77 A;  4CC9 A;  3L2O B;  4UI9 R;  2VZ3 A;  3EWE A;  2QR5 A;  4M3U A;  2OJY A;  5K19 A;  3EI1 A;  3SQ0 A;  3V4P A;  3OGM B;  1IH7 A;  2E32 A;  2XE4 A;  4X63 B;  3NVN A;  4M3Z A;  4MMX A;  4PNK B;  4GAM C;  3E4Y A;  3UVM A;  3C75 H;  4QND A;  4KHS A;  4HCC A;  4FJK A;  2PM6 B;  4PSW B;  2H9N A;  5IZ7 A;  2O9K A;  4IRZ A;  3SMR A;  1OMW B;  5KDO B;  2EIB A;  4GZ8 A;  3N1B A;  2YB5 A;  3QES A;  1GP2 B;  1K32 A;  3QEW A;  3JZG A;  3MXX A;  3OL2 A;  4JHN A;  2Z2O A;  4BP8 A;  1FZH E;  2EID A;  2VC2 A;  2IUV A;  4EP9 A;  3KD1 E;  2VDQ A;  3J27 A;  4HDJ A;  4DNU A;  2B5N A;  5IRE A;  1C9L A;  2P9S C;  4QQE A;  1PI6 A;  5AMS A;  4A2M A;  3FGB A;  4DNV A;  2TRC B;  5HQG A;  4I9Q A;  1E8N A;  1O6G A;  5CXB A;  2XL2 A;  3TJY A;  4KHW A;  3K72 A;  4AOW A;  4JSP C;  4J2E A;  2AGZ A;  4QRJ A;  3L4O D;  3TAF A;  3MKS B;  4KHU A;  3I2N A;  2HU7 A;  4WK0 A;  2P1N B;  3A0F A;  1TYQ C;  2MTA H;  4U7A A;  4JT6 C;  4FA4 D;  4QL1 A;  4B08 A;  3JZH A;  3EI4 B;  4G1M A;  4K3I D;  1MG3 A;  2B8I A;  2MMB A;  4R7A B;  2JPN A;  3IUL A;  3TAB A;  2W18 A;  4FA5 D;  1GOF A;  4LG9 A;  3JRP A;  5FFG A;  3SWS D;  4FJ9 A;  4FJM A;  2GC7 A;  5GMK n;  4ZOV A;  4DTX A;  4TZ4 A;  3L4M D;  4Z7O A;  3OKT A;  3LZI A;  2H6Q A;  4ZOZ A;  3I7N A;  2IUR A;  4EYW A;  2OVR B;  4JRQ A;  4A09 A;  3TAE A;  2JHC A;  5IJ8 E;  2PBI B;  3P4F A;  3AL8 A;  4FJJ A;  4ERZ A;  4J79 A;  4FVM A;  1XVG E;  4J78 A;  5SXM A;  1FZ6 E;  1L0Q A;  3VI4 A;  2I0S A;  1SQJ A;  1FPO A;  4L9O A;  4PSX B;  4FJ7 A;  5M5T A;  3EI1 B;  3TL8 B;  3IIW A;  4CY3 A;  4ADN A;  1I2M B;  4M3W A;  3V5W B;  4I79 A;  4XYI A;  3SCX A;  1GOH A;  1MMO G;  2VDR A;  3HP9 A;  3NVX A;  3OKY A;  5GXH A;  1O6F A;  1VE7 A;  2HJB A;  5M61 A;  5IJ7 E;  3W15 A;  4J0X A;  2B5M A;  1UOP A;  1RI6 A;  2OZS A;  2CE8 A;  2JKX A;  2VDL A;  3IUM A;  4PBZ A;  4CY2 A;  4ZN4 A;  3EI2 A;  2OVQ B;  3PVU B;  3EI3 A;  1Q47 A;  1H2X A;  4CY5 A;  1M1X A;  5FKS A;  5I5M A;  2HES X;  3RFG A;  3I7K A;  2LF3 A;  3UKR C;  5EMK B;  1VZ3 A;  1H2Y A;  1MG2 A;  1FZ8 E;  1B9Y A;  2CO0 A;  4ADO A;  3OTT A;  3IKO A;  2JHA A;  5E6S A;  5HDB A;  4GGC A;  4BL0 A;  2EBS A;  3BG0 A;  1N6D A;  3MKQ A;  4NC4 A;  4A0B A;  4GGA A;  2QC5 A;  3EQ9 A;  1CLQ A;  1TYE A;  4UM9 A;  5B4W A;  3V4V A;  4FA1 D;  3I7O A;  3SUP A;  3HFQ A;  4O1Q D;  4WJK A;  4AI6 A;  3SNN A;  4JS4 A;  5I5I A;  4IMM A;  3KRW B;  3SCY A;  5FKQ A;  4J2A A;  5E6U A;  3TAG A;  4DTM A;  4AKH A;  1E8M A;  1PBY B;  5FKR A;  4FJN A;  1Q9X A;  3IJ1 A;  2YB8 B;  4G55 A;  4K3J B;  4CI3 A;  2J56 H;  5GSA A;  4LG8 A;  4A09 B;  3RFH A;  5EAM A;  4AKG A;  4DNW A;  3AL8 B;  3ZE1 A;  3LZJ A;  2IAA A;  1P22 A;  1FYZ E;  4AMY A;  4GM3 A;  3VH0 A;  1XVB E;  1LDK E;  3N1E A;  3NDK A;  3PSC B;  5M5V A;  4QAM A;  3UO3 A;  2H13 A;  4DU3 A;  4KHQ A;  3OKY B;  5H37 A;  2AGY A;  1NEX B;  3SQ2 A;  2HD0 A;  4IT5 A;  2PFT A;  1UOO A;  1YFQ A;  5FA5 B;  3SUO A;  3SVI A;  2H3X A;  2HKR A;  3AL9 A;  4BUJ C;  1VZ2 A;  3EI2 B;  5C86 A;  4G1E A;  3C94 A;  4J8B A;  5EAR A;  5H14 A;  1H2W A;  3CFP A;  2YNO A;  4OZU A;  2OVP B;  4FK0 A;  2OYQ A;  4CI2 A;  4E4B A;  3CQ8 A;  2HXC A;  4XYH A;  4CZX A;  3IIY A;  4DTJ A;  4JS5 A;  4J2D A;  4NAA A;  1JMX B;  2RCU A;  3SVW D;  2JH8 A;  4E54 A;  4JSV C;  2IUP A;  3IJ0 A;  3I7L A;  5CYK A;  2PFV A;  5EMJ B;  1N6E A;  5IT9 g;  3ZE2 A;  4RL5 A;  3OF7 A;  5I5J A;  3LDS A;  5K1C C;  4MMY A;  2B4E A;  2VDP A;  3T3P A;  4M3R A;  4BCD A;  3FRX A;  2VDO A;  3NVQ A;  2AGX A;  2XZG A;  4GM8 A;  3CFR A;  4YVD A;  4RG8 A;  3SBR A;  1FZ2 E;  4FJ5 A;  2YBA A;  3SPY A;  3KCI A;  1U4C A;  5FXY A;  2HJ4 A;  2UZY B;  2XL3 A;  2Q7Q A;  4L3G D;  2CO0 C;  4GGD A;  3IUJ A;  3NIF A;  3JAM g;  1U8C A;  4DTO A;  1VE6 A;  4AX4 A;  3QHY B;  5EM2 A;  4I9L A;  4GQB B;  5TEF A;  3V9F A;  4E5Z B;  1SQ9 A;  4RNG A;  3QI0 A;  3V7D B;  2E31 A;  4FHL A;  2H68 A;  3SBP A;  1JV2 A;  1GOG A;  2FYO A;  2G9A A;  4WK2 A;  5IGO A;  2GC4 A;  2AGW A;  3IUQ A;  4X60 B;  1JOF A;  4NEN A;  2J55 H;  2H9M A;  4GQ2 P;  3GC3 B;  5M5R A;  3K26 A;  4ICG C;  3GD1 I;  2MZW B;  3F3P A;  2P9U C;  5FFO A;  2HU8 A;  5AFU 3;  4I6J B;  2I0T A;  3E0C A;  4M41 A;  2HU5 A;  1FZI E;  4DTU A;  1N6F A;  5GXI A;  1FZ3 E;  3UIQ A;  2ATQ A;  1GOT B;  4ES0 A;  1A12 A;  4KI4 A;  3F3G A;  4J0W A;  3SXT D;  2P1Q B;  4DTS A;  2B5L A;  3DXM C;  2P1M B;  2GNQ A;  2OK6 A;  2H9P A;  3NE6 A;  1GXR A;  4FB1 D;  4HCB A;  4L1M A;  1JTD B;  2OZM A;  2YNP A;  4UM8 A;  4FAN D;  3OL2 B;  2I3T A;  1FZ0 E;  4FJ8 A;  4M3X A;  1FZ5 E;  2BBK H;  4L1Q D;  4ZOX A;  1QFS A;  4FAV D;  3SQ1 A;  3VA6 A;  2HYE A;  3N0D A;  3PSL A;  3UO2 A;  4AN1 A;  1FZ7 E;  3L1N A;  4CI1 A;  4J87 A;  3O4H A;  4J2B A;  2P9I C;  1FZ4 E;  2P1P B;  4E54 B;  3DDU A;  3I8E A;  2DTU A;  5CYK B;  4EWR A;  4DU4 A;  1FZ9 E;  4J84 A;  1XMG E;  3HGL A;  3I8C A;  2DY4 A;  3OGL B;  3E4W A;  5CXB B;  5TF2 A;  4JSN C;  3ULE C;  3DSM A;  1NR0 A;  2XDW A;  1QNI A;  2WQ8 A;  4RE5 A;  3I89 A;  5EMM B;  2DEB A;  2I3S A;  4FWW A;  3RRM C;  1YR2 A;  4AKI A;  4FJX A;  2P5G A;  3IUR A;  3K2O A;  3QNN A;  2VJ4 A;  4E3S A;  4J86 A;  2BCJ B;  3EMH A;  3ODT A;  3UVN A;  1S4U X;  4CZV A;  4LGN A;  2QXF A;  2JH9 A;  4EPH A;  4FJH A;  2CE9 A;  4M45 A;  3JB9 L;  4NBM A;  4NSX A;  3SBQ A;  5EM2 B;  3DM0 A;  2OK4 A;  5CXC A;  3EG6 A;  2EIC A;  3MZL A;  5FLX g;  1XVD E;  5TEE A;  2H6K A;  1K8K C;  2P9K C;  3UVO A;  1A0R B;  1JMZ B;  3S9H A;  4FA9 D;  4N14 A;  2JQT A;  4FK4 A;  5EML B;  2PM7 B;  1XHM A;  3CFO A;  3C5M A;  3HL8 A;  3QEV A;  1MHY G;  1XVE E;  3SPZ A;  1ERJ A;  3PXS D;  1GG2 B;  3U4Y A;  1XMF E;  3C6P B;  1FS1 A;  4JD2 C;  5HE0 B;  1XU3 E;  3IVM A;  2PM9 A;  5HE1 B;  5H17 A;  3FCU A;  4ESG A;  2P9P C;  1FXX A;  2H47 A;  3JZN A;  3RMB A;  3QEP A;  4DTN A;  4A11 A;  2MW2 A;  4CI8 A;  3MUN A;  3EU7 A;  2P9L C;  3L8B A;  2I0R A;  3EI3 B;  1XL3 C;  3NHG A;  3CFV A;  4A7J A;  4X5N A;  3UR4 A;  3FCS A;  2QXV A;  3SUN A;  4OWR A;  5FKT A;  4H5J A;  1FZ1 E;  3C6N B;  3C6O B;  1IG9 A;  3RMZ D;  5IC7 A;  5M5S A;  2P1O B;  1L5G A;  2CNX A;  3RWU A;  2JHP A;  4A0B B;  2G99 A;  4J81 A;  3JPX A;  1N1C A;  4A2L A;  4AMZ A;  3ORV D;  3RMD A;  4M42 A;  1OLZ A;  3PVW B;  3GRE A;  3UKU C;  3ZWL B;  1MDA H;  2B1E A;  5EAP A;  5FQD A;  3VI3 A;  1XMH E;  2YMU A;  4AN0 A;  3K6S A;  1MHZ G;  2CN2 A;  5C92 A;  3FM0 A;  3QET A;  3SQ4 A;  1H2Z A;  3NGI A;  1BPO A;  5CXC B;  3I7P A;  4O3U B;  5THA A;  4DU1 A;  3CFS B;  3CIK B;  5HYN B;  4Z7Q A;  4H5I A;  3SUQ A;  4FJG A;  3SFZ A;  4CZY A;  1UTC A;  4GQ1 A;  3ZE0 A;  3ZDY A;  5JWZ A;  4U1E I;  4PBY A;  4BP9 A;  3J2P A;  2HKM A;  2QZP A;  2AH1 A;  1XVF E;  4M3T A;  2BKL A;  3KRX B;  3O4G A;  3VGZ A;  3C95 A;  4BCB A;  4BCC A;  2VIX A;  4FJI A;  3MUO A;  3O4I A;  4QNC A;  4IA9 A;  2XYI A;  4O9D A;  1FWX A;  2P9N C;  4XEI C;  1PEV A;  1JW2 A;  4MK0 B;  5C2V B;  2H14 A;  2PM9 B;  3N0E A;  1XU5 E;  3NID A;  3RLM D;  4D6V A;  3AH8 B;  4AEZ A;  4G56 B;  1VYH C;  2IWF A;  3MZK A;  5HE3 B;  5H1M A;  3JRO A;  1TBG A;  3ZDZ A;  4A11 B;  4ERQ A;  1MTY G;  4J73 A;  3C9C A;  4Z8L A;  2VJ5 A;  3EQ8 A;  3SJJ A;  2J57 G;  2VDM A;  3LDB A;  4Z7N A;  4O45 A;  4D9S A;  3RMC A;  4O02 A;  5M5U A;  4A08 A;  2B7M A;  1XIP A;  3RMA A;  2AGL A;  4X61 B;  5HE2 B;  5IGQ A;  2IUQ A;  2YNN A;  3L0M A;  4A0A A;  4CY1 A;  4A08 B;  2RKH A;  3K71 A;  3NCI A;  1U2V C;  2Z2N A;  4Y7R A;  5A2Q g;  3SJL D;  2UZX B;  3KD5 E;  3QNO A;  4MMZ A;  2Z2P A;  3J81 g;  3IJC A;  3OKW A;  3OW8 A;  4FK2 A;  3J80 g;  1C9I A;  4L3H D;  3F3F A;  1JJU B;  2IWK A;  3DWL C;  4FJL A;  4Y5R D;  4JXM A;  1E5T A;  4KI6 A;  2H4T A;  4O3T B;  2H9L A;  4KHY A;  1UOQ A;  3PXW D;  3EQ7 A;  2H6N A;  3K27 A; 
#chains in the Genus database with same CATH homology
 2CN3 A;  4J8G A;  3B7F A;  3HGK E;  4D0K A;  4DTR A;  4KHN A;  3SHF A;  4M3Y A;  3BWS A;  3AFC A;  4GM9 A;  3SN6 B;  3GFC A;  5AJA A;  3QEX A;  2P5O A;  1SHY B;  5TDH B;  3BG1 A;  3LD8 A;  2FW3 A;  2LF6 A;  1Q9Y A;  5C2W B;  3NAE A;  3MMY A;  1B9X A;  5EAL A;  2XU7 A;  3EI4 A;  4PC0 A;  2AQ5 A;  1WAF A;  2AH0 A;  1WAJ A;  5IBK B;  1R5M A;  4ERY A;  3QER A;  3SLE D;  3RN0 D;  3PXT D;  4JT5 C;  4X5M A;  3RSE C;  4E5Z A;  4BH6 A;  3WSO A;  4GMB A;  4JSX C;  3UVK A;  3DXK C;  4KFM B;  3PE7 A;  5C9Z B;  4A08 B;  3OGK B;  1PGU A;  3I7H A;  4ZOY A;  3C99 A;  4QT8 A;  4X3E A;  4J82 A;  4DTP A;  4PXW A;  4JRP A;  3SI6 A;  1XVC E;  1XKS A;  3UVL A;  3QEI A;  2OIZ A;  4A0A B;  3RN1 D;  4J77 A;  4CC9 A;  3L2O B;  4UI9 R;  3EWE A;  5K19 A;  4M3U A;  2OJY A;  3EI1 A;  3SQ0 A;  3OGM B;  1IH7 A;  2E32 A;  4X63 B;  3NVN A;  4M3Z A;  4PNK B;  4GAM C;  3E4Y A;  3UVM A;  3C75 H;  4QND A;  4KHS A;  4HCC A;  4FJK A;  2PM6 B;  4PSW B;  2H9N A;  5IZ7 A;  2O9K A;  3SMR A;  1OMW B;  5KDO B;  4GZ8 A;  3N1B A;  2YB5 A;  3QES A;  1GP2 B;  1K32 A;  3QEW A;  3JZG A;  3MXX A;  3OL2 A;  2Z2O A;  1FZH E;  2IUV A;  4EP9 A;  3KD1 E;  3J27 A;  4HDJ A;  2B5N A;  5IRE A;  2P9S C;  4QQE A;  1PI6 A;  5AMS A;  4A2M A;  3FGB A;  2TRC B;  5HQG A;  4I9Q A;  5CXB A;  2XL2 A;  3TJY A;  4KHW A;  4AOW A;  4JSP C;  4J2E A;  2AGZ A;  4QRJ A;  3L4O D;  3TAF A;  3MKS B;  4KHU A;  3I2N A;  2P1N B;  3A0F A;  1TYQ C;  2MTA H;  4U7A A;  4JT6 C;  4FA4 D;  4QL1 A;  4B08 A;  3JZH A;  3EI4 B;  4K3I D;  1MG3 A;  2B8I A;  2MMB A;  4R7A B;  2JPN A;  3TAB A;  2W18 A;  4FA5 D;  4LG9 A;  3JRP A;  3SWS D;  4FJ9 A;  4FJM A;  2GC7 A;  5GMK n;  4ZOV A;  4DTX A;  4TZ4 A;  3L4M D;  3OKT A;  3LZI A;  2H6Q A;  4ZOZ A;  3I7N A;  2IUR A;  4EYW A;  2OVR B;  4JRQ A;  4A09 A;  3TAE A;  2JHC A;  5IJ8 E;  2PBI B;  3P4F A;  3AL8 A;  4FJJ A;  4ERZ A;  4J79 A;  4FVM A;  1XVG E;  4J78 A;  5SXM A;  1FZ6 E;  1L0Q A;  2I0S A;  1SQJ A;  4L9O A;  4PSX B;  4FJ7 A;  3EI1 B;  3TL8 B;  3IIW A;  4CY3 A;  4ADN A;  4M3W A;  3V5W B;  4I79 A;  4XYI A;  3SCX A;  5GXH A;  1MMO G;  3HP9 A;  3NVX A;  3OKY A;  2HJB A;  5IJ7 E;  3W15 A;  4J0X A;  2B5M A;  4PBZ A;  1RI6 A;  2OZS A;  2CE8 A;  4CY2 A;  4ZN4 A;  3EI2 A;  2OVQ B;  3PVU B;  3EI3 A;  1Q47 A;  4CY5 A;  5FKS A;  5I5M A;  2HES X;  3RFG A;  3I7K A;  2LF3 A;  3UKR C;  5EMK B;  1MG2 A;  1FZ8 E;  1B9Y A;  2CO0 A;  4ADO A;  3OTT A;  3IKO A;  2JHA A;  4GGC A;  4BL0 A;  2EBS A;  3BG0 A;  1N6D A;  3MKQ A;  4A0B A;  4GGA A;  2QC5 A;  1CLQ A;  5B4W A;  4FA1 D;  3I7O A;  3SUP A;  3HFQ A;  4O1Q D;  4AI6 A;  3SNN A;  4JS4 A;  5I5I A;  4IMM A;  3KRW B;  3SCY A;  5FKQ A;  4J2A A;  3TAG A;  4DTM A;  4AKH A;  1PBY B;  5FKR A;  4FJN A;  1Q9X A;  3IJ1 A;  2YB8 B;  4K3J B;  4CI3 A;  2J56 H;  5GSA A;  4LG8 A;  4A09 B;  3RFH A;  5EAM A;  4AKG A;  3AL8 B;  3LZJ A;  2IAA A;  1P22 A;  1FYZ E;  4GM3 A;  3VH0 A;  1XVB E;  1LDK E;  3N1E A;  3NDK A;  3PSC B;  2H13 A;  4DU3 A;  4KHQ A;  3OKY B;  5H37 A;  2AGY A;  1NEX B;  3SQ2 A;  2HD0 A;  1YFQ A;  2PFT A;  5FA5 B;  3SUO A;  3SVI A;  2H3X A;  2HKR A;  3AL9 A;  4BUJ C;  3EI2 B;  3C94 A;  4J8B A;  5EAR A;  5H14 A;  3CFP A;  2YNO A;  4OZU A;  2OVP B;  4FK0 A;  2OYQ A;  4CI2 A;  4E4B A;  3CQ8 A;  2HXC A;  4XYH A;  4CZX A;  3IIY A;  4DTJ A;  4JS5 A;  4J2D A;  1JMX B;  2RCU A;  3SVW D;  2JH8 A;  4E54 A;  4JSV C;  2IUP A;  3IJ0 A;  3I7L A;  5CYK A;  2PFV A;  5EMJ B;  1N6E A;  5IT9 g;  4RL5 A;  5I5J A;  3LDS A;  5K1C C;  2B4E A;  4M3R A;  3FRX A;  3NVQ A;  2AGX A;  4GM8 A;  3CFR A;  4YVD A;  4RG8 A;  3SBR A;  1FZ2 E;  4FJ5 A;  2YBA A;  3SPY A;  1U4C A;  5FXY A;  2HJ4 A;  2UZY B;  2XL3 A;  2Q7Q A;  4L3G D;  2CO0 C;  4GGD A;  3JAM g;  4DTO A;  5EM2 A;  5TEF A;  4I9L A;  4GQB B;  3V9F A;  4E5Z B;  1SQ9 A;  4RNG A;  3V7D B;  2E31 A;  4FHL A;  2H68 A;  3SBP A;  2FYO A;  2G9A A;  5IGO A;  2GC4 A;  2AGW A;  4X60 B;  1JOF A;  2J55 H;  2H9M A;  4GQ2 P;  3K26 A;  2MZW B;  3F3P A;  2P9U C;  5AFU 3;  4I6J B;  2I0T A;  3E0C A;  4M41 A;  1FZI E;  4DTU A;  1N6F A;  5GXI A;  1FZ3 E;  3UIQ A;  2ATQ A;  1GOT B;  4ES0 A;  4KI4 A;  3F3G A;  4J0W A;  3SXT D;  2P1Q B;  4DTS A;  2B5L A;  3DXM C;  2P1M B;  2GNQ A;  2OK6 A;  2H9P A;  3NE6 A;  1GXR A;  4FB1 D;  4HCB A;  2OZM A;  2YNP A;  4FAN D;  3OL2 B;  2I3T A;  1FZ0 E;  4FJ8 A;  4M3X A;  1FZ5 E;  2BBK H;  4L1Q D;  4ZOX A;  4FAV D;  2HYE A;  3SQ1 A;  3VA6 A;  3N0D A;  3PSL A;  1FZ7 E;  3L1N A;  4CI1 A;  4J87 A;  4J2B A;  2P9I C;  1FZ4 E;  2P1P B;  4E54 B;  3I8E A;  2DTU A;  5CYK B;  4EWR A;  4DU4 A;  1FZ9 E;  4J84 A;  1XMG E;  3HGL A;  3I8C A;  2DY4 A;  3OGL B;  3E4W A;  5CXB B;  5TF2 A;  4JSN C;  3ULE C;  3DSM A;  1NR0 A;  1QNI A;  5EMM B;  3I89 A;  2DEB A;  2I3S A;  4FWW A;  3RRM C;  4AKI A;  4FJX A;  2P5G A;  3K2O A;  3QNN A;  2VJ4 A;  4E3S A;  4J86 A;  2BCJ B;  3EMH A;  3ODT A;  3UVN A;  1S4U X;  4CZV A;  4LGN A;  2QXF A;  2JH9 A;  4EPH A;  4FJH A;  2CE9 A;  4M45 A;  3JB9 L;  4NSX A;  3SBQ A;  5EM2 B;  3DM0 A;  2OK4 A;  5CXC A;  3EG6 A;  3MZL A;  5FLX g;  1XVD E;  5TEE A;  2H6K A;  1K8K C;  2P9K C;  3UVO A;  1A0R B;  1JMZ B;  3S9H A;  4FA9 D;  4N14 A;  4FK4 A;  5EML B;  2PM7 B;  1XHM A;  3CFO A;  3C5M A;  3HL8 A;  3QEV A;  1MHY G;  1XVE E;  3SPZ A;  1ERJ A;  3PXS D;  1GG2 B;  3U4Y A;  1XMF E;  3C6P B;  1FS1 A;  4JD2 C;  5HE0 B;  1XU3 E;  2PM9 A;  5HE1 B;  5H17 A;  4ESG A;  2P9P C;  1FXX A;  2H47 A;  3JZN A;  3RMB A;  3QEP A;  4DTN A;  4A11 A;  4CI8 A;  3EU7 A;  2P9L C;  3L8B A;  2I0R A;  3EI3 B;  1XL3 C;  3NHG A;  3CFV A;  4A7J A;  4X5N A;  3UR4 A;  2QXV A;  3SUN A;  4OWR A;  5FKT A;  4H5J A;  1FZ1 E;  3C6N B;  3C6O B;  1IG9 A;  3RMZ D;  5IC7 A;  2P1O B;  2CNX A;  3RWU A;  2JHP A;  4A0B B;  2G99 A;  4J81 A;  3JPX A;  4A2L A;  3ORV D;  3RMD A;  4M42 A;  1OLZ A;  3PVW B;  3GRE A;  3UKU C;  3ZWL B;  1MDA H;  2B1E A;  5EAP A;  5FQD A;  1XMH E;  2YMU A;  1MHZ G;  2CN2 A;  3FM0 A;  3QET A;  3SQ4 A;  3NGI A;  5CXC B;  3I7P A;  4O3U B;  5THA A;  4DU1 A;  3CFS B;  3CIK B;  5HYN B;  4H5I A;  3SUQ A;  4FJG A;  3SFZ A;  4CZY A;  4GQ1 A;  5JWZ A;  4U1E I;  4PBY A;  3J2P A;  2HKM A;  2AH1 A;  1XVF E;  4M3T A;  3KRX B;  3VGZ A;  3C95 A;  2VIX A;  4FJI A;  4QNC A;  4IA9 A;  2XYI A;  4O9D A;  1FWX A;  2P9N C;  4XEI C;  1PEV A;  4MK0 B;  5C2V B;  2H14 A;  2PM9 B;  3N0E A;  1XU5 E;  3RLM D;  4D6V A;  3AH8 B;  4AEZ A;  4G56 B;  1VYH C;  2IWF A;  3MZK A;  5HE3 B;  5H1M A;  3JRO A;  1TBG A;  4A11 B;  4ERQ A;  1MTY G;  4J73 A;  3C9C A;  4Z8L A;  2VJ5 A;  3SJJ A;  2J57 G;  3LDB A;  4O45 A;  3RMC A;  4A08 A;  2B7M A;  1XIP A;  3RMA A;  2AGL A;  4X61 B;  5HE2 B;  5IGQ A;  2IUQ A;  2YNN A;  3L0M A;  4A0A A;  4CY1 A;  3NCI A;  1U2V C;  2Z2N A;  4Y7R A;  5A2Q g;  3SJL D;  2UZX B;  3KD5 E;  3QNO A;  2Z2P A;  3J81 g;  3IJC A;  3OKW A;  3OW8 A;  4FK2 A;  3J80 g;  4L3H D;  3F3F A;  1JJU B;  2IWK A;  3DWL C;  4FJL A;  4Y5R D;  4JXM A;  4KI6 A;  2H4T A;  4O3T B;  2H9L A;  4KHY A;  3PXW D;  2H6N A;  3K27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...