2OVQB

Structure of the skp1-fbw7-cyclinedegc complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
444
structure length
444
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
total genus 126
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovqB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovqB02
2IWFA 4X60B 3FRXA 3V9FA 2CE8A 5EMKB 4MK0B 4GM3A 5I5MA 3GREA 4FB1D 4AOWA 4A09A 4J81A 3CFVA 2G99A 2I0RA 1GOTB 2P9PC 5EMMB 3MZLA 3C5MA 2MTAH 5FKQA 2P1MB 4JSNC 3GFCA 3E0CA 5H1MA 4A09B 4FAND 2IUQA 5HE1B 4ZOYA 2HKMA 2Z2OA 3DM0A 2B5NA 5EALA 3SFZA 3OGKB 3C6OB 1JMZB 3UVNA 2Q7QA 2PBIB 5GMKn 4GMBA 3I8EA 3UVMA 3KRXB 4X63B 2OVPB 3PXWD 2HKRA 3SMRA 5AFU3 1SQJA 5TDHB 1PGUA 1OMWB 2P1NB 2H68A 2P9IC 4ZOZA 3VH0A 3ODTA 3CFSB 3I7HA 3KRWB 3ORVD 1MG2A 5IJ7E 2IWKA 4FA5D 2YB8B 1A0RB 3EU7A 1LDKE 1SHYB 3SBQA 4GGAA 4FWWA 3CIKB 3IKOA 3EI1B 3RSEC 4GM9A 5EAPA 3EMHA 2CN2A 1XHMA 2H6NA 5K1CC 3I8CA 4YVDA 1JMXB 3NVNA 4CI3A 4JT6C 3OW8A 4JSVC 2P1OB 3NVQA 1PBYB 4BUJC 3C99A 1TYQC 3L2OB 4A2MA 3K27A 3I7NA 3ZWLB 4O45A 1VYHC 3I89A 3PXTD 1S4UX 3EI4B 1QNIA 5IGQA 4J0XA 3U4YA 1ERJA 5CYKA 2B5MA 4J84A 5H17A 4ZOXA 2IURA 1XIPA 2IUVA 4FA1D 4QRJA 4A0BB 4A0BA 4J8GA 2P9UC 4J77A 3SCYA 5C2VB 4UI9R 5B4WA 2CO0C 3FGBA 3N0DA 3I7PA 5C9ZB 4GZ8A 3EI4A 3W15A 3RMZD 2QC5A 1K32A 2E31A 4J73A 3RN1D 3F3GA 1GXRA 3I7OA 4PNKB 4A7JA 5EMLB 4PXWA 5IC7A 3SBRA 5CXCA 4E5ZB 3AFCA 4J0WA 1MDAH 3EI3B 1U2VC 5FA5B 4FA9D 5IGOA 3OL2B 2AGXA 4U1EI 2H9PA 4J86A 2PM9A 1XKSA 3JZHA 3PSLA 3FM0A 2BCJB 1YFQA 3L4OD 5CXCB 4FHLA 4CI1A 3ULEC 3JZGA 1GP2B 4E5ZA 5HE0B 4L3GD 3HFQA 4ES0A 4GQ2P 4LGNA 3PE7A 2B4EA 4PC0A 4A08B 4OWRA 2EBSA 4ERQA 2P9LC 3N0EA 3C6PB 2Z2PA 3C9CA 3SBPA 3PVWB 5THAA 3IIWA 5IJ8E 4E54A 3F3FA 3I7LA 4J87A 3J81g 3JZNA 4CZVA 3EI1A 4D0KA 2W18A 3OL2A 1U4CA 2IUPA 2H47A 3RFHA 4GGDA 3UVLA 4A11A 2CNXA 2E32A 2AQ5A 2UZYB 4N14A 4ZOVA 5FKRA 5H14A 4A0AB 4GGCA 4L1QD 2XL2A 2O9KA 3IJ0A 3JB9L 2P9KC 4X3EA 4FAVD 1R5MA 4JSPC 5FLXg 2XU7A 2I0TA 4GQBB 3L4MD 5HYNB 2H6KA 5EMJB 3RFGA 2BBKH 2I3TA 3UKRC 1B9YA 2P1PB 4JSXC 2AGLA 5JWZA 1Q47A 3I7KA 2HXCA 2YNNA 2P1QB 3PSCB 5EARA 4KFMB 3RRMC 4J79A 4U7AA 2I3SA 2H6QA 5GXIA 2OK6A 3OTTA 1N6FA 4TZ4A 5GXHA 3DXMC 1OLZA 3UR4A 3IJCA 4NSXA 4IA9A 2G9AA 4H5IA 1RI6A 2CE9A 4CZXA 5KDOB 2PM6B 3P4FA 4K3ID 3MKSB 4LG8A 3SLED 5AJAA 4D6VA 4LG9A 4QQEA 1NR0A 4PSWB 4O3UB 4CZYA 2IAAA 5CXBB 3SN6B 4J78A 3IIYA 4ESGA 1PEVA 2B5LA 5TF2A 4AEZA 2GC7A 3DWLC 4G56B 4GM8A 2H9NA 2YNOA 4L9OA 5HE2B 3SWSD 2GC4A 3MZKA 1JOFA 3PXSD 4GQ1A 3SHFA 2OVQB 2J57G 2OVRB 1JJUB 3J80g 3V7DB 3JROA 4CI2A 3K26A 4PSXB 5FXYA 5HE3B 2AGYA 3C6NB 2H9MA 2CN3A 4Y5RD 2J55H 3DXKC 5C2WB 5AMSA 4ERZA 5CXBA 4ERYA 4I79A 4IMMA 3AL8B 4A0AA 2P9NC 1N6DA 2XL3A 5TEFA 4QT8A 4CY3A 4L3HD 4JT5C 1PI6A 4A08A 4OZUA 1FWXA 5FKSA 3BWSA 2YMUA 1N6EA 2H9LA 2PM9B 2PM7B 1FS1A 5I5JA 2P9SC 4O9DA 3I2NA 5K19A 4FA4D 3PVUB 3MKQA 1P22A 3JPXA 2AH1A 1TBGA 2YNPA 3MMYA 3JAMg 1GG2B 3EI2B 4A11B 2HJ4A 3VA6A 2HJBA 4R7AB 4PBYA 3VGZA 3MXXA 3UKUC 3WSOA 2H14A 2QXVA 2TRCB 4QL1A 4Z8LA 3DSMA 4E54B 2GNQA 4X61B 2CO0A 4HDJA 4XYHA 3B7FA 2HESX 5EM2B 4CY2A 3EWEA 1B9XA 4CY5A 4CY1A 5HQGA 2HYEA 3AH8B 4CI8A 4H5JA 4A2LA 3UVOA 3EI3A 5IBKB 2UZXB 5IT9g 3OKYB 3OKWA 2AGZA 4BL0A 1L0QA 5EM2A 3C75H 3JRPA 4BH6A 1MG3A 2OK4A 5GSAA 4CC9A 4EWRA 4JXMA 4Y7RA 3OGLB 4K3JB 4J8BA 1SQ9A 2H13A 2AH0A 5SXMA 5FQDA 1NEXB 3OGMB 3AL8A 5A2Qg 3EI2A 3AL9A 3A0FA 3IJ1A 3V5WB 3F3PA 5CYKB 3EG6A 4XEIC 3NVXA 3SJLD 2XYIA 3BG1A 2OJYA 2J56H 3BG0A 4I6JB 5I5IA 2I0SA 2Z2NA 4O1QD 1K8KC 2OIZA 2H3XA 3SXTD 4XYIA 3OKYA 3UVKA 3RLMD 2AGWA 4JD2C 4J82A 3OKTA 5TEEA 4O3TB 4PBZA 3SVWD 5EAMA 4ZN4A 2YBAA 5FKTA 3RN0D
chains in the Genus database with same CATH superfamily
2VJ5A 3QNOA 3C94A 3SCXA 3SJJA 2IWFA 4X60B 1I2MB 3FRXA 3V9FA 2PFVA 2CE8A 2BKLA 2XE4A 5EMKB 4MK0B 4GM3A 4KI6A 1XVDE 5I5MA 4FJ7A 3QESA 3GREA 3ZE1A 4FB1D 4AOWA 4MMZA 4A09A 3NGIA 4J81A 3CFVA 5M5SA 2G99A 3ZE0A 5E6UA 2I0RA 4KI4A 1GOTB 2VDOA 2P9PC 4G55A 2ATQA 3CQ8A 3IUNA 5EMMB 3MZLA 2OYQA 1L5GA 3C5MA 4RE5A 2MZWB 2MTAH 2B7MA 5FKQA 2VC2A 1FZ3E 2P1MB 2OZMA 4JSNC 3KD5E 3GFCA 4NAAA 2JHPA 3E0CA 5H1MA 2VDRA 4A09B 4FAND 2IUQA 4M3YA 5HE1B 4ZOYA 2RCUA 2HKMA 2Z2OA 4QAMA 4MMYA 3DM0A 2B5NA 5EALA 3SFZA 4QNCA 3OGKB 3C6OB 2MMBA 1JMZB 4EPHA 4WK2A 3UVNA 2Q7QA 1K3IA 2JH9A 2PBIB 5FFGA 5E6RA 5GMKn 4GMBA 1VE6A 4DTUA 3I8EA 3UVMA 3KRXB 4X63B 2OVPB 3PXWD 2HKRA 3SMRA 5AFU3 1CLQA 4FJJA 3CFRA 1SQJA 1E8MA 5TDHB 4EYWA 1VE7A 4FJLA 1PGUA 4NENA 1OMWB 2P1NB 4KHQA 2H68A 2P9IC 4ZOZA 1XMHE 4RG8A 3VH0A 1FYZE 3IUJA 4DTRA 3ODTA 3CFSB 1MMOG 3I7HA 3KRWB 3ORVD 1MG2A 5IJ7E 2IWKA 4FA5D 4M45A 2HU5A 2YB8B 4RL5A 1A0RB 3BVOA 3EU7A 1LDKE 1SHYB 1IH7A 4FJ9A 4FK2A 4GGAA 3SBQA 3MVDK 1VZ3A 1FZ9E 4AX4A 4DTPA 3FCUA 4FWWA 4G1EA 3CIKB 3IKOA 3EI1B 1XVBE 3RSEC 4GM9A 5EAPA 3ZDYA 3L0MA 3EMHA 1QFSA 2CN2A 4KHYA 1XHMA 2H6NA 4FJIA 5K1CC 4JRPA 3I8CA 4YVDA 1JMXB 3NVNA 3VI3A 1UOPA 4JHPC 3UO3A 4CI3A 4JT6C 3SPZA 4AKGA 3OW8A 4JSVC 2P1OB 3NVQA 1PBYB 4BUJC 3C99A 1FZ1E 2DY4A 1TYQC 3L2OB 4A2MA 3RMCA 4KHWA 3K27A 4MMXA 3K71A 3I7NA 3ZWLB 4O45A 1UOQA 1VYHC 3NCIA 3I89A 4O2WA 3PXTD 4BCDA 2VIXA 1S4UX 3EI4B 1QNIA 2P5OA 4Z7OA 5IGQA 3LDSA 4J0XA 5C86A 3U4YA 4RE6A 1ERJA 4DNUA 5CYKA 3RMDA 2B5MA 3QERA 4J84A 5H17A 4ZOXA 2IURA 1XIPA 2IUVA 4FA1D 4QRJA 4A0BB 4A0BA 2MW2A 4J8GA 2P9UC 4J77A 3SCYA 5C2VB 4UI9R 5B4WA 2CO0C 3FGBA 3N0DA 3CFOA 3I7PA 5C9ZB 4GZ8A 3EI4A 3W15A 3RMZD 2QC5A 3SQ0A 1K32A 2E31A 4J73A 5M5VA 3RN1D 3F3GA 1GXRA 3I7OA 5E6SA 3TAEA 2EIEA 3KCIA 1JV2A 3NIDA 4PNKB 4A7JA 3MUNA 1WAJA 3HGKE 5EMLB 4PXWA 2LF3A 5IC7A 3SBRA 5CXCA 4E5ZB 1UTCA 3LZJA 3AFCA 4KHNA 3ZDXA 2B8IA 3O4IA 1MDAH 4J0WA 3EI3B 3C95A 3FCSA 1U2VC 5FA5B 4FA9D 4BP9A 5IZ7A 4FJXA 5IGOA 4FJ8A 3OL2B 2AGXA 2H9PA 4U1EI 2FW3A 4J86A 2PM9A 1XKSA 3IUQA 3JZHA 1C9IA 3PSLA 3FM0A 2BCJB 1FXXA 2JPNA 1YFQA 3L4OD 4DTOA 5CXCB 4FHLA 4CI1A 3ULEC 3JZGA 2JKXA 2K5SA 1GP2B 3GC3B 2EIBA 3CFPA 5HE0B 4E5ZA 3S9HA 3SUQA 5FFOA 3ZDZA 3NHGA 4L3GD 1FZHE 3HFQA 1U8CA 4EP9A 5M5UA 4ES0A 3SNNA 2OZSA 3NIGA 4GQ2P 4WK4A 4LGNA 3PE7A 2B4EA 3EQ7A 4J2BA 4M3XA 1O6GA 4PC0A 4A08B 1FZ7E 1GOGA 2EBSA 4FVMA 4OWRA 4ERQA 2P9LC 3N0EA 2RKHA 3NDKA 3C6PB 1T2XA 3L1NA 2Z2PA 3RWUA 3C9CA 3SBPA 3PVWB 1JW2A 5THAA 3IIWA 5IJ8E 4J2AA 4E54A 2VZ1A 3F3FA 3I7LA 4J87A 3ZE2A 4AN1A 3J81g 3O4JA 3LD8A 4I9QA 3IURA 3JZNA 4CZVA 4DU3A 2P5GA 1XU5E 1H2XA 4AMZA 3EI1A 4D0KA 1MHZG 2W18A 3OL2A 4X5MA 4M3RA 1U4CA 2IUPA 2H47A 3TABA 2HU8A 4GGDA 3RFHA 3UVLA 1IG9A 4A11A 3K6SA 2CNXA 3LDBA 4JRQA 2E32A 2AQ5A 2UZYB 4N14A 4ZOVA 5FKRA 5H14A 4Z7NA 4GGCA 3T3MA 4A0AB 3HL8A 3LZIA 4L1QD 1FZ8E 2XL2A 2O9KA 3IJ0A 3EQ9A 3JB9L 2P9KC 4X3EA 2DEBA 3UO2A 4FAVD 1E8NA 4DTNA 1R5MA 4JSPC 5FLXg 2XU7A 2I0TA 4GQBB 3L4MD 5HYNB 2H6KA 5EMJB 3RFGA 2JH8A 1YR2A 2BBKH 2I3TA 2QZPA 4IRZA 3UKRC 1B9YA 2P1PB 4JSXC 2AGLA 5JWZA 1Q47A 1XVEE 3IUMA 3I7KA 2HXCA 4DU1A 4ICGC 2YNNA 2P1QB 3PSCB 3KD1E 3SI6A 1MTYG 5EARA 2EIDA 4KFMB 4DTMA 2JHAA 3RRMC 1C9LA 4J79A 4U7AA 3V4PA 5HDBA 3J27A 4X5NA 2HD0A 2H6QA 2I3SA 2OK6A 3OTTA 5GXIA 3NE6A 1N6FA 4TZ4A 5GXHA 3DXMC 4JS5A 1OLZA 3UR4A 1E5TA 3IJCA 4NSXA 4IA9A 4WK0A 4JHNA 2G9AA 4H5IA 4FJMA 1XU3E 1RI6A 2CE9A 4CZXA 5KDOB 2PM6B 4Z7QA 3P4FA 4K3ID 3MKSB 1Q9YA 4LG8A 3SLED 5AJAA 4FJNA 2VDNA 3UIQA 4D6VA 3IULA 2VDPA 3TAGA 4LG9A 4QQEA 4IT5A 3HGLA 4AKIA 1NR0A 3EQ8A 4PSWB 3SQ2A 4O3UB 3GD1I 4CZYA 2IAAA 5CXBB 3SN6B 4M41A 4J78A 3IIYA 4ESGA 1PEVA 3IVMA 2B5LA 5TF2A 4AEZA 1XMGE 2GC7A 3DWLC 1XMFE 4G56B 2LF6A 1FZIE 4GM8A 4FJGA 2H9NA 2YNOA 4L9OA 5HE2B 3SWSD 4L1MA 3SUPA 2GC4A 3MZKA 1JOFA 3PXSD 4GQ1A 3SHFA 2OVQB 2EICA 3TAFA 2J57G 2OVRB 1JJUB 3J80g 3V7DB 3JROA 1N1CA 4CI2A 3K26A 4PSXB 1MHYG 2H4TA 4HCBA 5FXYA 5HE3B 3QEPA 2AGYA 3C6NB 2B1EA 2H9MA 3NIFA 2JHCA 2CN3A 4Y5RD 2J55H 3DXKC 3QI0A 2XZGA 1FZ4E 5C2WB 5AMSA 4GAMC 5CXBA 4RNGA 4ERZA 1XVGE 3VI4A 2QR5A 4M42A 4ERYA 4I79A 4IMMA 1XVCE 3AL8B 4A0AA 2P9NC 1N6DA 2XL3A 5TEFA 3O4HA 4QT8A 4CY3A 4L3HD 4JT5C 1PI6A 4A08A 3QHYB 1H2WA 4OZUA 1FWXA 1WAFA 4DTSA 5FKSA 3BWSA 3N1BA 1GOFA 1N6EA 2H9LA 2YMUA 3DDUA 1JTDB 2PM9B 1H2YA 2PM7B 1FS1A 5M5RA 4D9SA 3OF7A 5I5JA 4M3ZA 2P9SC 4O9DA 3I2NA 3V4VA 5K19A 4FA4D 2HU7A 3MKQA 3PVUB 1P22A 1H2ZA 2VDMA 3JPXA 2AH1A 1TBGA 2JQTA 3TL8B 4DU4A 3E4YA 2YNPA 3MMYA 3JAMg 1GG2B 3EI2B 4A11B 2HJ4A 3VA6A 4DTXA 2HJBA 4R7AB 2VZ3A 4PBYA 3VGZA 4AKHA 1FZ2E 5H37A 3QNNA 1Q9XA 3MXXA 3RMBA 3UKUC 1FPOA 3WSOA 2H14A 2QXVA 2TRCB 3IJEA 4QL1A 3QEVA 4Z8LA 3DSMA 4E54B 2GNQA 4J2DA 4BCCA 3QEXA 4X61B 2CO0A 2VDQA 4ADNA 4FK4A 1A12A 4HDJA 3E4WA 2FYOA 3B7FA 4XYHA 2HESX 5EM2B 4CY2A 1XL3C 3EWEA 4UM8A 4NBMA 4ADOA 1B9XA 4CY5A 4CY1A 5HQGA 2HYEA 3AH8B 4G1MA 4O02A 4CI8A 4E4BA 4FK0A 4H5JA 4A2LA 1FZ0E 3UVOA 3EI3A 5IBKB 2UZXB 5IT9g 3OKYB 3K72A 1BPOA 3OKWA 2AGZA 4B08A 4M3WA 4BL0A 1L0QA 4WJKA 1O6FA 5EM2A 3C75H 4BP8A 1GOHA 4BCBA 2DTUA 3JRPA 2WQ8A 1MG3A 4BH6A 2OK4A 3QEWA 4JS4A 3RMAA 5GSAA 4CC9A 4EWRA 4JXMA 3NAEA 4Y7RA 3OGLB 4K3JB 4HCCA 4KHUA 4J8BA 4DNVA 1SQ9A 3SUNA 4UM9A 4AN0A 2H13A 2AH0A 4QNDA 3QETA 5SXMA 3QEIA 5FQDA 1NEXB 4KHSA 3OGMB 3AL8A 5A2Qg 4AI6A 2PFTA 3EI2A 3AL9A 3A0FA 3IJ1A 3K2OA 3V5WB 4E3SA 3J2PA 3SUOA 3F3PA 4FJ5A 5CYKB 3EG6A 2XDWA 4XEIC 3NVXA 3SJLD 2XYIA 3BG1A 2OJYA 2VJ4A 3SQ4A 1M1XA 2J56H 2VDKA 3O4GA 4FJHA 4J2EA 3T3PA 3BG0A 3N1EA 3SQ1A 3L8BA 4I6JB 4M3TA 5I5IA 2I0SA 3TJYA 1FZ6E 2Z2NA 4M3UA 4O1QD 3SPYA 4DTJA 1K8KC 2VDLA 2YB5A 4NC4A 3SVIA 5C92A 2OIZA 2H3XA 3SXTD 4I9LA 1TYEA 4XYIA 3OKYA 2QXFA 3UVKA 3RLMD 2AGWA 4JD2C 4J82A 1QFMA 3MUOA 3OKTA 5TEEA 5M61A 4FJKA 4O3TB 4PBZA 5M5TA 1FZ5E 4DNWA 1XVFE 3HP9A 1VZ2A 3SVWD 5EAMA 4ZN4A 1UOOA 4AMYA 5IREA 2YBAA 5FKTA 3RN0D
chains in the Genus database with same CATH topology
2VJ5A 3QNOA 3C94A 3SCXA 3SJJA 2IWFA 4X60B 3FRXA 3V9FA 2PFVA 2CE8A 5EMKB 4MK0B 4GM3A 4KI6A 1XVDE 5I5MA 4FJ7A 3QESA 3GREA 4FB1D 4AOWA 4A09A 3NGIA 4J81A 3CFVA 2G99A 2I0RA 4KI4A 1GOTB 2P9PC 2ATQA 3CQ8A 5EMMB 3MZLA 2OYQA 3C5MA 2MZWB 2MTAH 2B7MA 5FKQA 1FZ3E 2P1MB 2OZMA 4JSNC 3KD5E 3GFCA 2JHPA 3E0CA 5H1MA 4A09B 4FAND 2IUQA 4M3YA 5HE1B 4ZOYA 2RCUA 2HKMA 2Z2OA 3DM0A 2B5NA 5EALA 3SFZA 4QNCA 3OGKB 3C6OB 2MMBA 1JMZB 4EPHA 3UVNA 2Q7QA 2JH9A 2PBIB 5GMKn 4GMBA 4DTUA 3I8EA 3UVMA 3KRXB 4X63B 2OVPB 3PXWD 2HKRA 3SMRA 5AFU3 1CLQA 4FJJA 3CFRA 1SQJA 5TDHB 4EYWA 4FJLA 1PGUA 1OMWB 2P1NB 4KHQA 2H68A 2P9IC 4ZOZA 1XMHE 4RG8A 3VH0A 1FYZE 4DTRA 3ODTA 3CFSB 1MMOG 3I7HA 3KRWB 3ORVD 1MG2A 5IJ7E 2IWKA 4FA5D 4M45A 2YB8B 4RL5A 1A0RB 3EU7A 1LDKE 1IH7A 4FJ9A 4FK2A 1SHYB 4GGAA 3SBQA 1FZ9E 4DTPA 4FWWA 3CIKB 3IKOA 3EI1B 1XVBE 3RSEC 4GM9A 5EAPA 3L0MA 3EMHA 2CN2A 4KHYA 1XHMA 2H6NA 4FJIA 5K1CC 4JRPA 3I8CA 4YVDA 1JMXB 3NVNA 4CI3A 4JT6C 3SPZA 4AKGA 3OW8A 4JSVC 2P1OB 3NVQA 1PBYB 4BUJC 3C99A 1FZ1E 2DY4A 1TYQC 3L2OB 4A2MA 3RMCA 4KHWA 3K27A 3I7NA 3ZWLB 4O45A 1VYHC 3NCIA 3I89A 3PXTD 2VIXA 1S4UX 3EI4B 1QNIA 2P5OA 5IGQA 3LDSA 4J0XA 3U4YA 1ERJA 5CYKA 3RMDA 2B5MA 3QERA 4J84A 5H17A 4ZOXA 2IURA 1XIPA 2IUVA 4FA1D 4QRJA 4A0BB 4A0BA 4J8GA 2P9UC 4J77A 3SCYA 5C2VB 4UI9R 5B4WA 2CO0C 3FGBA 3N0DA 3CFOA 3I7PA 5C9ZB 4GZ8A 3EI4A 3W15A 3RMZD 2QC5A 3SQ0A 1K32A 2E31A 4J73A 3RN1D 3F3GA 1GXRA 3I7OA 3TAEA 4PNKB 4A7JA 1WAJA 3HGKE 5EMLB 4PXWA 2LF3A 5IC7A 3SBRA 5CXCA 4E5ZB 3LZJA 3AFCA 4KHNA 2B8IA 4J0WA 1MDAH 3EI3B 3C95A 1U2VC 5FA5B 4FA9D 5IZ7A 4FJXA 5IGOA 4FJ8A 3OL2B 2AGXA 2H9PA 4U1EI 2FW3A 4J86A 2PM9A 1XKSA 3JZHA 3PSLA 3FM0A 2BCJB 1FXXA 2JPNA 1YFQA 3L4OD 4DTOA 5CXCB 4FHLA 4CI1A 3ULEC 3JZGA 1GP2B 4E5ZA 3CFPA 5HE0B 3S9HA 3SUQA 3NHGA 4L3GD 1FZHE 3HFQA 4EP9A 4ES0A 3SNNA 2OZSA 4GQ2P 4LGNA 3PE7A 2B4EA 4J2BA 4M3XA 4PC0A 4A08B 1FZ7E 2EBSA 4FVMA 4OWRA 4ERQA 2P9LC 3N0EA 3NDKA 3C6PB 2Z2PA 3L1NA 3RWUA 3C9CA 3SBPA 3PVWB 5THAA 3IIWA 5IJ8E 4J2AA 4E54A 3F3FA 3I7LA 4J87A 3J81g 3LD8A 4I9QA 3JZNA 4CZVA 4DU3A 2P5GA 1XU5E 3EI1A 4D0KA 1MHZG 2W18A 3OL2A 4X5MA 4M3RA 1U4CA 2IUPA 2H47A 3TABA 3RFHA 4GGDA 3UVLA 1IG9A 4A11A 2CNXA 3LDBA 4JRQA 2E32A 2AQ5A 2UZYB 4N14A 4ZOVA 5FKRA 5H14A 4A0AB 4GGCA 3HL8A 3LZIA 4L1QD 1FZ8E 2XL2A 2O9KA 3IJ0A 3JB9L 2P9KC 4X3EA 2DEBA 4FAVD 4DTNA 1R5MA 4JSPC 5FLXg 2XU7A 2I0TA 4GQBB 3L4MD 5HYNB 2H6KA 5EMJB 3RFGA 2JH8A 2BBKH 2I3TA 3UKRC 1B9YA 2P1PB 4JSXC 2AGLA 5JWZA 1Q47A 1XVEE 3I7KA 2HXCA 4DU1A 2YNNA 2P1QB 3PSCB 3KD1E 3SI6A 1MTYG 5EARA 4KFMB 4DTMA 2JHAA 3RRMC 4J79A 4U7AA 3J27A 4X5NA 2HD0A 2H6QA 2I3SA 2OK6A 3OTTA 5GXIA 3NE6A 1N6FA 4TZ4A 5GXHA 3DXMC 4JS5A 1OLZA 3UR4A 3IJCA 4NSXA 4IA9A 2G9AA 4H5IA 4FJMA 1XU3E 1RI6A 2CE9A 4CZXA 5KDOB 2PM6B 3P4FA 4K3ID 3MKSB 1Q9YA 4LG8A 3SLED 5AJAA 4FJNA 3UIQA 4D6VA 3TAGA 4LG9A 4QQEA 3HGLA 4AKIA 1NR0A 4PSWB 3SQ2A 4O3UB 4CZYA 2IAAA 5CXBB 3SN6B 4M41A 4J78A 3IIYA 4ESGA 1PEVA 2B5LA 5TF2A 4AEZA 1XMGE 2GC7A 3DWLC 1XMFE 4G56B 2LF6A 1FZIE 4GM8A 4FJGA 2H9NA 2YNOA 4L9OA 5HE2B 3SWSD 3SUPA 2GC4A 3MZKA 1JOFA 3PXSD 4GQ1A 3SHFA 2OVQB 3TAFA 2J57G 2OVRB 1JJUB 3J80g 3V7DB 3JROA 4CI2A 3K26A 4PSXB 1MHYG 2H4TA 4HCBA 5FXYA 5HE3B 3QEPA 2AGYA 3C6NB 2B1EA 2H9MA 2JHCA 2CN3A 4Y5RD 2J55H 3DXKC 1FZ4E 5C2WB 5AMSA 4GAMC 5CXBA 4RNGA 4ERZA 1XVGE 4M42A 4ERYA 4I79A 4IMMA 1XVCE 3AL8B 4A0AA 2P9NC 1N6DA 2XL3A 5TEFA 4QT8A 4CY3A 4L3HD 4JT5C 1PI6A 4A08A 4OZUA 1FWXA 1WAFA 4DTSA 5FKSA 3BWSA 3N1BA 2YMUA 1N6EA 2H9LA 2PM9B 2PM7B 1FS1A 5I5JA 4M3ZA 2P9SC 4O9DA 3I2NA 5K19A 4FA4D 3MKQA 3PVUB 1P22A 3JPXA 2AH1A 1TBGA 3TL8B 4DU4A 3E4YA 2YNPA 3MMYA 3JAMg 1GG2B 3EI2B 4A11B 2HJ4A 3VA6A 4DTXA 2HJBA 4R7AB 4PBYA 3VGZA 4AKHA 1FZ2E 5H37A 3QNNA 1Q9XA 3MXXA 3RMBA 3UKUC 3WSOA 2H14A 2QXVA 2TRCB 4QL1A 3QEVA 4Z8LA 3DSMA 4E54B 2GNQA 4J2DA 3QEXA 4X61B 2CO0A 4ADNA 4FK4A 4HDJA 3E4WA 2FYOA 3B7FA 4XYHA 2HESX 5EM2B 4CY2A 1XL3C 3EWEA 4ADOA 1B9XA 4CY5A 4CY1A 5HQGA 2HYEA 3AH8B 4CI8A 4E4BA 4FK0A 4H5JA 4A2LA 1FZ0E 3UVOA 3EI3A 5IBKB 2UZXB 5IT9g 3OKYB 3OKWA 2AGZA 4B08A 4M3WA 4BL0A 1L0QA 5EM2A 3C75H 2DTUA 3JRPA 4BH6A 1MG3A 2OK4A 3QEWA 4JS4A 3RMAA 5GSAA 4CC9A 4EWRA 4JXMA 3NAEA 4Y7RA 3OGLB 4K3JB 4HCCA 4KHUA 4J8BA 1SQ9A 3SUNA 2H13A 2AH0A 4QNDA 3QETA 5SXMA 3QEIA 5FQDA 1NEXB 4KHSA 3OGMB 3AL8A 5A2Qg 4AI6A 2PFTA 3EI2A 3AL9A 3A0FA 3IJ1A 3K2OA 3V5WB 4E3SA 3J2PA 3SUOA 3F3PA 4FJ5A 5CYKB 3EG6A 4XEIC 3NVXA 3SJLD 2XYIA 3BG1A 2OJYA 2VJ4A 3SQ4A 2J56H 4FJHA 4J2EA 3BG0A 3N1EA 3SQ1A 3L8BA 4I6JB 4M3TA 5I5IA 2I0SA 3TJYA 1FZ6E 2Z2NA 4M3UA 4O1QD 3SPYA 4DTJA 1K8KC 2YB5A 3SVIA 2OIZA 2H3XA 3SXTD 4I9LA 4XYIA 3OKYA 2QXFA 3UVKA 3RLMD 2AGWA 4JD2C 4J82A 3OKTA 5TEEA 4FJKA 4O3TB 4PBZA 1FZ5E 1XVFE 3HP9A 3SVWD 5EAMA 4ZN4A 5IREA 2YBAA 5FKTA 3RN0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWF A;  4X60 B;  3FRX A;  3V9F A;  2CE8 A;  5EMK B;  4MK0 B;  4GM3 A;  5I5M A;  3GRE A;  4FB1 D;  4AOW A;  4A09 A;  4J81 A;  3CFV A;  2G99 A;  2I0R A;  1GOT B;  2P9P C;  5EMM B;  3MZL A;  3C5M A;  2MTA H;  5FKQ A;  2P1M B;  4JSN C;  3GFC A;  3E0C A;  5H1M A;  4A09 B;  4FAN D;  2IUQ A;  5HE1 B;  4ZOY A;  2HKM A;  2Z2O A;  3DM0 A;  2B5N A;  5EAL A;  3SFZ A;  3OGK B;  3C6O B;  1JMZ B;  3UVN A;  2Q7Q A;  2PBI B;  5GMK n;  4GMB A;  3I8E A;  3UVM A;  3KRX B;  4X63 B;  2OVP B;  3PXW D;  2HKR A;  3SMR A;  5AFU 3;  1SQJ A;  5TDH B;  1PGU A;  1OMW B;  2P1N B;  2H68 A;  2P9I C;  4ZOZ A;  3VH0 A;  3ODT A;  3CFS B;  3I7H A;  3KRW B;  3ORV D;  1MG2 A;  5IJ7 E;  2IWK A;  4FA5 D;  2YB8 B;  1A0R B;  3EU7 A;  1LDK E;  1SHY B;  3SBQ A;  4GGA A;  4FWW A;  3CIK B;  3IKO A;  3EI1 B;  3RSE C;  4GM9 A;  5EAP A;  3EMH A;  2CN2 A;  1XHM A;  2H6N A;  5K1C C;  3I8C A;  4YVD A;  1JMX B;  3NVN A;  4CI3 A;  4JT6 C;  3OW8 A;  4JSV C;  2P1O B;  3NVQ A;  1PBY B;  4BUJ C;  3C99 A;  1TYQ C;  3L2O B;  4A2M A;  3K27 A;  3I7N A;  3ZWL B;  4O45 A;  1VYH C;  3I89 A;  3PXT D;  1S4U X;  3EI4 B;  1QNI A;  5IGQ A;  4J0X A;  3U4Y A;  1ERJ A;  5CYK A;  2B5M A;  4J84 A;  5H17 A;  4ZOX A;  2IUR A;  1XIP A;  2IUV A;  4FA1 D;  4QRJ A;  4A0B B;  4A0B A;  4J8G A;  2P9U C;  4J77 A;  3SCY A;  5C2V B;  4UI9 R;  5B4W A;  2CO0 C;  3FGB A;  3N0D A;  3I7P A;  5C9Z B;  4GZ8 A;  3EI4 A;  3W15 A;  3RMZ D;  2QC5 A;  1K32 A;  2E31 A;  4J73 A;  3RN1 D;  3F3G A;  1GXR A;  3I7O A;  4PNK B;  4A7J A;  5EML B;  4PXW A;  5IC7 A;  3SBR A;  5CXC A;  4E5Z B;  3AFC A;  4J0W A;  1MDA H;  3EI3 B;  1U2V C;  5FA5 B;  4FA9 D;  5IGO A;  3OL2 B;  2AGX A;  4U1E I;  2H9P A;  4J86 A;  2PM9 A;  1XKS A;  3JZH A;  3PSL A;  3FM0 A;  2BCJ B;  1YFQ A;  3L4O D;  5CXC B;  4FHL A;  4CI1 A;  3ULE C;  3JZG A;  1GP2 B;  4E5Z A;  5HE0 B;  4L3G D;  3HFQ A;  4ES0 A;  4GQ2 P;  4LGN A;  3PE7 A;  2B4E A;  4PC0 A;  4A08 B;  4OWR A;  2EBS A;  4ERQ A;  2P9L C;  3N0E A;  3C6P B;  2Z2P A;  3C9C A;  3SBP A;  3PVW B;  5THA A;  3IIW A;  5IJ8 E;  4E54 A;  3F3F A;  3I7L A;  4J87 A;  3J81 g;  3JZN A;  4CZV A;  3EI1 A;  4D0K A;  2W18 A;  3OL2 A;  1U4C A;  2IUP A;  2H47 A;  3RFH A;  4GGD A;  3UVL A;  4A11 A;  2CNX A;  2E32 A;  2AQ5 A;  2UZY B;  4N14 A;  4ZOV A;  5FKR A;  5H14 A;  4A0A B;  4GGC A;  4L1Q D;  2XL2 A;  2O9K A;  3IJ0 A;  3JB9 L;  2P9K C;  4X3E A;  4FAV D;  1R5M A;  4JSP C;  5FLX g;  2XU7 A;  2I0T A;  4GQB B;  3L4M D;  5HYN B;  2H6K A;  5EMJ B;  3RFG A;  2BBK H;  2I3T A;  3UKR C;  1B9Y A;  2P1P B;  4JSX C;  2AGL A;  5JWZ A;  1Q47 A;  3I7K A;  2HXC A;  2YNN A;  2P1Q B;  3PSC B;  5EAR A;  4KFM B;  3RRM C;  4J79 A;  4U7A A;  2I3S A;  2H6Q A;  5GXI A;  2OK6 A;  3OTT A;  1N6F A;  4TZ4 A;  5GXH A;  3DXM C;  1OLZ A;  3UR4 A;  3IJC A;  4NSX A;  4IA9 A;  2G9A A;  4H5I A;  1RI6 A;  2CE9 A;  4CZX A;  5KDO B;  2PM6 B;  3P4F A;  4K3I D;  3MKS B;  4LG8 A;  3SLE D;  5AJA A;  4D6V A;  4LG9 A;  4QQE A;  1NR0 A;  4PSW B;  4O3U B;  4CZY A;  2IAA A;  5CXB B;  3SN6 B;  4J78 A;  3IIY A;  4ESG A;  1PEV A;  2B5L A;  5TF2 A;  4AEZ A;  2GC7 A;  3DWL C;  4G56 B;  4GM8 A;  2H9N A;  2YNO A;  4L9O A;  5HE2 B;  3SWS D;  2GC4 A;  3MZK A;  1JOF A;  3PXS D;  4GQ1 A;  3SHF A;  2OVQ B;  2J57 G;  2OVR B;  1JJU B;  3J80 g;  3V7D B;  3JRO A;  4CI2 A;  3K26 A;  4PSX B;  5FXY A;  5HE3 B;  2AGY A;  3C6N B;  2H9M A;  2CN3 A;  4Y5R D;  2J55 H;  3DXK C;  5C2W B;  5AMS A;  4ERZ A;  5CXB A;  4ERY A;  4I79 A;  4IMM A;  3AL8 B;  4A0A A;  2P9N C;  1N6D A;  2XL3 A;  5TEF A;  4QT8 A;  4CY3 A;  4L3H D;  4JT5 C;  1PI6 A;  4A08 A;  4OZU A;  1FWX A;  5FKS A;  3BWS A;  2YMU A;  1N6E A;  2H9L A;  2PM9 B;  2PM7 B;  1FS1 A;  5I5J A;  2P9S C;  4O9D A;  3I2N A;  5K19 A;  4FA4 D;  3PVU B;  3MKQ A;  1P22 A;  3JPX A;  2AH1 A;  1TBG A;  2YNP A;  3MMY A;  3JAM g;  1GG2 B;  3EI2 B;  4A11 B;  2HJ4 A;  3VA6 A;  2HJB A;  4R7A B;  4PBY A;  3VGZ A;  3MXX A;  3UKU C;  3WSO A;  2H14 A;  2QXV A;  2TRC B;  4QL1 A;  4Z8L A;  3DSM A;  4E54 B;  2GNQ A;  4X61 B;  2CO0 A;  4HDJ A;  4XYH A;  3B7F A;  2HES X;  5EM2 B;  4CY2 A;  3EWE A;  1B9X A;  4CY5 A;  4CY1 A;  5HQG A;  2HYE A;  3AH8 B;  4CI8 A;  4H5J A;  4A2L A;  3UVO A;  3EI3 A;  5IBK B;  2UZX B;  5IT9 g;  3OKY B;  3OKW A;  2AGZ A;  4BL0 A;  1L0Q A;  5EM2 A;  3C75 H;  3JRP A;  4BH6 A;  1MG3 A;  2OK4 A;  5GSA A;  4CC9 A;  4EWR A;  4JXM A;  4Y7R A;  3OGL B;  4K3J B;  4J8B A;  1SQ9 A;  2H13 A;  2AH0 A;  5SXM A;  5FQD A;  1NEX B;  3OGM B;  3AL8 A;  5A2Q g;  3EI2 A;  3AL9 A;  3A0F A;  3IJ1 A;  3V5W B;  3F3P A;  5CYK B;  3EG6 A;  4XEI C;  3NVX A;  3SJL D;  2XYI A;  3BG1 A;  2OJY A;  2J56 H;  3BG0 A;  4I6J B;  5I5I A;  2I0S A;  2Z2N A;  4O1Q D;  1K8K C;  2OIZ A;  2H3X A;  3SXT D;  4XYI A;  3OKY A;  3UVK A;  3RLM D;  2AGW A;  4JD2 C;  4J82 A;  3OKT A;  5TEE A;  4O3T B;  4PBZ A;  3SVW D;  5EAM A;  4ZN4 A;  2YBA A;  5FKT A;  3RN0 D; 
#chains in the Genus database with same CATH topology
 2VJ5 A;  3QNO A;  3C94 A;  3SCX A;  3SJJ A;  2IWF A;  4X60 B;  1I2M B;  3FRX A;  3V9F A;  2PFV A;  2CE8 A;  2BKL A;  2XE4 A;  5EMK B;  4MK0 B;  4GM3 A;  4KI6 A;  1XVD E;  5I5M A;  4FJ7 A;  3QES A;  3GRE A;  3ZE1 A;  4FB1 D;  4AOW A;  4MMZ A;  4A09 A;  3NGI A;  4J81 A;  3CFV A;  5M5S A;  2G99 A;  3ZE0 A;  5E6U A;  2I0R A;  4KI4 A;  1GOT B;  2VDO A;  2P9P C;  4G55 A;  2ATQ A;  3CQ8 A;  3IUN A;  5EMM B;  3MZL A;  2OYQ A;  1L5G A;  3C5M A;  4RE5 A;  2MZW B;  2MTA H;  2B7M A;  5FKQ A;  2VC2 A;  1FZ3 E;  2P1M B;  2OZM A;  4JSN C;  3KD5 E;  3GFC A;  4NAA A;  2JHP A;  3E0C A;  5H1M A;  2VDR A;  4A09 B;  4FAN D;  2IUQ A;  4M3Y A;  5HE1 B;  4ZOY A;  2RCU A;  2HKM A;  2Z2O A;  4QAM A;  4MMY A;  3DM0 A;  2B5N A;  5EAL A;  3SFZ A;  4QNC A;  3OGK B;  3C6O B;  2MMB A;  1JMZ B;  4EPH A;  4WK2 A;  3UVN A;  2Q7Q A;  1K3I A;  2JH9 A;  2PBI B;  5FFG A;  5E6R A;  5GMK n;  4GMB A;  1VE6 A;  4DTU A;  3I8E A;  3UVM A;  3KRX B;  4X63 B;  2OVP B;  3PXW D;  2HKR A;  3SMR A;  5AFU 3;  1CLQ A;  4FJJ A;  3CFR A;  1SQJ A;  1E8M A;  5TDH B;  4EYW A;  1VE7 A;  4FJL A;  1PGU A;  4NEN A;  1OMW B;  2P1N B;  4KHQ A;  2H68 A;  2P9I C;  4ZOZ A;  1XMH E;  4RG8 A;  3VH0 A;  1FYZ E;  3IUJ A;  4DTR A;  3ODT A;  3CFS B;  1MMO G;  3I7H A;  3KRW B;  3ORV D;  1MG2 A;  5IJ7 E;  2IWK A;  4FA5 D;  4M45 A;  2HU5 A;  2YB8 B;  4RL5 A;  1A0R B;  3BVO A;  3EU7 A;  1LDK E;  1SHY B;  1IH7 A;  4FJ9 A;  4FK2 A;  4GGA A;  3SBQ A;  3MVD K;  1VZ3 A;  1FZ9 E;  4AX4 A;  4DTP A;  3FCU A;  4FWW A;  4G1E A;  3CIK B;  3IKO A;  3EI1 B;  1XVB E;  3RSE C;  4GM9 A;  5EAP A;  3ZDY A;  3L0M A;  3EMH A;  1QFS A;  2CN2 A;  4KHY A;  1XHM A;  2H6N A;  4FJI A;  5K1C C;  4JRP A;  3I8C A;  4YVD A;  1JMX B;  3NVN A;  3VI3 A;  1UOP A;  4JHP C;  3UO3 A;  4CI3 A;  4JT6 C;  3SPZ A;  4AKG A;  3OW8 A;  4JSV C;  2P1O B;  3NVQ A;  1PBY B;  4BUJ C;  3C99 A;  1FZ1 E;  2DY4 A;  1TYQ C;  3L2O B;  4A2M A;  3RMC A;  4KHW A;  3K27 A;  4MMX A;  3K71 A;  3I7N A;  3ZWL B;  4O45 A;  1UOQ A;  1VYH C;  3NCI A;  3I89 A;  4O2W A;  3PXT D;  4BCD A;  2VIX A;  1S4U X;  3EI4 B;  1QNI A;  2P5O A;  4Z7O A;  5IGQ A;  3LDS A;  4J0X A;  5C86 A;  3U4Y A;  4RE6 A;  1ERJ A;  4DNU A;  5CYK A;  3RMD A;  2B5M A;  3QER A;  4J84 A;  5H17 A;  4ZOX A;  2IUR A;  1XIP A;  2IUV A;  4FA1 D;  4QRJ A;  4A0B B;  4A0B A;  2MW2 A;  4J8G A;  2P9U C;  4J77 A;  3SCY A;  5C2V B;  4UI9 R;  5B4W A;  2CO0 C;  3FGB A;  3N0D A;  3CFO A;  3I7P A;  5C9Z B;  4GZ8 A;  3EI4 A;  3W15 A;  3RMZ D;  2QC5 A;  3SQ0 A;  1K32 A;  2E31 A;  4J73 A;  5M5V A;  3RN1 D;  3F3G A;  1GXR A;  3I7O A;  5E6S A;  3TAE A;  2EIE A;  3KCI A;  1JV2 A;  3NID A;  4PNK B;  4A7J A;  3MUN A;  1WAJ A;  3HGK E;  5EML B;  4PXW A;  2LF3 A;  5IC7 A;  3SBR A;  5CXC A;  4E5Z B;  1UTC A;  3LZJ A;  3AFC A;  4KHN A;  3ZDX A;  2B8I A;  3O4I A;  1MDA H;  4J0W A;  3EI3 B;  3C95 A;  3FCS A;  1U2V C;  5FA5 B;  4FA9 D;  4BP9 A;  5IZ7 A;  4FJX A;  5IGO A;  4FJ8 A;  3OL2 B;  2AGX A;  2H9P A;  4U1E I;  2FW3 A;  4J86 A;  2PM9 A;  1XKS A;  3IUQ A;  3JZH A;  1C9I A;  3PSL A;  3FM0 A;  2BCJ B;  1FXX A;  2JPN A;  1YFQ A;  3L4O D;  4DTO A;  5CXC B;  4FHL A;  4CI1 A;  3ULE C;  3JZG A;  2JKX A;  2K5S A;  1GP2 B;  3GC3 B;  2EIB A;  3CFP A;  5HE0 B;  4E5Z A;  3S9H A;  3SUQ A;  5FFO A;  3ZDZ A;  3NHG A;  4L3G D;  1FZH E;  3HFQ A;  1U8C A;  4EP9 A;  5M5U A;  4ES0 A;  3SNN A;  2OZS A;  3NIG A;  4GQ2 P;  4WK4 A;  4LGN A;  3PE7 A;  2B4E A;  3EQ7 A;  4J2B A;  4M3X A;  1O6G A;  4PC0 A;  4A08 B;  1FZ7 E;  1GOG A;  2EBS A;  4FVM A;  4OWR A;  4ERQ A;  2P9L C;  3N0E A;  2RKH A;  3NDK A;  3C6P B;  1T2X A;  3L1N A;  2Z2P A;  3RWU A;  3C9C A;  3SBP A;  3PVW B;  1JW2 A;  5THA A;  3IIW A;  5IJ8 E;  4J2A A;  4E54 A;  2VZ1 A;  3F3F A;  3I7L A;  4J87 A;  3ZE2 A;  4AN1 A;  3J81 g;  3O4J A;  3LD8 A;  4I9Q A;  3IUR A;  3JZN A;  4CZV A;  4DU3 A;  2P5G A;  1XU5 E;  1H2X A;  4AMZ A;  3EI1 A;  4D0K A;  1MHZ G;  2W18 A;  3OL2 A;  4X5M A;  4M3R A;  1U4C A;  2IUP A;  2H47 A;  3TAB A;  2HU8 A;  4GGD A;  3RFH A;  3UVL A;  1IG9 A;  4A11 A;  3K6S A;  2CNX A;  3LDB A;  4JRQ A;  2E32 A;  2AQ5 A;  2UZY B;  4N14 A;  4ZOV A;  5FKR A;  5H14 A;  4Z7N A;  4GGC A;  3T3M A;  4A0A B;  3HL8 A;  3LZI A;  4L1Q D;  1FZ8 E;  2XL2 A;  2O9K A;  3IJ0 A;  3EQ9 A;  3JB9 L;  2P9K C;  4X3E A;  2DEB A;  3UO2 A;  4FAV D;  1E8N A;  4DTN A;  1R5M A;  4JSP C;  5FLX g;  2XU7 A;  2I0T A;  4GQB B;  3L4M D;  5HYN B;  2H6K A;  5EMJ B;  3RFG A;  2JH8 A;  1YR2 A;  2BBK H;  2I3T A;  2QZP A;  4IRZ A;  3UKR C;  1B9Y A;  2P1P B;  4JSX C;  2AGL A;  5JWZ A;  1Q47 A;  1XVE E;  3IUM A;  3I7K A;  2HXC A;  4DU1 A;  4ICG C;  2YNN A;  2P1Q B;  3PSC B;  3KD1 E;  3SI6 A;  1MTY G;  5EAR A;  2EID A;  4KFM B;  4DTM A;  2JHA A;  3RRM C;  1C9L A;  4J79 A;  4U7A A;  3V4P A;  5HDB A;  3J27 A;  4X5N A;  2HD0 A;  2H6Q A;  2I3S A;  2OK6 A;  3OTT A;  5GXI A;  3NE6 A;  1N6F A;  4TZ4 A;  5GXH A;  3DXM C;  4JS5 A;  1OLZ A;  3UR4 A;  1E5T A;  3IJC A;  4NSX A;  4IA9 A;  4WK0 A;  4JHN A;  2G9A A;  4H5I A;  4FJM A;  1XU3 E;  1RI6 A;  2CE9 A;  4CZX A;  5KDO B;  2PM6 B;  4Z7Q A;  3P4F A;  4K3I D;  3MKS B;  1Q9Y A;  4LG8 A;  3SLE D;  5AJA A;  4FJN A;  2VDN A;  3UIQ A;  4D6V A;  3IUL A;  2VDP A;  3TAG A;  4LG9 A;  4QQE A;  4IT5 A;  3HGL A;  4AKI A;  1NR0 A;  3EQ8 A;  4PSW B;  3SQ2 A;  4O3U B;  3GD1 I;  4CZY A;  2IAA A;  5CXB B;  3SN6 B;  4M41 A;  4J78 A;  3IIY A;  4ESG A;  1PEV A;  3IVM A;  2B5L A;  5TF2 A;  4AEZ A;  1XMG E;  2GC7 A;  3DWL C;  1XMF E;  4G56 B;  2LF6 A;  1FZI E;  4GM8 A;  4FJG A;  2H9N A;  2YNO A;  4L9O A;  5HE2 B;  3SWS D;  4L1M A;  3SUP A;  2GC4 A;  3MZK A;  1JOF A;  3PXS D;  4GQ1 A;  3SHF A;  2OVQ B;  2EIC A;  3TAF A;  2J57 G;  2OVR B;  1JJU B;  3J80 g;  3V7D B;  3JRO A;  1N1C A;  4CI2 A;  3K26 A;  4PSX B;  1MHY G;  2H4T A;  4HCB A;  5FXY A;  5HE3 B;  3QEP A;  2AGY A;  3C6N B;  2B1E A;  2H9M A;  3NIF A;  2JHC A;  2CN3 A;  4Y5R D;  2J55 H;  3DXK C;  3QI0 A;  2XZG A;  1FZ4 E;  5C2W B;  5AMS A;  4GAM C;  5CXB A;  4RNG A;  4ERZ A;  1XVG E;  3VI4 A;  2QR5 A;  4M42 A;  4ERY A;  4I79 A;  4IMM A;  1XVC E;  3AL8 B;  4A0A A;  2P9N C;  1N6D A;  2XL3 A;  5TEF A;  3O4H A;  4QT8 A;  4CY3 A;  4L3H D;  4JT5 C;  1PI6 A;  4A08 A;  3QHY B;  1H2W A;  4OZU A;  1FWX A;  1WAF A;  4DTS A;  5FKS A;  3BWS A;  3N1B A;  1GOF A;  1N6E A;  2H9L A;  2YMU A;  3DDU A;  1JTD B;  2PM9 B;  1H2Y A;  2PM7 B;  1FS1 A;  5M5R A;  4D9S A;  3OF7 A;  5I5J A;  4M3Z A;  2P9S C;  4O9D A;  3I2N A;  3V4V A;  5K19 A;  4FA4 D;  2HU7 A;  3MKQ A;  3PVU B;  1P22 A;  1H2Z A;  2VDM A;  3JPX A;  2AH1 A;  1TBG A;  2JQT A;  3TL8 B;  4DU4 A;  3E4Y A;  2YNP A;  3MMY A;  3JAM g;  1GG2 B;  3EI2 B;  4A11 B;  2HJ4 A;  3VA6 A;  4DTX A;  2HJB A;  4R7A B;  2VZ3 A;  4PBY A;  3VGZ A;  4AKH A;  1FZ2 E;  5H37 A;  3QNN A;  1Q9X A;  3MXX A;  3RMB A;  3UKU C;  1FPO A;  3WSO A;  2H14 A;  2QXV A;  2TRC B;  3IJE A;  4QL1 A;  3QEV A;  4Z8L A;  3DSM A;  4E54 B;  2GNQ A;  4J2D A;  4BCC A;  3QEX A;  4X61 B;  2CO0 A;  2VDQ A;  4ADN A;  4FK4 A;  1A12 A;  4HDJ A;  3E4W A;  2FYO A;  3B7F A;  4XYH A;  2HES X;  5EM2 B;  4CY2 A;  1XL3 C;  3EWE A;  4UM8 A;  4NBM A;  4ADO A;  1B9X A;  4CY5 A;  4CY1 A;  5HQG A;  2HYE A;  3AH8 B;  4G1M A;  4O02 A;  4CI8 A;  4E4B A;  4FK0 A;  4H5J A;  4A2L A;  1FZ0 E;  3UVO A;  3EI3 A;  5IBK B;  2UZX B;  5IT9 g;  3OKY B;  3K72 A;  1BPO A;  3OKW A;  2AGZ A;  4B08 A;  4M3W A;  4BL0 A;  1L0Q A;  4WJK A;  1O6F A;  5EM2 A;  3C75 H;  4BP8 A;  1GOH A;  4BCB A;  2DTU A;  3JRP A;  2WQ8 A;  1MG3 A;  4BH6 A;  2OK4 A;  3QEW A;  4JS4 A;  3RMA A;  5GSA A;  4CC9 A;  4EWR A;  4JXM A;  3NAE A;  4Y7R A;  3OGL B;  4K3J B;  4HCC A;  4KHU A;  4J8B A;  4DNV A;  1SQ9 A;  3SUN A;  4UM9 A;  4AN0 A;  2H13 A;  2AH0 A;  4QND A;  3QET A;  5SXM A;  3QEI A;  5FQD A;  1NEX B;  4KHS A;  3OGM B;  3AL8 A;  5A2Q g;  4AI6 A;  2PFT A;  3EI2 A;  3AL9 A;  3A0F A;  3IJ1 A;  3K2O A;  3V5W B;  4E3S A;  3J2P A;  3SUO A;  3F3P A;  4FJ5 A;  5CYK B;  3EG6 A;  2XDW A;  4XEI C;  3NVX A;  3SJL D;  2XYI A;  3BG1 A;  2OJY A;  2VJ4 A;  3SQ4 A;  1M1X A;  2J56 H;  2VDK A;  3O4G A;  4FJH A;  4J2E A;  3T3P A;  3BG0 A;  3N1E A;  3SQ1 A;  3L8B A;  4I6J B;  4M3T A;  5I5I A;  2I0S A;  3TJY A;  1FZ6 E;  2Z2N A;  4M3U A;  4O1Q D;  3SPY A;  4DTJ A;  1K8K C;  2VDL A;  2YB5 A;  4NC4 A;  3SVI A;  5C92 A;  2OIZ A;  2H3X A;  3SXT D;  4I9L A;  1TYE A;  4XYI A;  3OKY A;  2QXF A;  3UVK A;  3RLM D;  2AGW A;  4JD2 C;  4J82 A;  1QFM A;  3MUO A;  3OKT A;  5TEE A;  5M61 A;  4FJK A;  4O3T B;  4PBZ A;  5M5T A;  1FZ5 E;  4DNW A;  1XVF E;  3HP9 A;  1VZ2 A;  3SVW D;  5EAM A;  4ZN4 A;  1UOO A;  4AMY A;  5IRE A;  2YBA A;  5FKT A;  3RN0 D; 
#chains in the Genus database with same CATH homology
 2VJ5 A;  3QNO A;  3C94 A;  3SCX A;  3SJJ A;  2IWF A;  4X60 B;  3FRX A;  3V9F A;  2PFV A;  2CE8 A;  5EMK B;  4MK0 B;  4GM3 A;  4KI6 A;  1XVD E;  5I5M A;  4FJ7 A;  3QES A;  3GRE A;  4FB1 D;  4AOW A;  4A09 A;  3NGI A;  4J81 A;  3CFV A;  2G99 A;  2I0R A;  4KI4 A;  1GOT B;  2P9P C;  2ATQ A;  3CQ8 A;  5EMM B;  3MZL A;  2OYQ A;  3C5M A;  2MZW B;  2MTA H;  2B7M A;  5FKQ A;  1FZ3 E;  2P1M B;  2OZM A;  4JSN C;  3KD5 E;  3GFC A;  2JHP A;  3E0C A;  5H1M A;  4A09 B;  4FAN D;  2IUQ A;  4M3Y A;  5HE1 B;  4ZOY A;  2RCU A;  2HKM A;  2Z2O A;  3DM0 A;  2B5N A;  5EAL A;  3SFZ A;  4QNC A;  3OGK B;  3C6O B;  2MMB A;  1JMZ B;  4EPH A;  3UVN A;  2Q7Q A;  2JH9 A;  2PBI B;  5GMK n;  4GMB A;  4DTU A;  3I8E A;  3UVM A;  3KRX B;  4X63 B;  2OVP B;  3PXW D;  2HKR A;  3SMR A;  5AFU 3;  1CLQ A;  4FJJ A;  3CFR A;  1SQJ A;  5TDH B;  4EYW A;  4FJL A;  1PGU A;  1OMW B;  2P1N B;  4KHQ A;  2H68 A;  2P9I C;  4ZOZ A;  1XMH E;  4RG8 A;  3VH0 A;  1FYZ E;  4DTR A;  3ODT A;  3CFS B;  1MMO G;  3I7H A;  3KRW B;  3ORV D;  1MG2 A;  5IJ7 E;  2IWK A;  4FA5 D;  4M45 A;  2YB8 B;  4RL5 A;  1A0R B;  3EU7 A;  1LDK E;  1IH7 A;  4FJ9 A;  4FK2 A;  1SHY B;  4GGA A;  3SBQ A;  1FZ9 E;  4DTP A;  4FWW A;  3CIK B;  3IKO A;  3EI1 B;  1XVB E;  3RSE C;  4GM9 A;  5EAP A;  3L0M A;  3EMH A;  2CN2 A;  4KHY A;  1XHM A;  2H6N A;  4FJI A;  5K1C C;  4JRP A;  3I8C A;  4YVD A;  1JMX B;  3NVN A;  4CI3 A;  4JT6 C;  3SPZ A;  4AKG A;  3OW8 A;  4JSV C;  2P1O B;  3NVQ A;  1PBY B;  4BUJ C;  3C99 A;  1FZ1 E;  2DY4 A;  1TYQ C;  3L2O B;  4A2M A;  3RMC A;  4KHW A;  3K27 A;  3I7N A;  3ZWL B;  4O45 A;  1VYH C;  3NCI A;  3I89 A;  3PXT D;  2VIX A;  1S4U X;  3EI4 B;  1QNI A;  2P5O A;  5IGQ A;  3LDS A;  4J0X A;  3U4Y A;  1ERJ A;  5CYK A;  3RMD A;  2B5M A;  3QER A;  4J84 A;  5H17 A;  4ZOX A;  2IUR A;  1XIP A;  2IUV A;  4FA1 D;  4QRJ A;  4A0B B;  4A0B A;  4J8G A;  2P9U C;  4J77 A;  3SCY A;  5C2V B;  4UI9 R;  5B4W A;  2CO0 C;  3FGB A;  3N0D A;  3CFO A;  3I7P A;  5C9Z B;  4GZ8 A;  3EI4 A;  3W15 A;  3RMZ D;  2QC5 A;  3SQ0 A;  1K32 A;  2E31 A;  4J73 A;  3RN1 D;  3F3G A;  1GXR A;  3I7O A;  3TAE A;  4PNK B;  4A7J A;  1WAJ A;  3HGK E;  5EML B;  4PXW A;  2LF3 A;  5IC7 A;  3SBR A;  5CXC A;  4E5Z B;  3LZJ A;  3AFC A;  4KHN A;  2B8I A;  4J0W A;  1MDA H;  3EI3 B;  3C95 A;  1U2V C;  5FA5 B;  4FA9 D;  5IZ7 A;  4FJX A;  5IGO A;  4FJ8 A;  3OL2 B;  2AGX A;  2H9P A;  4U1E I;  2FW3 A;  4J86 A;  2PM9 A;  1XKS A;  3JZH A;  3PSL A;  3FM0 A;  2BCJ B;  1FXX A;  2JPN A;  1YFQ A;  3L4O D;  4DTO A;  5CXC B;  4FHL A;  4CI1 A;  3ULE C;  3JZG A;  1GP2 B;  4E5Z A;  3CFP A;  5HE0 B;  3S9H A;  3SUQ A;  3NHG A;  4L3G D;  1FZH E;  3HFQ A;  4EP9 A;  4ES0 A;  3SNN A;  2OZS A;  4GQ2 P;  4LGN A;  3PE7 A;  2B4E A;  4J2B A;  4M3X A;  4PC0 A;  4A08 B;  1FZ7 E;  2EBS A;  4FVM A;  4OWR A;  4ERQ A;  2P9L C;  3N0E A;  3NDK A;  3C6P B;  2Z2P A;  3L1N A;  3RWU A;  3C9C A;  3SBP A;  3PVW B;  5THA A;  3IIW A;  5IJ8 E;  4J2A A;  4E54 A;  3F3F A;  3I7L A;  4J87 A;  3J81 g;  3LD8 A;  4I9Q A;  3JZN A;  4CZV A;  4DU3 A;  2P5G A;  1XU5 E;  3EI1 A;  4D0K A;  1MHZ G;  2W18 A;  3OL2 A;  4X5M A;  4M3R A;  1U4C A;  2IUP A;  2H47 A;  3TAB A;  3RFH A;  4GGD A;  3UVL A;  1IG9 A;  4A11 A;  2CNX A;  3LDB A;  4JRQ A;  2E32 A;  2AQ5 A;  2UZY B;  4N14 A;  4ZOV A;  5FKR A;  5H14 A;  4A0A B;  4GGC A;  3HL8 A;  3LZI A;  4L1Q D;  1FZ8 E;  2XL2 A;  2O9K A;  3IJ0 A;  3JB9 L;  2P9K C;  4X3E A;  2DEB A;  4FAV D;  4DTN A;  1R5M A;  4JSP C;  5FLX g;  2XU7 A;  2I0T A;  4GQB B;  3L4M D;  5HYN B;  2H6K A;  5EMJ B;  3RFG A;  2JH8 A;  2BBK H;  2I3T A;  3UKR C;  1B9Y A;  2P1P B;  4JSX C;  2AGL A;  5JWZ A;  1Q47 A;  1XVE E;  3I7K A;  2HXC A;  4DU1 A;  2YNN A;  2P1Q B;  3PSC B;  3KD1 E;  3SI6 A;  1MTY G;  5EAR A;  4KFM B;  4DTM A;  2JHA A;  3RRM C;  4J79 A;  4U7A A;  3J27 A;  4X5N A;  2HD0 A;  2H6Q A;  2I3S A;  2OK6 A;  3OTT A;  5GXI A;  3NE6 A;  1N6F A;  4TZ4 A;  5GXH A;  3DXM C;  4JS5 A;  1OLZ A;  3UR4 A;  3IJC A;  4NSX A;  4IA9 A;  2G9A A;  4H5I A;  4FJM A;  1XU3 E;  1RI6 A;  2CE9 A;  4CZX A;  5KDO B;  2PM6 B;  3P4F A;  4K3I D;  3MKS B;  1Q9Y A;  4LG8 A;  3SLE D;  5AJA A;  4FJN A;  3UIQ A;  4D6V A;  3TAG A;  4LG9 A;  4QQE A;  3HGL A;  4AKI A;  1NR0 A;  4PSW B;  3SQ2 A;  4O3U B;  4CZY A;  2IAA A;  5CXB B;  3SN6 B;  4M41 A;  4J78 A;  3IIY A;  4ESG A;  1PEV A;  2B5L A;  5TF2 A;  4AEZ A;  1XMG E;  2GC7 A;  3DWL C;  1XMF E;  4G56 B;  2LF6 A;  1FZI E;  4GM8 A;  4FJG A;  2H9N A;  2YNO A;  4L9O A;  5HE2 B;  3SWS D;  3SUP A;  2GC4 A;  3MZK A;  1JOF A;  3PXS D;  4GQ1 A;  3SHF A;  2OVQ B;  3TAF A;  2J57 G;  2OVR B;  1JJU B;  3J80 g;  3V7D B;  3JRO A;  4CI2 A;  3K26 A;  4PSX B;  1MHY G;  2H4T A;  4HCB A;  5FXY A;  5HE3 B;  3QEP A;  2AGY A;  3C6N B;  2B1E A;  2H9M A;  2JHC A;  2CN3 A;  4Y5R D;  2J55 H;  3DXK C;  1FZ4 E;  5C2W B;  5AMS A;  4GAM C;  5CXB A;  4RNG A;  4ERZ A;  1XVG E;  4M42 A;  4ERY A;  4I79 A;  4IMM A;  1XVC E;  3AL8 B;  4A0A A;  2P9N C;  1N6D A;  2XL3 A;  5TEF A;  4QT8 A;  4CY3 A;  4L3H D;  4JT5 C;  1PI6 A;  4A08 A;  4OZU A;  1FWX A;  1WAF A;  4DTS A;  5FKS A;  3BWS A;  3N1B A;  2YMU A;  1N6E A;  2H9L A;  2PM9 B;  2PM7 B;  1FS1 A;  5I5J A;  4M3Z A;  2P9S C;  4O9D A;  3I2N A;  5K19 A;  4FA4 D;  3MKQ A;  3PVU B;  1P22 A;  3JPX A;  2AH1 A;  1TBG A;  3TL8 B;  4DU4 A;  3E4Y A;  2YNP A;  3MMY A;  3JAM g;  1GG2 B;  3EI2 B;  4A11 B;  2HJ4 A;  3VA6 A;  4DTX A;  2HJB A;  4R7A B;  4PBY A;  3VGZ A;  4AKH A;  1FZ2 E;  5H37 A;  3QNN A;  1Q9X A;  3MXX A;  3RMB A;  3UKU C;  3WSO A;  2H14 A;  2QXV A;  2TRC B;  4QL1 A;  3QEV A;  4Z8L A;  3DSM A;  4E54 B;  2GNQ A;  4J2D A;  3QEX A;  4X61 B;  2CO0 A;  4ADN A;  4FK4 A;  4HDJ A;  3E4W A;  2FYO A;  3B7F A;  4XYH A;  2HES X;  5EM2 B;  4CY2 A;  1XL3 C;  3EWE A;  4ADO A;  1B9X A;  4CY5 A;  4CY1 A;  5HQG A;  2HYE A;  3AH8 B;  4CI8 A;  4E4B A;  4FK0 A;  4H5J A;  4A2L A;  1FZ0 E;  3UVO A;  3EI3 A;  5IBK B;  2UZX B;  5IT9 g;  3OKY B;  3OKW A;  2AGZ A;  4B08 A;  4M3W A;  4BL0 A;  1L0Q A;  5EM2 A;  3C75 H;  2DTU A;  3JRP A;  4BH6 A;  1MG3 A;  2OK4 A;  3QEW A;  4JS4 A;  3RMA A;  5GSA A;  4CC9 A;  4EWR A;  4JXM A;  3NAE A;  4Y7R A;  3OGL B;  4K3J B;  4HCC A;  4KHU A;  4J8B A;  1SQ9 A;  3SUN A;  2H13 A;  2AH0 A;  4QND A;  3QET A;  5SXM A;  3QEI A;  5FQD A;  1NEX B;  4KHS A;  3OGM B;  3AL8 A;  5A2Q g;  4AI6 A;  2PFT A;  3EI2 A;  3AL9 A;  3A0F A;  3IJ1 A;  3K2O A;  3V5W B;  4E3S A;  3J2P A;  3SUO A;  3F3P A;  4FJ5 A;  5CYK B;  3EG6 A;  4XEI C;  3NVX A;  3SJL D;  2XYI A;  3BG1 A;  2OJY A;  2VJ4 A;  3SQ4 A;  2J56 H;  4FJH A;  4J2E A;  3BG0 A;  3N1E A;  3SQ1 A;  3L8B A;  4I6J B;  4M3T A;  5I5I A;  2I0S A;  3TJY A;  1FZ6 E;  2Z2N A;  4M3U A;  4O1Q D;  3SPY A;  4DTJ A;  1K8K C;  2YB5 A;  3SVI A;  2OIZ A;  2H3X A;  3SXT D;  4I9L A;  4XYI A;  3OKY A;  2QXF A;  3UVK A;  3RLM D;  2AGW A;  4JD2 C;  4J82 A;  3OKT A;  5TEE A;  4FJK A;  4O3T B;  4PBZ A;  1FZ5 E;  1XVF E;  3HP9 A;  3SVW D;  5EAM A;  4ZN4 A;  5IRE A;  2YBA A;  5FKT A;  3RN0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...