2OVQB

Structure of the skp1-fbw7-cyclinedegc complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
444
structure length
444
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 126
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovqB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovqB02
3C5MA 4KFMB 5FA5B 1XHMA 5HE1B 2B5LA 5HE0B 2HKMA 3GREA 3OL2A 4A11A 2CO0A 2GC4A 4ZOVA 5EMJB 3DM0A 1MDAH 2PM7B 4PBYA 4AEZA 2J56H 3IIYA 3OKTA 4ERZA 2P1PB 3L2OB 4CZVA 4FA5D 5FKRA 4A09A 3JB9L 1L0QA 3UR4A 1P22A 4BUJC 3I7NA 3JZGA 2P9IC 4J0XA 4YVDA 5CXBB 3EI2A 5H14A 4FB1D 4CI1A 5GSAA 4J77A 4AOWA 2QXVA 4J73A 4UI9R 4X63B 4A7JA 5IGQA 3MXXA 5EM2A 3SHFA 4J81A 4CI3A 5CYKA 4O9DA 2IUQA 3V5WB 5A2Qg 3C6PB 3V9FA 1TBGA 3RN1D 4J79A 4OWRA 1YFQA 3SN6B 2AGWA 4H5JA 1NEXB 5SXMA 5HE2B 1S4UX 1XKSA 3ODTA 3EI4B 2O9KA 4K3JB 1QNIA 5C2VB 3PXSD 2H9MA 4XYHA 3SMRA 1JOFA 4IA9A 1JJUB 1GOTB 2AGXA 3UVMA 5EAPA 3JZNA 3B7FA 2CNXA 3AL8A 4L9OA 5B4WA 4GM9A 3JAMg 2HESX 3FM0A 4CI2A 2CE8A 2CN2A 4Z8LA 4L3GD 3EI1A 3K26A 2UZXB 1A0RB 1K8KC 4A08A 5AJAA 2H13A 3C75H 3HFQA 3I8CA 4IMMA 1N6EA 2I3SA 4JSPC 5EARA 5HE3B 3C6OB 3UKRC 4I79A 3F3GA 4J0WA 3EU7A 4J87A 3SXTD 4GMBA 4MK0B 5I5JA 4E5ZB 2YNNA 1JMXB 4BL0A 2P1MB 3OTTA 5TEFA 4QL1A 2OVRB 3RN0D 2G9AA 3VGZA 4A0AB 4GQ2P 3OKWA 5C2WB 4XEIC 5IJ7E 5CXCA 2PM9B 1PBYB 2IUPA 4A2LA 3I7PA 2W18A 3NVNA 3AFCA 2UZYB 4E54A 4A11B 2Z2NA 5EMMB 4X60B 3OGMB 3VH0A 3V7DB 3NVQA 4GM8A 4Y5RD 3RRMC 2AGYA 2H9NA 3I7KA 3N0EA 2P9PC 5EAMA 4ESGA 2GC7A 4D6VA 3BG0A 2I3TA 1TYQC 3IJ1A 2B4EA 3EI2B 1U2VC 1FWXA 2OIZA 4GGCA 1ERJA 3EI3A 2E31A 3IKOA 2Z2OA 4QT8A 5EM2B 3RFHA 3IJCA 1GG2B 1JMZB 3DWLC 4A0BB 3SBRA 5FKTA 3L4MD 2J55H 5IGOA 4K3ID 1SQ9A 4PC0A 3NVXA 3AH8B 2AH0A 2H6NA 3SFZA 3ULEC 4FAVD 5K19A 2CO0C 2P1OB 1XIPA 3F3FA 3DXMC 5AMSA 1N6DA 2OK6A 5IT9g 2AGZA 3EMHA 3I7HA 1OLZA 5TDHB 5GXIA 4FWWA 4GGAA 3MKQA 3OKYB 5IC7A 1Q47A 3FGBA 4EWRA 3EWEA 4QRJA 5CXBA 3UVOA 3IIWA 4FHLA 1OMWB 3I7LA 3JRPA 4TZ4A 5EMKB 2GNQA 2H6KA 5HYNB 2XL3A 1LDKE 3A0FA 2PM6B 3SBPA 4O45A 1MG2A 4A08B 3GFCA 3W15A 4GQ1A 3F3PA 4N14A 4I6JB 5EALA 2H14A 3KRXB 3VA6A 4J78A 2G99A 2I0SA 4ZOZA 3JROA 4CZYA 3I2NA 3JZHA 5FKSA 2HXCA 4OZUA 4H5IA 5EMLB 1NR0A 3MZKA 1PGUA 4HDJA 2P1QB 5HQGA 2YBAA 2XYIA 2H3XA 2YMUA 4PSXB 3RMZD 2B5NA 3UVKA 4LG8A 3SVWD 3MKSB 3E0CA 4R7AB 1SHYB 3OW8A 2XL2A 5H1MA 3K27A 2P9SC 5FQDA 4PBZA 1U4CA 4CY2A 3AL9A 2YNPA 5I5MA 4G56B 1GP2B 4J84A 2MTAH 4O3TB 4JD2C 4U1EI 3N0DA 4ERQA 2P9NC 3J80g 2OK4A 2P9UC 3OL2B 3UVNA 3CFVA 4JT6C 4L1QD 1PI6A 4ZN4A 4JT5C 4NSXA 4GGDA 3C6NB 3BWSA 4A09B 4JXMA 2P9LC 5GMKn 5KDOB 3EI3B 1N6FA 3RSEC 3I8EA 4JSNC 2P9KC 3PE7A 4ES0A 3PXTD 4E5ZA 2AH1A 2Z2PA 3IJ0A 3MZLA 3SCYA 2HJ4A 5C9ZB 2H9PA 5IBKB 1B9XA 3RFGA 4FA9D 5JWZA 3WSOA 2XU7A 3PVWB 4A0AA 2BCJB 2IURA 2I0RA 5H17A 4CC9A 1GXRA 2PM9A 5I5IA 3ZWLB 5AFU3 3SLED 5CYKB 5THAA 4A2MA 1B9YA 2TRCB 4ZOXA 2AQ5A 2EBSA 5FKQA 4FA4D 3KRWB 3PSLA 1FS1A 2H47A 3UKUC 2OJYA 4J86A 3DSMA 3RLMD 4LG9A 3CIKB 2H68A 3PVUB 1MG3A 2P1NB 2Q7QA 5FLXg 4XYIA 3EG6A 5TEEA 4J8BA 3U4YA 3P4FA 1RI6A 3SJLD 4U7AA 4CZXA 3AL8B 2CE9A 4JSXC 4A0BA 2E32A 2B5MA 2IWKA 4L3HD 3C9CA 4X3EA 1R5MA 5GXHA 3EI1B 5TF2A 2QC5A 4PSWB 2AGLA 2HJBA 4CY5A 1VYHC 4D0KA 3PXWD 3ORVD 3SWSD 4CY1A 4Y7RA 2PBIB 4LGNA 4O1QD 3J81g 4J82A 3C99A 4BH6A 3OKYA 4J8GA 1PEVA 4GQBB 3L4OD 3EI4A 1K32A 3OGKB 2HKRA 3SBQA 4JSVC 2OVQB 4ERYA 4CY3A 5CXCB 2BBKH 5K1CC 2IUVA 3FRXA 3PSCB 4E54B 4PNKB 2OVPB 3MMYA 2YB8B 1SQJA 4X61B 4GM3A 3I89A 3I7OA 4FA1D 4ZOYA 5IJ8E 4QQEA 4O3UB 3BG1A 2IAAA 2HYEA 3UVLA 2H6QA 2CN3A 3CFSB 3DXKC 2IWFA 2YNOA 2H9LA 4CI8A 4PXWA 2I0TA 3JPXA 2J57G 4FAND 5FXYA 3OGLB 4GZ8A
chains in the Genus database with same CATH superfamily
3C5MA 4KFMB 3GD1I 5FA5B 1XVFE 3N1EA 1XHMA 3FCSA 3NDKA 3SPZA 5HE1B 4DNUA 3ZDXA 4DTOA 2B5LA 3QHYB 2HKMA 4G55A 2VZ3A 5HE0B 3GREA 3OL2A 1FZ7E 4A11A 2CO0A 2GC4A 3EQ8A 4ZOVA 5EMJB 3DM0A 1MDAH 2PM7B 2FYOA 4PBYA 4AEZA 1VE7A 2J56H 3IIYA 3OKTA 4ERZA 2VJ5A 4M3XA 2P1PB 3L2OB 4CZVA 4FA5D 4WK0A 5FKRA 4A09A 3JB9L 4EPHA 3O4JA 2HU7A 1L0QA 4AX4A 3UR4A 1P22A 2DY4A 4BUJC 3I7NA 3JZGA 4AN0A 2MMBA 1FZ5E 3NCIA 1T2XA 2P9IC 4J0XA 1L5GA 4YVDA 1XVBE 3IULA 5CXBB 3EI2A 5H14A 4FB1D 4CI1A 1A12A 5GSAA 3QNOA 4J77A 4AOWA 2QXVA 3EQ9A 4J73A 4UI9R 4X63B 4A7JA 4FJLA 5IGQA 3MXXA 5EM2A 4WJKA 3SHFA 2VDMA 4J81A 2JHPA 2QXFA 2XE4A 4CI3A 5CYKA 4KI4A 4O9DA 1FZ3E 3KD5E 2IUQA 3V5WB 5A2Qg 2MZWB 3KD1E 3C6PB 3V9FA 5C92A 3OGLB 1XVDE 1TBGA 3RN1D 2VDPA 3MUOA 4J79A 4OWRA 1YFQA 3SN6B 3C95A 3E4YA 2AGWA 2BKLA 3QEVA 4H5JA 1NEXB 2JH8A 5SXMA 1XVGE 5HE2B 1S4UX 1XKSA 4DTNA 4EP9A 3TABA 3ODTA 3SUPA 3QNNA 1MHYG 3EI4B 3EQ7A 3IVMA 2O9KA 1O6GA 4K3JB 3LZJA 1QNIA 5C2VB 3PXSD 2H9MA 4FVMA 3L0MA 3RMCA 4XYHA 4FJIA 1XL3C 3SMRA 4D9SA 1FZ8E 1JOFA 1JJUB 4IA9A 4M3ZA 1XMHE 3SQ2A 4KHYA 1GOTB 2AGXA 4WK4A 3UVMA 4E3SA 5EAPA 3JZNA 3B7FA 2CNXA 3AL8A 4L9OA 5B4WA 3SJJA 1UOQA 4GM9A 4JS4A 3JAMg 2HESX 4RE5A 1FXXA 3FM0A 1Q9YA 3QERA 4O02A 3K71A 4CI2A 2JQTA 3BVOA 3QETA 2CE8A 2CN2A 4Z8LA 4L3GD 3EI1A 3IUNA 3K26A 2EIDA 2UZXB 4J2BA 1A0RB 1K8KC 4KHUA 4A08A 5AJAA 3RMBA 2H13A 3ZDYA 4I9QA 3S9HA 2WQ8A 5C86A 3C75H 3HFQA 3IURA 3I8CA 4IMMA 1FZHE 4RL5A 1N6EA 3ZE1A 2I3SA 4JSPC 5EARA 5HE3B 3C6OB 3O4IA 3UKRC 2LF6A 3FCUA 4FJKA 4I79A 4ICGC 2DEBA 3F3GA 3EU7A 4J0WA 4J87A 3SXTD 3CFRA 5M5SA 4GMBA 4MK0B 5E6SA 4IRZA 5I5JA 4E5ZB 1GOHA 3SQ0A 2YNNA 1JMXB 4BL0A 2P1MB 1H2WA 3OTTA 5TEFA 4QL1A 4QAMA 2OVRB 3RN0D 2G9AA 3VGZA 4A0AB 4GQ2P 3OKWA 4FJGA 3NAEA 5C2WB 4XEIC 4Z7QA 5IJ7E 5CXCA 2PM9B 3J2PA 1PBYB 2IUPA 4A2LA 3I7PA 2W18A 5FFOA 4QNCA 3NVNA 3AFCA 2UZYB 3K2OA 3VI4A 4E54A 4A11B 4FJHA 2Z2NA 3OF7A 5EMMB 4X60B 3SQ1A 5M5RA 4M3RA 3MVDK 3VH0A 3V7DB 3NVQA 4GM8A 4Y5RD 3NIFA 3RRMC 3ZE2A 2PFTA 4BP8A 2JPNA 2AGYA 1MMOG 2H9NA 4B08A 3I7KA 2LF3A 4AKIA 1E8MA 2P9PC 3N0EA 5EAMA 2GC7A 4D6VA 4ESGA 4FK4A 4G1EA 1YR2A 3CQ8A 3V4PA 1GOFA 3BG0A 4X5MA 1JTDB 2I3TA 1TYQC 3IJ1A 3L1NA 2B4EA 3EI2B 1U2VC 1FWXA 3UIQA 2OIZA 3K72A 4GGCA 1VZ3A 1ERJA 3EI3A 3TL8B 3KCIA 2JHCA 1WAFA 2E31A 2Z2OA 3IKOA 4QT8A 5EM2B 4AI6A 4Z7NA 4ADOA 1UTCA 4NENA 3RFHA 3IJCA 5HDBA 1GG2B 1JMZB 3DWLC 4FK0A 4A0BB 1MHZG 3CFPA 3SBRA 4FJMA 3L4MD 5FKTA 2J55H 5IGOA 3ZE0A 1UOOA 4K3ID 1SQ9A 4PC0A 3HP9A 3NVXA 3AH8B 2AH0A 2FW3A 1GOGA 2H6NA 3SFZA 3ULEC 3UO2A 2B8IA 4FAVD 4Z7OA 5K19A 2CO0C 2P1OB 1XU3E 1XIPA 3C94A 3IUMA 1H2ZA 3DXMC 3F3FA 5AMSA 5IREA 1N6DA 2OZMA 1O6FA 1K3IA 2OK6A 4AN1A 1TYEA 4J2EA 5IT9g 2AGZA 4KHWA 3EMHA 3I7HA 1OLZA 4X5NA 4AKGA 5TDHB 5GXIA 4FWWA 4GGAA 4JHPC 3MKQA 4FJ9A 3OKYB 5IC7A 4BCBA 1XVCE 4DU3A 4FJ5A 4M3TA 1Q47A 3FGBA 2B7MA 4EWRA 3EWEA 3HL8A 4QNDA 4QRJA 5CXBA 3UVOA 3IIWA 4FHLA 1XMFE 1OMWB 3I7LA 3NIGA 2JH9A 3JRPA 1BPOA 4TZ4A 2XZGA 5EMKB 3VI3A 1H2XA 2GNQA 2H6KA 1FZ0E 3O4GA 4E4BA 1XVEE 5HYNB 2JKXA 2XL3A 1FZ1E 1LDKE 3A0FA 2PM6B 4UM8A 1CLQA 3SBPA 3SCXA 4O45A 1N1CA 1MG2A 4I9LA 4O2WA 3GFCA 4A08B 3UO3A 3W15A 4GQ1A 3F3PA 4N14A 4I6JB 4DTUA 5EALA 2H14A 4M3UA 3KRXB 3VA6A 1IH7A 3NIDA 4J78A 2G99A 3LDBA 4DTJA 2I0SA 5IZ7A 2EICA 4BCDA 3QESA 3K6SA 4KHSA 4ZOZA 3JROA 4CZYA 3I2NA 3JZHA 5FKSA 2HXCA 4OZUA 4H5IA 3QI0A 2VDNA 5EMLB 3V4VA 1NR0A 3MZKA 1PGUA 4AMZA 4HDJA 2P1QB 4HCCA 5HQGA 2YBAA 3SUNA 2XYIA 3SVIA 4JRPA 2H3XA 2YMUA 4PSXB 3RMZD 2HD0A 2B5NA 4LG8A 3UVKA 1C9IA 3SVWD 4FK2A 4UM9A 3MKSB 3E0CA 4R7AB 1SHYB 3OW8A 2XL2A 3TJYA 5H1MA 4FJ7A 4RNGA 2P9SC 3K27A 3MUNA 5FQDA 4PBZA 4IT5A 1QFMA 1U4CA 4WK2A 4CY2A 3AL9A 2YNPA 4J2DA 1FZ2E 4NC4A 5I5MA 4G56B 1GP2B 4J84A 4ADNA 2MTAH 4O3TB 4JD2C 4U1EI 3N0DA 1XU5E 4NBMA 4ERQA 2P9NC 1IG9A 3J80g 2OK4A 4HCBA 2P9UC 2VDLA 3OL2B 3UVNA 3CFVA 3NGIA 4JT6C 2VDQA 4L1QD 2YB5A 1PI6A 4ZN4A 4JT5C 3T3PA 4NSXA 2ATQA 4DTPA 3C6NB 4GGDA 2JHAA 4DTRA 3TAEA 3BWSA 4A09B 1FZ9E 2QZPA 4JXMA 2P9LC 5H37A 5GMKn 2H4TA 3EI3B 1N6FA 3RSEC 2P5OA 5KDOB 3I8EA 4JSNC 2P9KC 4DU1A 3PE7A 4ES0A 3PXTD 2VZ1A 3QEWA 1FZ4E 2AH1A 2Z2PA 3IJ0A 3MZLA 3SCYA 4E5ZA 2HJ4A 5C9ZB 1FPOA 2H9PA 5IBKB 1B9XA 2VDOA 3RFGA 4FA9D 3WSOA 5JWZA 2XU7A 3PVWB 4A0AA 2BCJB 2IURA 2I0RA 5H17A 4CC9A 4M3YA 1GXRA 2PM9A 4MMZA 5I5IA 5M5TA 2XDWA 1U8CA 3ZWLB 3RWUA 3E4WA 5AFU3 3SLED 2OZSA 5CYKB 4MMYA 1FZIE 4DTSA 3ZDZA 5THAA 3GC3B 4DU4A 4A2MA 2VIXA 2B1EA 1B9YA 3HGKE 1JV2A 2TRCB 4ZOXA 4GZ8A 2AQ5A 2EBSA 5FKQA 4FA4D 3KRWB 3PSLA 1FS1A 2H47A 3UKUC 1E8NA 2VDRA 2OJYA 4J2AA 3LDSA 3LZIA 4KI6A 4J86A 5M5UA 4KHNA 3DSMA 4GAMC 1E5TA 1JW2A 3J27A 3RLMD 3RMDA 3IUQA 4FJXA 4DTXA 4LG9A 1FYZE 2H68A 3CIKB 4NAAA 3PVUB 1MG3A 2P1NB 2Q7QA 4DNVA 5FLXg 2HU8A 4XYIA 4BP9A 3EG6A 5TEEA 2QR5A 4J8BA 3U4YA 3P4FA 1FZ6E 4BCCA 1RI6A 3SJLD 4U7AA 1H2YA 2EIEA 3QEPA 4CZXA 5E6RA 3O4HA 3AL8B 3CFOA 4DTMA 1M1XA 1XMGE 2CE9A 4JSXC 4A0BA 2E32A 2B5MA 2IWKA 4L3HD 3C9CA 4JRQA 4M3WA 4X3EA 3RMAA 1R5MA 3TAGA 5GXHA 2VC2A 4RE6A 5M5VA 3EI1B 3NHGA 2RCUA 5TF2A 2VDKA 3QEXA 4AMYA 2P5GA 2QC5A 4PSWB 2AGLA 2HJBA 4CY5A 1VYHC 4M42A 4D0KA 3PXWD 3IJEA 3ORVD 3SWSD 4CY1A 3SQ4A 4FJNA 1C9LA 4Y7RA 1QFSA 2PBIB 1UOPA 4LGNA 4O1QD 3J81g 4J82A 3SNNA 3C99A 4BH6A 3HGLA 3OKYA 4J8GA 1PEVA 4GQBB 3DDUA 4KHQA 3L4OD 3EI4A 3OGKB 3SUQA 1K32A 1VE6A 3NE6A 2HKRA 3SBQA 4JSVC 2OVQB 4ERYA 4CY3A 5CXCB 2BBKH 5K1CC 2IUVA 3FRXA 3SUOA 5M61A 3L8BA 3PSCB 4E54B 4M41A 3QEIA 4PNKB 1VZ2A 2OVPB 3MMYA 2YB8B 2HU5A 2EIBA 2RKHA 1SQJA 4JS5A 2K5SA 4EYWA 4X61B 5E6UA 5FFGA 4GM3A 2PFVA 4JHNA 2DTUA 3IUJA 4DNWA 3I89A 3I7OA 3N1BA 4FA1D 4ZOYA 5IJ8E 4QQEA 4O3UB 3BG1A 2IAAA 3TAFA 2MW2A 4G1MA 4MMXA 3T3MA 4FJJA 3SI6A 2HYEA 3UVLA 2H6QA 2CN3A 4L1MA 3CFSB 3DXKC 2IWFA 3SPYA 1Q9XA 2YNOA 2H9LA 3LD8A 4FJ8A 4CI8A 4AKHA 4PXWA 2VJ4A 2I0TA 4M45A 3JPXA 1I2MB 2J57G 4FAND 1MTYG 5FXYA 1WAJA 4RG8A 2OYQA 3OGMB
chains in the Genus database with same CATH topology
3C5MA 4KFMB 5FA5B 1XVFE 3N1EA 1XHMA 3NDKA 3SPZA 5HE1B 4DTOA 2B5LA 5HE0B 2HKMA 3GREA 3OL2A 1FZ7E 4A11A 2CO0A 2GC4A 4ZOVA 5EMJB 3DM0A 1MDAH 2PM7B 2FYOA 4PBYA 4AEZA 2J56H 3IIYA 3OKTA 4ERZA 2VJ5A 4M3XA 2P1PB 3L2OB 4CZVA 4FA5D 5FKRA 4A09A 3JB9L 4EPHA 1L0QA 3UR4A 1P22A 2DY4A 4BUJC 3I7NA 3JZGA 2MMBA 1FZ5E 3NCIA 2P9IC 4J0XA 4YVDA 1XVBE 5CXBB 3EI2A 5H14A 4FB1D 4CI1A 5GSAA 3QNOA 4J77A 4AOWA 2QXVA 4J73A 4UI9R 4X63B 4A7JA 4FJLA 5IGQA 3MXXA 5EM2A 3SHFA 4J81A 2JHPA 2QXFA 4CI3A 5CYKA 4KI4A 4O9DA 1FZ3E 3KD5E 2IUQA 3V5WB 5A2Qg 2MZWB 3KD1E 3C6PB 3V9FA 3OGLB 1XVDE 1TBGA 3RN1D 4J79A 4OWRA 1YFQA 3SN6B 3C95A 3E4YA 2AGWA 3QEVA 4H5JA 1NEXB 2JH8A 5SXMA 1XVGE 5HE2B 1S4UX 1XKSA 4DTNA 4EP9A 3TABA 3ODTA 3SUPA 3QNNA 1MHYG 3EI4B 2O9KA 4K3JB 3LZJA 1QNIA 5C2VB 3PXSD 2H9MA 4FVMA 3L0MA 3RMCA 4XYHA 4FJIA 1XL3C 3SMRA 1FZ8E 1JOFA 1JJUB 4IA9A 4M3ZA 1XMHE 3SQ2A 4KHYA 1GOTB 2AGXA 3UVMA 4E3SA 5EAPA 3JZNA 3B7FA 2CNXA 3AL8A 4L9OA 5B4WA 3SJJA 4GM9A 4JS4A 3JAMg 2HESX 1FXXA 3FM0A 1Q9YA 3QERA 4CI2A 3QETA 2CE8A 2CN2A 4Z8LA 4L3GD 3EI1A 3K26A 2UZXB 4J2BA 1A0RB 1K8KC 4KHUA 4A08A 5AJAA 3RMBA 2H13A 4I9QA 3S9HA 3C75H 3HFQA 3I8CA 4IMMA 1FZHE 4RL5A 1N6EA 2I3SA 4JSPC 5EARA 5HE3B 3C6OB 3UKRC 2LF6A 4FJKA 4I79A 2DEBA 3F3GA 3EU7A 4J0WA 4J87A 3SXTD 3CFRA 4GMBA 4MK0B 5I5JA 4E5ZB 3SQ0A 2YNNA 1JMXB 4BL0A 2P1MB 3OTTA 5TEFA 4QL1A 2OVRB 3RN0D 2G9AA 3VGZA 4A0AB 4GQ2P 3OKWA 4FJGA 3NAEA 5C2WB 4XEIC 5IJ7E 5CXCA 2PM9B 3J2PA 1PBYB 2IUPA 4A2LA 3I7PA 2W18A 4QNCA 3NVNA 3AFCA 2UZYB 3K2OA 4E54A 4A11B 4FJHA 2Z2NA 5EMMB 4X60B 3SQ1A 4M3RA 3VH0A 3V7DB 3NVQA 4GM8A 4Y5RD 3RRMC 2PFTA 2JPNA 2AGYA 1MMOG 2H9NA 4B08A 3I7KA 2LF3A 4AKIA 2P9PC 3N0EA 5EAMA 4ESGA 2GC7A 4D6VA 4FK4A 3CQ8A 3BG0A 4X5MA 2I3TA 1TYQC 3IJ1A 3L1NA 2B4EA 3EI2B 1U2VC 1FWXA 3UIQA 2OIZA 4GGCA 1ERJA 3EI3A 3TL8B 2JHCA 1WAFA 2E31A 2Z2OA 3IKOA 4QT8A 5EM2B 4AI6A 4ADOA 3RFHA 3IJCA 1GG2B 1JMZB 3DWLC 4FK0A 4A0BB 1MHZG 3CFPA 3SBRA 4FJMA 3L4MD 5FKTA 2J55H 5IGOA 4K3ID 1SQ9A 4PC0A 3HP9A 3NVXA 3AH8B 2AH0A 2FW3A 2H6NA 3SFZA 3ULEC 4FAVD 2B8IA 5K19A 2CO0C 2P1OB 1XU3E 1XIPA 3C94A 3F3FA 3DXMC 5AMSA 5IREA 1N6DA 2OZMA 2OK6A 4J2EA 5IT9g 2AGZA 4KHWA 3EMHA 3I7HA 1OLZA 4X5NA 4AKGA 5TDHB 5GXIA 4FWWA 4GGAA 3MKQA 4FJ9A 3OKYB 5IC7A 1XVCE 4DU3A 4FJ5A 4M3TA 1Q47A 3FGBA 2B7MA 4EWRA 3EWEA 3HL8A 4QNDA 4QRJA 5CXBA 3UVOA 3IIWA 4FHLA 1XMFE 1OMWB 3I7LA 2JH9A 3JRPA 4TZ4A 5EMKB 2GNQA 2H6KA 5HYNB 1FZ0E 4E4BA 1XVEE 2XL3A 1FZ1E 1LDKE 3A0FA 2PM6B 1CLQA 3SBPA 3SCXA 4O45A 1MG2A 4I9LA 4A08B 3GFCA 3W15A 4GQ1A 3F3PA 4N14A 4I6JB 4DTUA 5EALA 2H14A 4M3UA 3KRXB 3VA6A 1IH7A 4J78A 2G99A 3LDBA 4DTJA 2I0SA 5IZ7A 3QESA 4KHSA 4ZOZA 3JROA 4CZYA 3I2NA 3JZHA 5FKSA 2HXCA 4OZUA 4H5IA 5EMLB 1NR0A 3MZKA 1PGUA 4HDJA 2P1QB 4HCCA 5HQGA 2YBAA 3SUNA 2XYIA 3SVIA 4JRPA 2H3XA 2YMUA 4PSXB 3RMZD 2HD0A 2B5NA 4LG8A 3UVKA 3SVWD 4FK2A 3MKSB 3E0CA 4R7AB 1SHYB 3OW8A 2XL2A 3TJYA 5H1MA 4FJ7A 4RNGA 2P9SC 3K27A 5FQDA 4PBZA 1U4CA 4CY2A 3AL9A 2YNPA 4J2DA 1FZ2E 5I5MA 4G56B 1GP2B 4J84A 4ADNA 2MTAH 4O3TB 4JD2C 4U1EI 3N0DA 1XU5E 4ERQA 2P9NC 1IG9A 3J80g 2OK4A 4HCBA 2P9UC 3OL2B 3UVNA 3CFVA 3NGIA 4JT6C 4L1QD 2YB5A 1PI6A 4ZN4A 4JT5C 4NSXA 2ATQA 4DTPA 3C6NB 4GGDA 2JHAA 4DTRA 3TAEA 3BWSA 4A09B 1FZ9E 4JXMA 2P9LC 5H37A 5GMKn 2H4TA 3EI3B 1N6FA 3RSEC 2P5OA 5KDOB 3I8EA 4JSNC 2P9KC 4DU1A 3PE7A 4ES0A 3PXTD 3QEWA 1FZ4E 2AH1A 2Z2PA 3IJ0A 3MZLA 3SCYA 4E5ZA 2HJ4A 5C9ZB 2H9PA 5IBKB 1B9XA 3RFGA 4FA9D 5JWZA 3WSOA 2XU7A 3PVWB 4A0AA 2BCJB 2IURA 2I0RA 5H17A 4CC9A 4M3YA 1GXRA 2PM9A 5I5IA 3ZWLB 3RWUA 3E4WA 5AFU3 3SLED 2OZSA 5CYKB 1FZIE 4DTSA 5THAA 4DU4A 4A2MA 2VIXA 2B1EA 1B9YA 3HGKE 2TRCB 4ZOXA 4GZ8A 2AQ5A 2EBSA 5FKQA 4FA4D 3KRWB 3PSLA 1FS1A 2H47A 3UKUC 2OJYA 4J2AA 3LDSA 3LZIA 4KI6A 4J86A 4KHNA 3DSMA 4GAMC 3J27A 3RLMD 3RMDA 4FJXA 4DTXA 4LG9A 1FYZE 2H68A 3CIKB 3PVUB 1MG3A 2P1NB 2Q7QA 5FLXg 4XYIA 3EG6A 5TEEA 4J8BA 3U4YA 3P4FA 1FZ6E 1RI6A 3SJLD 4U7AA 3QEPA 4CZXA 3AL8B 3CFOA 4DTMA 2CE9A 1XMGE 4JSXC 4A0BA 2E32A 2B5MA 2IWKA 4L3HD 3C9CA 4JRQA 4M3WA 4X3EA 3RMAA 1R5MA 3TAGA 5GXHA 3EI1B 3NHGA 2RCUA 5TF2A 3QEXA 2P5GA 2QC5A 4PSWB 2AGLA 2HJBA 4CY5A 1VYHC 4M42A 4D0KA 3PXWD 3ORVD 3SWSD 4CY1A 3SQ4A 4FJNA 4Y7RA 2PBIB 4LGNA 4O1QD 3J81g 4J82A 3SNNA 3C99A 4BH6A 3HGLA 3OKYA 4J8GA 1PEVA 4GQBB 4KHQA 3L4OD 3EI4A 3OGKB 3SUQA 1K32A 3NE6A 2HKRA 3SBQA 4JSVC 2OVQB 4ERYA 4CY3A 5CXCB 2BBKH 5K1CC 2IUVA 3FRXA 3SUOA 3L8BA 3PSCB 4E54B 4M41A 3QEIA 4PNKB 2OVPB 3MMYA 2YB8B 1SQJA 4JS5A 4EYWA 4X61B 4GM3A 2PFVA 2DTUA 3I89A 3I7OA 3N1BA 4FA1D 4ZOYA 5IJ8E 4QQEA 4O3UB 3BG1A 2IAAA 3TAFA 4FJJA 3SI6A 2HYEA 3UVLA 2H6QA 2CN3A 3CFSB 3DXKC 2IWFA 3SPYA 1Q9XA 2YNOA 2H9LA 3LD8A 4FJ8A 4CI8A 4AKHA 4PXWA 2VJ4A 2I0TA 4M45A 3JPXA 2J57G 4FAND 1MTYG 5FXYA 1WAJA 4RG8A 2OYQA 3OGMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5M A;  4KFM B;  5FA5 B;  1XHM A;  5HE1 B;  2B5L A;  5HE0 B;  2HKM A;  3GRE A;  3OL2 A;  4A11 A;  2CO0 A;  2GC4 A;  4ZOV A;  5EMJ B;  3DM0 A;  1MDA H;  2PM7 B;  4PBY A;  4AEZ A;  2J56 H;  3IIY A;  3OKT A;  4ERZ A;  2P1P B;  3L2O B;  4CZV A;  4FA5 D;  5FKR A;  4A09 A;  3JB9 L;  1L0Q A;  3UR4 A;  1P22 A;  4BUJ C;  3I7N A;  3JZG A;  2P9I C;  4J0X A;  4YVD A;  5CXB B;  3EI2 A;  5H14 A;  4FB1 D;  4CI1 A;  5GSA A;  4J77 A;  4AOW A;  2QXV A;  4J73 A;  4UI9 R;  4X63 B;  4A7J A;  5IGQ A;  3MXX A;  5EM2 A;  3SHF A;  4J81 A;  4CI3 A;  5CYK A;  4O9D A;  2IUQ A;  3V5W B;  5A2Q g;  3C6P B;  3V9F A;  1TBG A;  3RN1 D;  4J79 A;  4OWR A;  1YFQ A;  3SN6 B;  2AGW A;  4H5J A;  1NEX B;  5SXM A;  5HE2 B;  1S4U X;  1XKS A;  3ODT A;  3EI4 B;  2O9K A;  4K3J B;  1QNI A;  5C2V B;  3PXS D;  2H9M A;  4XYH A;  3SMR A;  1JOF A;  4IA9 A;  1JJU B;  1GOT B;  2AGX A;  3UVM A;  5EAP A;  3JZN A;  3B7F A;  2CNX A;  3AL8 A;  4L9O A;  5B4W A;  4GM9 A;  3JAM g;  2HES X;  3FM0 A;  4CI2 A;  2CE8 A;  2CN2 A;  4Z8L A;  4L3G D;  3EI1 A;  3K26 A;  2UZX B;  1A0R B;  1K8K C;  4A08 A;  5AJA A;  2H13 A;  3C75 H;  3HFQ A;  3I8C A;  4IMM A;  1N6E A;  2I3S A;  4JSP C;  5EAR A;  5HE3 B;  3C6O B;  3UKR C;  4I79 A;  3F3G A;  4J0W A;  3EU7 A;  4J87 A;  3SXT D;  4GMB A;  4MK0 B;  5I5J A;  4E5Z B;  2YNN A;  1JMX B;  4BL0 A;  2P1M B;  3OTT A;  5TEF A;  4QL1 A;  2OVR B;  3RN0 D;  2G9A A;  3VGZ A;  4A0A B;  4GQ2 P;  3OKW A;  5C2W B;  4XEI C;  5IJ7 E;  5CXC A;  2PM9 B;  1PBY B;  2IUP A;  4A2L A;  3I7P A;  2W18 A;  3NVN A;  3AFC A;  2UZY B;  4E54 A;  4A11 B;  2Z2N A;  5EMM B;  4X60 B;  3OGM B;  3VH0 A;  3V7D B;  3NVQ A;  4GM8 A;  4Y5R D;  3RRM C;  2AGY A;  2H9N A;  3I7K A;  3N0E A;  2P9P C;  5EAM A;  4ESG A;  2GC7 A;  4D6V A;  3BG0 A;  2I3T A;  1TYQ C;  3IJ1 A;  2B4E A;  3EI2 B;  1U2V C;  1FWX A;  2OIZ A;  4GGC A;  1ERJ A;  3EI3 A;  2E31 A;  3IKO A;  2Z2O A;  4QT8 A;  5EM2 B;  3RFH A;  3IJC A;  1GG2 B;  1JMZ B;  3DWL C;  4A0B B;  3SBR A;  5FKT A;  3L4M D;  2J55 H;  5IGO A;  4K3I D;  1SQ9 A;  4PC0 A;  3NVX A;  3AH8 B;  2AH0 A;  2H6N A;  3SFZ A;  3ULE C;  4FAV D;  5K19 A;  2CO0 C;  2P1O B;  1XIP A;  3F3F A;  3DXM C;  5AMS A;  1N6D A;  2OK6 A;  5IT9 g;  2AGZ A;  3EMH A;  3I7H A;  1OLZ A;  5TDH B;  5GXI A;  4FWW A;  4GGA A;  3MKQ A;  3OKY B;  5IC7 A;  1Q47 A;  3FGB A;  4EWR A;  3EWE A;  4QRJ A;  5CXB A;  3UVO A;  3IIW A;  4FHL A;  1OMW B;  3I7L A;  3JRP A;  4TZ4 A;  5EMK B;  2GNQ A;  2H6K A;  5HYN B;  2XL3 A;  1LDK E;  3A0F A;  2PM6 B;  3SBP A;  4O45 A;  1MG2 A;  4A08 B;  3GFC A;  3W15 A;  4GQ1 A;  3F3P A;  4N14 A;  4I6J B;  5EAL A;  2H14 A;  3KRX B;  3VA6 A;  4J78 A;  2G99 A;  2I0S A;  4ZOZ A;  3JRO A;  4CZY A;  3I2N A;  3JZH A;  5FKS A;  2HXC A;  4OZU A;  4H5I A;  5EML B;  1NR0 A;  3MZK A;  1PGU A;  4HDJ A;  2P1Q B;  5HQG A;  2YBA A;  2XYI A;  2H3X A;  2YMU A;  4PSX B;  3RMZ D;  2B5N A;  3UVK A;  4LG8 A;  3SVW D;  3MKS B;  3E0C A;  4R7A B;  1SHY B;  3OW8 A;  2XL2 A;  5H1M A;  3K27 A;  2P9S C;  5FQD A;  4PBZ A;  1U4C A;  4CY2 A;  3AL9 A;  2YNP A;  5I5M A;  4G56 B;  1GP2 B;  4J84 A;  2MTA H;  4O3T B;  4JD2 C;  4U1E I;  3N0D A;  4ERQ A;  2P9N C;  3J80 g;  2OK4 A;  2P9U C;  3OL2 B;  3UVN A;  3CFV A;  4JT6 C;  4L1Q D;  1PI6 A;  4ZN4 A;  4JT5 C;  4NSX A;  4GGD A;  3C6N B;  3BWS A;  4A09 B;  4JXM A;  2P9L C;  5GMK n;  5KDO B;  3EI3 B;  1N6F A;  3RSE C;  3I8E A;  4JSN C;  2P9K C;  3PE7 A;  4ES0 A;  3PXT D;  4E5Z A;  2AH1 A;  2Z2P A;  3IJ0 A;  3MZL A;  3SCY A;  2HJ4 A;  5C9Z B;  2H9P A;  5IBK B;  1B9X A;  3RFG A;  4FA9 D;  5JWZ A;  3WSO A;  2XU7 A;  3PVW B;  4A0A A;  2BCJ B;  2IUR A;  2I0R A;  5H17 A;  4CC9 A;  1GXR A;  2PM9 A;  5I5I A;  3ZWL B;  5AFU 3;  3SLE D;  5CYK B;  5THA A;  4A2M A;  1B9Y A;  2TRC B;  4ZOX A;  2AQ5 A;  2EBS A;  5FKQ A;  4FA4 D;  3KRW B;  3PSL A;  1FS1 A;  2H47 A;  3UKU C;  2OJY A;  4J86 A;  3DSM A;  3RLM D;  4LG9 A;  3CIK B;  2H68 A;  3PVU B;  1MG3 A;  2P1N B;  2Q7Q A;  5FLX g;  4XYI A;  3EG6 A;  5TEE A;  4J8B A;  3U4Y A;  3P4F A;  1RI6 A;  3SJL D;  4U7A A;  4CZX A;  3AL8 B;  2CE9 A;  4JSX C;  4A0B A;  2E32 A;  2B5M A;  2IWK A;  4L3H D;  3C9C A;  4X3E A;  1R5M A;  5GXH A;  3EI1 B;  5TF2 A;  2QC5 A;  4PSW B;  2AGL A;  2HJB A;  4CY5 A;  1VYH C;  4D0K A;  3PXW D;  3ORV D;  3SWS D;  4CY1 A;  4Y7R A;  2PBI B;  4LGN A;  4O1Q D;  3J81 g;  4J82 A;  3C99 A;  4BH6 A;  3OKY A;  4J8G A;  1PEV A;  4GQB B;  3L4O D;  3EI4 A;  1K32 A;  3OGK B;  2HKR A;  3SBQ A;  4JSV C;  2OVQ B;  4ERY A;  4CY3 A;  5CXC B;  2BBK H;  5K1C C;  2IUV A;  3FRX A;  3PSC B;  4E54 B;  4PNK B;  2OVP B;  3MMY A;  2YB8 B;  1SQJ A;  4X61 B;  4GM3 A;  3I89 A;  3I7O A;  4FA1 D;  4ZOY A;  5IJ8 E;  4QQE A;  4O3U B;  3BG1 A;  2IAA A;  2HYE A;  3UVL A;  2H6Q A;  2CN3 A;  3CFS B;  3DXK C;  2IWF A;  2YNO A;  2H9L A;  4CI8 A;  4PXW A;  2I0T A;  3JPX A;  2J57 G;  4FAN D;  5FXY A;  3OGL B;  4GZ8 A; 
#chains in the Genus database with same CATH topology
 3C5M A;  4KFM B;  3GD1 I;  5FA5 B;  1XVF E;  3N1E A;  1XHM A;  3FCS A;  3NDK A;  3SPZ A;  5HE1 B;  4DNU A;  3ZDX A;  4DTO A;  2B5L A;  3QHY B;  2HKM A;  4G55 A;  2VZ3 A;  5HE0 B;  3GRE A;  3OL2 A;  1FZ7 E;  4A11 A;  2CO0 A;  2GC4 A;  3EQ8 A;  4ZOV A;  5EMJ B;  3DM0 A;  1MDA H;  2PM7 B;  2FYO A;  4PBY A;  4AEZ A;  1VE7 A;  2J56 H;  3IIY A;  3OKT A;  4ERZ A;  2VJ5 A;  4M3X A;  2P1P B;  3L2O B;  4CZV A;  4FA5 D;  4WK0 A;  5FKR A;  4A09 A;  3JB9 L;  4EPH A;  3O4J A;  2HU7 A;  1L0Q A;  4AX4 A;  3UR4 A;  1P22 A;  2DY4 A;  4BUJ C;  3I7N A;  3JZG A;  4AN0 A;  2MMB A;  1FZ5 E;  3NCI A;  1T2X A;  2P9I C;  4J0X A;  1L5G A;  4YVD A;  1XVB E;  3IUL A;  5CXB B;  3EI2 A;  5H14 A;  4FB1 D;  4CI1 A;  1A12 A;  5GSA A;  3QNO A;  4J77 A;  4AOW A;  2QXV A;  3EQ9 A;  4J73 A;  4UI9 R;  4X63 B;  4A7J A;  4FJL A;  5IGQ A;  3MXX A;  5EM2 A;  4WJK A;  3SHF A;  2VDM A;  4J81 A;  2JHP A;  2QXF A;  2XE4 A;  4CI3 A;  5CYK A;  4KI4 A;  4O9D A;  1FZ3 E;  3KD5 E;  2IUQ A;  3V5W B;  5A2Q g;  2MZW B;  3KD1 E;  3C6P B;  3V9F A;  5C92 A;  3OGL B;  1XVD E;  1TBG A;  3RN1 D;  2VDP A;  3MUO A;  4J79 A;  4OWR A;  1YFQ A;  3SN6 B;  3C95 A;  3E4Y A;  2AGW A;  2BKL A;  3QEV A;  4H5J A;  1NEX B;  2JH8 A;  5SXM A;  1XVG E;  5HE2 B;  1S4U X;  1XKS A;  4DTN A;  4EP9 A;  3TAB A;  3ODT A;  3SUP A;  3QNN A;  1MHY G;  3EI4 B;  3EQ7 A;  3IVM A;  2O9K A;  1O6G A;  4K3J B;  3LZJ A;  1QNI A;  5C2V B;  3PXS D;  2H9M A;  4FVM A;  3L0M A;  3RMC A;  4XYH A;  4FJI A;  1XL3 C;  3SMR A;  4D9S A;  1FZ8 E;  1JOF A;  1JJU B;  4IA9 A;  4M3Z A;  1XMH E;  3SQ2 A;  4KHY A;  1GOT B;  2AGX A;  4WK4 A;  3UVM A;  4E3S A;  5EAP A;  3JZN A;  3B7F A;  2CNX A;  3AL8 A;  4L9O A;  5B4W A;  3SJJ A;  1UOQ A;  4GM9 A;  4JS4 A;  3JAM g;  2HES X;  4RE5 A;  1FXX A;  3FM0 A;  1Q9Y A;  3QER A;  4O02 A;  3K71 A;  4CI2 A;  2JQT A;  3BVO A;  3QET A;  2CE8 A;  2CN2 A;  4Z8L A;  4L3G D;  3EI1 A;  3IUN A;  3K26 A;  2EID A;  2UZX B;  4J2B A;  1A0R B;  1K8K C;  4KHU A;  4A08 A;  5AJA A;  3RMB A;  2H13 A;  3ZDY A;  4I9Q A;  3S9H A;  2WQ8 A;  5C86 A;  3C75 H;  3HFQ A;  3IUR A;  3I8C A;  4IMM A;  1FZH E;  4RL5 A;  1N6E A;  3ZE1 A;  2I3S A;  4JSP C;  5EAR A;  5HE3 B;  3C6O B;  3O4I A;  3UKR C;  2LF6 A;  3FCU A;  4FJK A;  4I79 A;  4ICG C;  2DEB A;  3F3G A;  3EU7 A;  4J0W A;  4J87 A;  3SXT D;  3CFR A;  5M5S A;  4GMB A;  4MK0 B;  5E6S A;  4IRZ A;  5I5J A;  4E5Z B;  1GOH A;  3SQ0 A;  2YNN A;  1JMX B;  4BL0 A;  2P1M B;  1H2W A;  3OTT A;  5TEF A;  4QL1 A;  4QAM A;  2OVR B;  3RN0 D;  2G9A A;  3VGZ A;  4A0A B;  4GQ2 P;  3OKW A;  4FJG A;  3NAE A;  5C2W B;  4XEI C;  4Z7Q A;  5IJ7 E;  5CXC A;  2PM9 B;  3J2P A;  1PBY B;  2IUP A;  4A2L A;  3I7P A;  2W18 A;  5FFO A;  4QNC A;  3NVN A;  3AFC A;  2UZY B;  3K2O A;  3VI4 A;  4E54 A;  4A11 B;  4FJH A;  2Z2N A;  3OF7 A;  5EMM B;  4X60 B;  3SQ1 A;  5M5R A;  4M3R A;  3MVD K;  3VH0 A;  3V7D B;  3NVQ A;  4GM8 A;  4Y5R D;  3NIF A;  3RRM C;  3ZE2 A;  2PFT A;  4BP8 A;  2JPN A;  2AGY A;  1MMO G;  2H9N A;  4B08 A;  3I7K A;  2LF3 A;  4AKI A;  1E8M A;  2P9P C;  3N0E A;  5EAM A;  2GC7 A;  4D6V A;  4ESG A;  4FK4 A;  4G1E A;  1YR2 A;  3CQ8 A;  3V4P A;  1GOF A;  3BG0 A;  4X5M A;  1JTD B;  2I3T A;  1TYQ C;  3IJ1 A;  3L1N A;  2B4E A;  3EI2 B;  1U2V C;  1FWX A;  3UIQ A;  2OIZ A;  3K72 A;  4GGC A;  1VZ3 A;  1ERJ A;  3EI3 A;  3TL8 B;  3KCI A;  2JHC A;  1WAF A;  2E31 A;  2Z2O A;  3IKO A;  4QT8 A;  5EM2 B;  4AI6 A;  4Z7N A;  4ADO A;  1UTC A;  4NEN A;  3RFH A;  3IJC A;  5HDB A;  1GG2 B;  1JMZ B;  3DWL C;  4FK0 A;  4A0B B;  1MHZ G;  3CFP A;  3SBR A;  4FJM A;  3L4M D;  5FKT A;  2J55 H;  5IGO A;  3ZE0 A;  1UOO A;  4K3I D;  1SQ9 A;  4PC0 A;  3HP9 A;  3NVX A;  3AH8 B;  2AH0 A;  2FW3 A;  1GOG A;  2H6N A;  3SFZ A;  3ULE C;  3UO2 A;  2B8I A;  4FAV D;  4Z7O A;  5K19 A;  2CO0 C;  2P1O B;  1XU3 E;  1XIP A;  3C94 A;  3IUM A;  1H2Z A;  3DXM C;  3F3F A;  5AMS A;  5IRE A;  1N6D A;  2OZM A;  1O6F A;  1K3I A;  2OK6 A;  4AN1 A;  1TYE A;  4J2E A;  5IT9 g;  2AGZ A;  4KHW A;  3EMH A;  3I7H A;  1OLZ A;  4X5N A;  4AKG A;  5TDH B;  5GXI A;  4FWW A;  4GGA A;  4JHP C;  3MKQ A;  4FJ9 A;  3OKY B;  5IC7 A;  4BCB A;  1XVC E;  4DU3 A;  4FJ5 A;  4M3T A;  1Q47 A;  3FGB A;  2B7M A;  4EWR A;  3EWE A;  3HL8 A;  4QND A;  4QRJ A;  5CXB A;  3UVO A;  3IIW A;  4FHL A;  1XMF E;  1OMW B;  3I7L A;  3NIG A;  2JH9 A;  3JRP A;  1BPO A;  4TZ4 A;  2XZG A;  5EMK B;  3VI3 A;  1H2X A;  2GNQ A;  2H6K A;  1FZ0 E;  3O4G A;  4E4B A;  1XVE E;  5HYN B;  2JKX A;  2XL3 A;  1FZ1 E;  1LDK E;  3A0F A;  2PM6 B;  4UM8 A;  1CLQ A;  3SBP A;  3SCX A;  4O45 A;  1N1C A;  1MG2 A;  4I9L A;  4O2W A;  3GFC A;  4A08 B;  3UO3 A;  3W15 A;  4GQ1 A;  3F3P A;  4N14 A;  4I6J B;  4DTU A;  5EAL A;  2H14 A;  4M3U A;  3KRX B;  3VA6 A;  1IH7 A;  3NID A;  4J78 A;  2G99 A;  3LDB A;  4DTJ A;  2I0S A;  5IZ7 A;  2EIC A;  4BCD A;  3QES A;  3K6S A;  4KHS A;  4ZOZ A;  3JRO A;  4CZY A;  3I2N A;  3JZH A;  5FKS A;  2HXC A;  4OZU A;  4H5I A;  3QI0 A;  2VDN A;  5EML B;  3V4V A;  1NR0 A;  3MZK A;  1PGU A;  4AMZ A;  4HDJ A;  2P1Q B;  4HCC A;  5HQG A;  2YBA A;  3SUN A;  2XYI A;  3SVI A;  4JRP A;  2H3X A;  2YMU A;  4PSX B;  3RMZ D;  2HD0 A;  2B5N A;  4LG8 A;  3UVK A;  1C9I A;  3SVW D;  4FK2 A;  4UM9 A;  3MKS B;  3E0C A;  4R7A B;  1SHY B;  3OW8 A;  2XL2 A;  3TJY A;  5H1M A;  4FJ7 A;  4RNG A;  2P9S C;  3K27 A;  3MUN A;  5FQD A;  4PBZ A;  4IT5 A;  1QFM A;  1U4C A;  4WK2 A;  4CY2 A;  3AL9 A;  2YNP A;  4J2D A;  1FZ2 E;  4NC4 A;  5I5M A;  4G56 B;  1GP2 B;  4J84 A;  4ADN A;  2MTA H;  4O3T B;  4JD2 C;  4U1E I;  3N0D A;  1XU5 E;  4NBM A;  4ERQ A;  2P9N C;  1IG9 A;  3J80 g;  2OK4 A;  4HCB A;  2P9U C;  2VDL A;  3OL2 B;  3UVN A;  3CFV A;  3NGI A;  4JT6 C;  2VDQ A;  4L1Q D;  2YB5 A;  1PI6 A;  4ZN4 A;  4JT5 C;  3T3P A;  4NSX A;  2ATQ A;  4DTP A;  3C6N B;  4GGD A;  2JHA A;  4DTR A;  3TAE A;  3BWS A;  4A09 B;  1FZ9 E;  2QZP A;  4JXM A;  2P9L C;  5H37 A;  5GMK n;  2H4T A;  3EI3 B;  1N6F A;  3RSE C;  2P5O A;  5KDO B;  3I8E A;  4JSN C;  2P9K C;  4DU1 A;  3PE7 A;  4ES0 A;  3PXT D;  2VZ1 A;  3QEW A;  1FZ4 E;  2AH1 A;  2Z2P A;  3IJ0 A;  3MZL A;  3SCY A;  4E5Z A;  2HJ4 A;  5C9Z B;  1FPO A;  2H9P A;  5IBK B;  1B9X A;  2VDO A;  3RFG A;  4FA9 D;  3WSO A;  5JWZ A;  2XU7 A;  3PVW B;  4A0A A;  2BCJ B;  2IUR A;  2I0R A;  5H17 A;  4CC9 A;  4M3Y A;  1GXR A;  2PM9 A;  4MMZ A;  5I5I A;  5M5T A;  2XDW A;  1U8C A;  3ZWL B;  3RWU A;  3E4W A;  5AFU 3;  3SLE D;  2OZS A;  5CYK B;  4MMY A;  1FZI E;  4DTS A;  3ZDZ A;  5THA A;  3GC3 B;  4DU4 A;  4A2M A;  2VIX A;  2B1E A;  1B9Y A;  3HGK E;  1JV2 A;  2TRC B;  4ZOX A;  4GZ8 A;  2AQ5 A;  2EBS A;  5FKQ A;  4FA4 D;  3KRW B;  3PSL A;  1FS1 A;  2H47 A;  3UKU C;  1E8N A;  2VDR A;  2OJY A;  4J2A A;  3LDS A;  3LZI A;  4KI6 A;  4J86 A;  5M5U A;  4KHN A;  3DSM A;  4GAM C;  1E5T A;  1JW2 A;  3J27 A;  3RLM D;  3RMD A;  3IUQ A;  4FJX A;  4DTX A;  4LG9 A;  1FYZ E;  2H68 A;  3CIK B;  4NAA A;  3PVU B;  1MG3 A;  2P1N B;  2Q7Q A;  4DNV A;  5FLX g;  2HU8 A;  4XYI A;  4BP9 A;  3EG6 A;  5TEE A;  2QR5 A;  4J8B A;  3U4Y A;  3P4F A;  1FZ6 E;  4BCC A;  1RI6 A;  3SJL D;  4U7A A;  1H2Y A;  2EIE A;  3QEP A;  4CZX A;  5E6R A;  3O4H A;  3AL8 B;  3CFO A;  4DTM A;  1M1X A;  1XMG E;  2CE9 A;  4JSX C;  4A0B A;  2E32 A;  2B5M A;  2IWK A;  4L3H D;  3C9C A;  4JRQ A;  4M3W A;  4X3E A;  3RMA A;  1R5M A;  3TAG A;  5GXH A;  2VC2 A;  4RE6 A;  5M5V A;  3EI1 B;  3NHG A;  2RCU A;  5TF2 A;  2VDK A;  3QEX A;  4AMY A;  2P5G A;  2QC5 A;  4PSW B;  2AGL A;  2HJB A;  4CY5 A;  1VYH C;  4M42 A;  4D0K A;  3PXW D;  3IJE A;  3ORV D;  3SWS D;  4CY1 A;  3SQ4 A;  4FJN A;  1C9L A;  4Y7R A;  1QFS A;  2PBI B;  1UOP A;  4LGN A;  4O1Q D;  3J81 g;  4J82 A;  3SNN A;  3C99 A;  4BH6 A;  3HGL A;  3OKY A;  4J8G A;  1PEV A;  4GQB B;  3DDU A;  4KHQ A;  3L4O D;  3EI4 A;  3OGK B;  3SUQ A;  1K32 A;  1VE6 A;  3NE6 A;  2HKR A;  3SBQ A;  4JSV C;  2OVQ B;  4ERY A;  4CY3 A;  5CXC B;  2BBK H;  5K1C C;  2IUV A;  3FRX A;  3SUO A;  5M61 A;  3L8B A;  3PSC B;  4E54 B;  4M41 A;  3QEI A;  4PNK B;  1VZ2 A;  2OVP B;  3MMY A;  2YB8 B;  2HU5 A;  2EIB A;  2RKH A;  1SQJ A;  4JS5 A;  2K5S A;  4EYW A;  4X61 B;  5E6U A;  5FFG A;  4GM3 A;  2PFV A;  4JHN A;  2DTU A;  3IUJ A;  4DNW A;  3I89 A;  3I7O A;  3N1B A;  4FA1 D;  4ZOY A;  5IJ8 E;  4QQE A;  4O3U B;  3BG1 A;  2IAA A;  3TAF A;  2MW2 A;  4G1M A;  4MMX A;  3T3M A;  4FJJ A;  3SI6 A;  2HYE A;  3UVL A;  2H6Q A;  2CN3 A;  4L1M A;  3CFS B;  3DXK C;  2IWF A;  3SPY A;  1Q9X A;  2YNO A;  2H9L A;  3LD8 A;  4FJ8 A;  4CI8 A;  4AKH A;  4PXW A;  2VJ4 A;  2I0T A;  4M45 A;  3JPX A;  1I2M B;  2J57 G;  4FAN D;  1MTY G;  5FXY A;  1WAJ A;  4RG8 A;  2OYQ A;  3OGM B; 
#chains in the Genus database with same CATH homology
 3C5M A;  4KFM B;  5FA5 B;  1XVF E;  3N1E A;  1XHM A;  3NDK A;  3SPZ A;  5HE1 B;  4DTO A;  2B5L A;  5HE0 B;  2HKM A;  3GRE A;  3OL2 A;  1FZ7 E;  4A11 A;  2CO0 A;  2GC4 A;  4ZOV A;  5EMJ B;  3DM0 A;  1MDA H;  2PM7 B;  2FYO A;  4PBY A;  4AEZ A;  2J56 H;  3IIY A;  3OKT A;  4ERZ A;  2VJ5 A;  4M3X A;  2P1P B;  3L2O B;  4CZV A;  4FA5 D;  5FKR A;  4A09 A;  3JB9 L;  4EPH A;  1L0Q A;  3UR4 A;  1P22 A;  2DY4 A;  4BUJ C;  3I7N A;  3JZG A;  2MMB A;  1FZ5 E;  3NCI A;  2P9I C;  4J0X A;  4YVD A;  1XVB E;  5CXB B;  3EI2 A;  5H14 A;  4FB1 D;  4CI1 A;  5GSA A;  3QNO A;  4J77 A;  4AOW A;  2QXV A;  4J73 A;  4UI9 R;  4X63 B;  4A7J A;  4FJL A;  5IGQ A;  3MXX A;  5EM2 A;  3SHF A;  4J81 A;  2JHP A;  2QXF A;  4CI3 A;  5CYK A;  4KI4 A;  4O9D A;  1FZ3 E;  3KD5 E;  2IUQ A;  3V5W B;  5A2Q g;  2MZW B;  3KD1 E;  3C6P B;  3V9F A;  3OGL B;  1XVD E;  1TBG A;  3RN1 D;  4J79 A;  4OWR A;  1YFQ A;  3SN6 B;  3C95 A;  3E4Y A;  2AGW A;  3QEV A;  4H5J A;  1NEX B;  2JH8 A;  5SXM A;  1XVG E;  5HE2 B;  1S4U X;  1XKS A;  4DTN A;  4EP9 A;  3TAB A;  3ODT A;  3SUP A;  3QNN A;  1MHY G;  3EI4 B;  2O9K A;  4K3J B;  3LZJ A;  1QNI A;  5C2V B;  3PXS D;  2H9M A;  4FVM A;  3L0M A;  3RMC A;  4XYH A;  4FJI A;  1XL3 C;  3SMR A;  1FZ8 E;  1JOF A;  1JJU B;  4IA9 A;  4M3Z A;  1XMH E;  3SQ2 A;  4KHY A;  1GOT B;  2AGX A;  3UVM A;  4E3S A;  5EAP A;  3JZN A;  3B7F A;  2CNX A;  3AL8 A;  4L9O A;  5B4W A;  3SJJ A;  4GM9 A;  4JS4 A;  3JAM g;  2HES X;  1FXX A;  3FM0 A;  1Q9Y A;  3QER A;  4CI2 A;  3QET A;  2CE8 A;  2CN2 A;  4Z8L A;  4L3G D;  3EI1 A;  3K26 A;  2UZX B;  4J2B A;  1A0R B;  1K8K C;  4KHU A;  4A08 A;  5AJA A;  3RMB A;  2H13 A;  4I9Q A;  3S9H A;  3C75 H;  3HFQ A;  3I8C A;  4IMM A;  1FZH E;  4RL5 A;  1N6E A;  2I3S A;  4JSP C;  5EAR A;  5HE3 B;  3C6O B;  3UKR C;  2LF6 A;  4FJK A;  4I79 A;  2DEB A;  3F3G A;  3EU7 A;  4J0W A;  4J87 A;  3SXT D;  3CFR A;  4GMB A;  4MK0 B;  5I5J A;  4E5Z B;  3SQ0 A;  2YNN A;  1JMX B;  4BL0 A;  2P1M B;  3OTT A;  5TEF A;  4QL1 A;  2OVR B;  3RN0 D;  2G9A A;  3VGZ A;  4A0A B;  4GQ2 P;  3OKW A;  4FJG A;  3NAE A;  5C2W B;  4XEI C;  5IJ7 E;  5CXC A;  2PM9 B;  3J2P A;  1PBY B;  2IUP A;  4A2L A;  3I7P A;  2W18 A;  4QNC A;  3NVN A;  3AFC A;  2UZY B;  3K2O A;  4E54 A;  4A11 B;  4FJH A;  2Z2N A;  5EMM B;  4X60 B;  3SQ1 A;  4M3R A;  3VH0 A;  3V7D B;  3NVQ A;  4GM8 A;  4Y5R D;  3RRM C;  2PFT A;  2JPN A;  2AGY A;  1MMO G;  2H9N A;  4B08 A;  3I7K A;  2LF3 A;  4AKI A;  2P9P C;  3N0E A;  5EAM A;  4ESG A;  2GC7 A;  4D6V A;  4FK4 A;  3CQ8 A;  3BG0 A;  4X5M A;  2I3T A;  1TYQ C;  3IJ1 A;  3L1N A;  2B4E A;  3EI2 B;  1U2V C;  1FWX A;  3UIQ A;  2OIZ A;  4GGC A;  1ERJ A;  3EI3 A;  3TL8 B;  2JHC A;  1WAF A;  2E31 A;  2Z2O A;  3IKO A;  4QT8 A;  5EM2 B;  4AI6 A;  4ADO A;  3RFH A;  3IJC A;  1GG2 B;  1JMZ B;  3DWL C;  4FK0 A;  4A0B B;  1MHZ G;  3CFP A;  3SBR A;  4FJM A;  3L4M D;  5FKT A;  2J55 H;  5IGO A;  4K3I D;  1SQ9 A;  4PC0 A;  3HP9 A;  3NVX A;  3AH8 B;  2AH0 A;  2FW3 A;  2H6N A;  3SFZ A;  3ULE C;  4FAV D;  2B8I A;  5K19 A;  2CO0 C;  2P1O B;  1XU3 E;  1XIP A;  3C94 A;  3F3F A;  3DXM C;  5AMS A;  5IRE A;  1N6D A;  2OZM A;  2OK6 A;  4J2E A;  5IT9 g;  2AGZ A;  4KHW A;  3EMH A;  3I7H A;  1OLZ A;  4X5N A;  4AKG A;  5TDH B;  5GXI A;  4FWW A;  4GGA A;  3MKQ A;  4FJ9 A;  3OKY B;  5IC7 A;  1XVC E;  4DU3 A;  4FJ5 A;  4M3T A;  1Q47 A;  3FGB A;  2B7M A;  4EWR A;  3EWE A;  3HL8 A;  4QND A;  4QRJ A;  5CXB A;  3UVO A;  3IIW A;  4FHL A;  1XMF E;  1OMW B;  3I7L A;  2JH9 A;  3JRP A;  4TZ4 A;  5EMK B;  2GNQ A;  2H6K A;  5HYN B;  1FZ0 E;  4E4B A;  1XVE E;  2XL3 A;  1FZ1 E;  1LDK E;  3A0F A;  2PM6 B;  1CLQ A;  3SBP A;  3SCX A;  4O45 A;  1MG2 A;  4I9L A;  4A08 B;  3GFC A;  3W15 A;  4GQ1 A;  3F3P A;  4N14 A;  4I6J B;  4DTU A;  5EAL A;  2H14 A;  4M3U A;  3KRX B;  3VA6 A;  1IH7 A;  4J78 A;  2G99 A;  3LDB A;  4DTJ A;  2I0S A;  5IZ7 A;  3QES A;  4KHS A;  4ZOZ A;  3JRO A;  4CZY A;  3I2N A;  3JZH A;  5FKS A;  2HXC A;  4OZU A;  4H5I A;  5EML B;  1NR0 A;  3MZK A;  1PGU A;  4HDJ A;  2P1Q B;  4HCC A;  5HQG A;  2YBA A;  3SUN A;  2XYI A;  3SVI A;  4JRP A;  2H3X A;  2YMU A;  4PSX B;  3RMZ D;  2HD0 A;  2B5N A;  4LG8 A;  3UVK A;  3SVW D;  4FK2 A;  3MKS B;  3E0C A;  4R7A B;  1SHY B;  3OW8 A;  2XL2 A;  3TJY A;  5H1M A;  4FJ7 A;  4RNG A;  2P9S C;  3K27 A;  5FQD A;  4PBZ A;  1U4C A;  4CY2 A;  3AL9 A;  2YNP A;  4J2D A;  1FZ2 E;  5I5M A;  4G56 B;  1GP2 B;  4J84 A;  4ADN A;  2MTA H;  4O3T B;  4JD2 C;  4U1E I;  3N0D A;  1XU5 E;  4ERQ A;  2P9N C;  1IG9 A;  3J80 g;  2OK4 A;  4HCB A;  2P9U C;  3OL2 B;  3UVN A;  3CFV A;  3NGI A;  4JT6 C;  4L1Q D;  2YB5 A;  1PI6 A;  4ZN4 A;  4JT5 C;  4NSX A;  2ATQ A;  4DTP A;  3C6N B;  4GGD A;  2JHA A;  4DTR A;  3TAE A;  3BWS A;  4A09 B;  1FZ9 E;  4JXM A;  2P9L C;  5H37 A;  5GMK n;  2H4T A;  3EI3 B;  1N6F A;  3RSE C;  2P5O A;  5KDO B;  3I8E A;  4JSN C;  2P9K C;  4DU1 A;  3PE7 A;  4ES0 A;  3PXT D;  3QEW A;  1FZ4 E;  2AH1 A;  2Z2P A;  3IJ0 A;  3MZL A;  3SCY A;  4E5Z A;  2HJ4 A;  5C9Z B;  2H9P A;  5IBK B;  1B9X A;  3RFG A;  4FA9 D;  5JWZ A;  3WSO A;  2XU7 A;  3PVW B;  4A0A A;  2BCJ B;  2IUR A;  2I0R A;  5H17 A;  4CC9 A;  4M3Y A;  1GXR A;  2PM9 A;  5I5I A;  3ZWL B;  3RWU A;  3E4W A;  5AFU 3;  3SLE D;  2OZS A;  5CYK B;  1FZI E;  4DTS A;  5THA A;  4DU4 A;  4A2M A;  2VIX A;  2B1E A;  1B9Y A;  3HGK E;  2TRC B;  4ZOX A;  4GZ8 A;  2AQ5 A;  2EBS A;  5FKQ A;  4FA4 D;  3KRW B;  3PSL A;  1FS1 A;  2H47 A;  3UKU C;  2OJY A;  4J2A A;  3LDS A;  3LZI A;  4KI6 A;  4J86 A;  4KHN A;  3DSM A;  4GAM C;  3J27 A;  3RLM D;  3RMD A;  4FJX A;  4DTX A;  4LG9 A;  1FYZ E;  2H68 A;  3CIK B;  3PVU B;  1MG3 A;  2P1N B;  2Q7Q A;  5FLX g;  4XYI A;  3EG6 A;  5TEE A;  4J8B A;  3U4Y A;  3P4F A;  1FZ6 E;  1RI6 A;  3SJL D;  4U7A A;  3QEP A;  4CZX A;  3AL8 B;  3CFO A;  4DTM A;  2CE9 A;  1XMG E;  4JSX C;  4A0B A;  2E32 A;  2B5M A;  2IWK A;  4L3H D;  3C9C A;  4JRQ A;  4M3W A;  4X3E A;  3RMA A;  1R5M A;  3TAG A;  5GXH A;  3EI1 B;  3NHG A;  2RCU A;  5TF2 A;  3QEX A;  2P5G A;  2QC5 A;  4PSW B;  2AGL A;  2HJB A;  4CY5 A;  1VYH C;  4M42 A;  4D0K A;  3PXW D;  3ORV D;  3SWS D;  4CY1 A;  3SQ4 A;  4FJN A;  4Y7R A;  2PBI B;  4LGN A;  4O1Q D;  3J81 g;  4J82 A;  3SNN A;  3C99 A;  4BH6 A;  3HGL A;  3OKY A;  4J8G A;  1PEV A;  4GQB B;  4KHQ A;  3L4O D;  3EI4 A;  3OGK B;  3SUQ A;  1K32 A;  3NE6 A;  2HKR A;  3SBQ A;  4JSV C;  2OVQ B;  4ERY A;  4CY3 A;  5CXC B;  2BBK H;  5K1C C;  2IUV A;  3FRX A;  3SUO A;  3L8B A;  3PSC B;  4E54 B;  4M41 A;  3QEI A;  4PNK B;  2OVP B;  3MMY A;  2YB8 B;  1SQJ A;  4JS5 A;  4EYW A;  4X61 B;  4GM3 A;  2PFV A;  2DTU A;  3I89 A;  3I7O A;  3N1B A;  4FA1 D;  4ZOY A;  5IJ8 E;  4QQE A;  4O3U B;  3BG1 A;  2IAA A;  3TAF A;  4FJJ A;  3SI6 A;  2HYE A;  3UVL A;  2H6Q A;  2CN3 A;  3CFS B;  3DXK C;  2IWF A;  3SPY A;  1Q9X A;  2YNO A;  2H9L A;  3LD8 A;  4FJ8 A;  4CI8 A;  4AKH A;  4PXW A;  2VJ4 A;  2I0T A;  4M45 A;  3JPX A;  2J57 G;  4FAN D;  1MTY G;  5FXY A;  1WAJ A;  4RG8 A;  2OYQ A;  3OGM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...