2OVQB

Structure of the skp1-fbw7-cyclinedegc complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
444
structure length
444
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
molecule keywords S-phase kinase-associated protein 1A
total genus 126
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovqB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovqB02
4Y5RD 2I0SA 3EI3A 3ULEC 4K3JB 5IGQA 4FB1D 2H6QA 1XHMA 1N6DA 3I2NA 2P1MB 5GSAA 1SHYB 2Z2NA 4BH6A 3EMHA 3OKWA 3VGZA 4FA1D 4ERZA 3C5MA 3ORVD 3AL8B 4CY3A 4ZOYA 4ZN4A 3C6PB 3UR4A 4XEIC 5IC7A 3BWSA 4CY2A 3EI2B 4PXWA 4ERYA 4A09A 4ERQA 4BL0A 1P22A 3PVWB 3EI3B 2PM9B 4ESGA 4ES0A 4CZXA 2OK4A 2PBIB 5FKTA 4ZOVA 3NVQA 4CI1A 2YNOA 2OIZA 5H1MA 2H3XA 3OKYB 4FA4D 2HYEA 4X60B 2H6NA 3AL9A 1LDKE 2Q7QA 3I8EA 5CYKA 3SMRA 3PSCB 3CFVA 2CO0A 5EARA 5SXMA 5A2Qg 3JZNA 4FA5D 4IA9A 2H13A 3JZHA 3PVUB 4XYHA 4MK0B 4Z8LA 1TYQC 4H5JA 5FKQA 3RSEC 4CI3A 5EAMA 2P9IC 3JZGA 2P9SC 4A08B 2B5LA 4J0WA 4A2MA 5AMSA 3BG0A 2E32A 4N14A 5CXBA 1FS1A 4FA9D 4GGAA 3N0EA 4G56B 3B7FA 4R7AB 3KRXB 3F3PA 3IKOA 2H14A 2J57G 3MZKA 2I3SA 2AH0A 5GXIA 4QRJA 3C6NB 1K32A 3AL8A 5CXCA 2GC7A 2HXCA 2H68A 2H47A 3EI4A 5C2WB 1GOTB 2OVQB 4GQ2P 3PXSD 4PNKB 3FRXA 3VH0A 4D6VA 4LG8A 2YB8B 2TRCB 4A08A 5HE1B 3E0CA 3JB9L 3SLED 2W18A 5CYKB 4CY5A 2P9UC 4CI2A 2XYIA 4PC0A 5IT9g 2HESX 2Z2PA 4GGDA 2AH1A 4JT6C 3C9CA 5FXYA 3JRPA 4JXMA 5HYNB 3MMYA 3UVLA 1U2VC 3I89A 3J81g 4GM9A 3ZWLB 4L3GD 2B5NA 4CI8A 2PM9A 5EM2A 4JSXC 4FAND 3I7NA 2HKMA 1S4UX 4AOWA 3OKYA 4GZ8A 4FHLA 4O3UB 4J73A 4J8GA 3NVNA 2QC5A 5EMLB 4L9OA 2CN2A 2I0RA 3IIYA 2IWKA 4J0XA 2GC4A 1B9YA 5KDOB 5EMKB 2B4EA 2P1OB 2GNQA 5AJAA 4JT5C 1PBYB 3J80g 3CIKB 4CZYA 2B5MA 4LG9A 3FGBA 3I7KA 3PXWD 2IAAA 4PSXB 4FWWA 1MG3A 3DWLC 3NVXA 5B4WA 2HJBA 1JOFA 5FKSA 3I7LA 4J86A 3SHFA 1QNIA 4QL1A 1NEXB 3UVNA 1OLZA 2CE9A 3SN6B 2AGLA 3EI4B 1ERJA 5IBKB 4QT8A 3UKRC 5TEEA 3OL2A 2AGXA 2P9KC 3MXXA 3JAMg 5H14A 1OMWB 3N0DA 2BCJB 2PM6B 3L4OD 5HE2B 5EM2B 5IJ8E 3V7DB 4EWRA 2YNPA 5FLXg 1JMXB 5EAPA 3EU7A 4JSNC 4NSXA 4X61B 4O3TB 3WSOA 2CN3A 5TEFA 3OGKB 3C99A 4O45A 4I6JB 1Q47A 3IJ0A 2O9KA 3RN1D 2CO0C 3MKQA 4GGCA 3RLMD 3C6OB 1N6FA 5I5IA 2XL2A 4L1QD 4J87A 5I5JA 3RFGA 4PBZA 4OWRA 1RI6A 5GXHA 2I3TA 3HFQA 4JSPC 3RRMC 1GG2B 2H9MA 4E54B 4I79A 3PSLA 2UZXB 5THAA 3EG6A 2G9AA 4YVDA 1U4CA 4A7JA 3MZLA 2P9LC 3OW8A 3F3GA 4KFMB 1PI6A 4U7AA 3IJCA 4A09B 3OKTA 3DXKC 3L2OB 3RMZD 4A0BA 3VA6A 2P1NB 4X3EA 3EWEA 3A0FA 1GXRA 3MKSB 3KRWB 1NR0A 4E5ZB 3JROA 1PEVA 2P1PB 3F3FA 3IIWA 4PSWB 3FM0A 5GMKn 1XKSA 3UKUC 4J79A 5IGOA 5TF2A 5AFU3 3DM0A 4D0KA 3GREA 4J78A 3BG1A 2IUQA 4OZUA 3AFCA 3ODTA 3K27A 3OL2B 4BUJC 5K19A 3OGLB 5EMMB 2J55H 1L0QA 2AQ5A 3PE7A 2Z2OA 2BBKH 1N6EA 2XU7A 5HE3B 3EI1A 1TBGA 1PGUA 2P9PC 2XL3A 3SBQA 3RFHA 3I7PA 4A0AA 4O9DA 1A0RB 5TDHB 2UZYB 5FA5B 3I7HA 1VYHC 2PM7B 2OVPB 4GM3A 3RN0D 3SXTD 4JD2C 3UVOA 5JWZA 3SFZA 3V5WB 4X63B 2P1QB 5C9ZB 1GP2B 3C75H 2QXVA 1FWXA 4U1EI 3SVWD 1YFQA 4H5IA 4QQEA 3EI1B 2IUVA 4J77A 5CXBB 2HKRA 4LGNA 4XYIA 2YMUA 3DXMC 2H9NA 4Y7RA 2J56H 3AH8B 4PBYA 5HE0B 3UVMA 2E31A 3L4MD 3JPXA 2OVRB 3K26A 4J81A 5C2VB 2YNNA 4A0BB 2AGYA 5K1CC 2AGZA 4A11A 4CC9A 4HDJA 2IURA 4J8BA 2IUPA 2YBAA 4J84A 2OK6A 1XIPA 4GMBA 3W15A 4E5ZA 3GFCA 3OGMB 5H17A 2EBSA 3OTTA 2MTAH 4UI9R 1R5MA 2H6KA 5FKRA 3V9FA 3PXTD 4CY1A 4J82A 5HQGA 2CE8A 4K3ID 1SQJA 4L3HD 1B9XA 1MG2A 4AEZA 2IWFA 4A0AB 1K8KC 2G99A 2I0TA 3SBPA 3I8CA 3SWSD 3EI2A 3SBRA 2AGWA 2HJ4A 4IMMA 4E54A 2H9PA 1MDAH 2H9LA 4ZOZA 3IJ1A 4A2LA 4O1QD 1JMZB 3SJLD 3P4FA 5EALA 4CZVA 3DSMA 1JJUB 3UVKA 4ZOXA 5IJ7E 4GQBB 2CNXA 3I7OA 4FAVD 4GQ1A 4TZ4A 2OJYA 1SQ9A 3CFSB 5EMJB 4JSVC 3SCYA 5CXCB 4GM8A 5I5MA 3U4YA 4A11B 2P9NC 5FQDA
chains in the Genus database with same CATH superfamily
4Y5RD 2I0SA 3EI3A 3SVIA 4E3SA 3ULEC 4K3JB 5IGQA 4FB1D 4JRQA 3NHGA 2H6QA 3FCUA 1M1XA 1JV2A 1XHMA 1N6DA 3I2NA 2P1MB 4AX4A 5GSAA 1SHYB 3IUQA 2Z2NA 4BH6A 3SPZA 4AMZA 1VE7A 3EMHA 3OKWA 3VGZA 4FA1D 4ERZA 3C5MA 2VJ5A 1C9LA 4M41A 4NC4A 4FJGA 3ORVD 3SI6A 3AL8B 2ATQA 2RKHA 4CY3A 5IZ7A 4ZOYA 2QZPA 4ZN4A 3C6PB 3UR4A 4JRPA 4XEIC 5IC7A 2EIDA 2B8IA 3BWSA 4CY2A 3EI2B 2XE4A 4PXWA 3NCIA 2VC2A 3VI4A 4AMYA 4ERYA 4A09A 4ERQA 4BL0A 1P22A 3PVWB 2FYOA 2PM9B 3EI3B 3IULA 4G55A 3T3PA 3QEXA 4CZXA 4ES0A 2OK4A 4ESGA 2PBIB 5FKTA 4ZOVA 1MHYG 4FJXA 3KCIA 3NVQA 3QI0A 4CI1A 2VDOA 1L5GA 2YNOA 1UOOA 2OIZA 5H1MA 1FXXA 2H3XA 3OKYB 4J2EA 2JH9A 4FA4D 2HYEA 3LDSA 1UTCA 4X60B 2H6NA 3AL9A 1LDKE 4DNVA 4QAMA 3QEPA 2Q7QA 1E5TA 3I8EA 5CYKA 3SMRA 3PSCB 4FK4A 4DTMA 3CFVA 2CO0A 5EARA 5SXMA 5A2Qg 3JZNA 4FA5D 2PFVA 4IA9A 1CLQA 3RMBA 2H13A 3JZHA 3PVUB 4XYHA 4MK0B 3C95A 1TYQC 4H5JA 4Z8LA 5FKQA 3RSEC 1IG9A 4CI3A 3N1EA 5EAMA 2P9IC 3JZGA 1FZ5E 3N1BA 2P9SC 4A08B 2B5LA 4J0WA 4UM8A 5AMSA 3BG0A 4A2MA 2E32A 4FK2A 4N14A 5CXBA 4IT5A 1FS1A 4FA9D 4J2BA 4KHNA 3LZIA 4DTOA 4GGAA 3N0EA 1FPOA 3GD1I 4G56B 3B7FA 4FJIA 4R7AB 4NENA 4FJ5A 3KRXB 3F3PA 3IKOA 2H14A 5M61A 2J57G 3MZKA 2I3SA 2AH0A 2XZGA 5GXIA 3C6NB 1K32A 4QRJA 3AL8A 5CXCA 2VZ1A 2GC7A 2HXCA 2H68A 2H47A 3EI4A 5C2WB 1H2YA 1GOTB 2OVQB 4GQ2P 4BCDA 3PXSD 4PNKB 3FRXA 3VH0A 1FZ8E 2RCUA 4AKGA 4D6VA 2QR5A 4LG8A 3MVDK 2YB8B 1H2WA 3QNOA 3IVMA 4J2AA 3ZDZA 2TRCB 1FZ9E 4A08A 5HE1B 3E0CA 3JB9L 5H37A 3SLED 5M5VA 4AKHA 2W18A 5CYKB 4CY5A 1FZ6E 4G1MA 4BCCA 2P9UC 4UM9A 4CI2A 2XYIA 4NAAA 3HL8A 4PC0A 2HESX 3RMCA 2Z2PA 5IT9g 2BKLA 4GGDA 5E6SA 3NGIA 3CFPA 2AH1A 4G1EA 4JT6C 3C94A 3TJYA 1XVCE 3C9CA 5FXYA 4NBMA 1QFSA 1XVDE 4FJHA 3JRPA 4JXMA 5HYNB 2MZWB 3TL8B 3MMYA 1U2VC 3UVLA 2MW2A 3I89A 3NE6A 3J81g 3QEWA 3NIFA 4AN0A 5E6UA 4GM9A 4DTJA 3ZWLB 4EYWA 1Q9XA 4L3GD 3QERA 4D9SA 4RE6A 2B5NA 2HU7A 1T2XA 4CI8A 2PM9A 5EM2A 3SUQA 4JSXC 3HGKE 3K71A 2JPNA 4WK2A 4FAND 3I7NA 2HKMA 1S4UX 1H2XA 4AOWA 3OKYA 4GZ8A 4FHLA 4O3UB 1MHZG 4J73A 2PFTA 2VDNA 4J8GA 3NVNA 3NDKA 2QC5A 3TAFA 5EMLB 1BPOA 4L9OA 3SUPA 2DEBA 3K2OA 2CN2A 2I0RA 2MMBA 2VZ3A 4BCBA 1VZ3A 3IIYA 2IWKA 2VDLA 4J0XA 2B1EA 2VDMA 2GC4A 1B9YA 5KDOB 5EMKB 2VIXA 2B4EA 2VDKA 1E8MA 2P1OB 3KD5E 2GNQA 5C92A 5AJAA 4JT5C 1PBYB 3J80g 5HDBA 4RG8A 3CIKB 4CZYA 4J2DA 2B5MA 4LG9A 3FGBA 3I7KA 3PXWD 1XU5E 4DTXA 4IRZA 2OZMA 2IAAA 4PSXB 4FWWA 1FYZE 2LF6A 1MG3A 4M3TA 3DWLC 3NVXA 3MUNA 5B4WA 1H2ZA 2HJBA 1JOFA 5FKSA 3I7LA 4J86A 3SHFA 1XVFE 1QNIA 4QL1A 1NEXB 3UVNA 1OLZA 3RMAA 4FJ9A 1FZ2E 2CE9A 3SN6B 4QNDA 2AGLA 3EI4B 1ERJA 5IBKB 4ICGC 4QT8A 3UKRC 2EIEA 5TEEA 3EQ7A 3OL2A 2VDQA 4DU1A 1E8NA 2AGXA 2P9KC 4DU3A 3MXXA 3T3MA 4RL5A 3HP9A 3K72A 4M45A 4DNUA 3JAMg 2XDWA 1OMWB 3N0DA 5H14A 4FJ8A 2BCJB 3TABA 1GOHA 5IREA 2DY4A 2PM6B 3L4OD 4FJMA 5HE2B 5EM2B 3SCXA 5M5TA 4QNCA 4KHUA 2HD0A 5IJ8E 3V7DB 4EWRA 2YNPA 5FLXg 4X5MA 1JMXB 1TYEA 1UOQA 5EAPA 3EU7A 4JSNC 4WK4A 4NSXA 4X61B 3WSOA 4O3TB 2CN3A 4B08A 5TEFA 3ZDXA 4AKIA 3OGKB 3C99A 4O45A 3UO3A 4I6JB 3CFRA 1Q47A 1Q9YA 3IJ0A 1XMHE 2O9KA 3RN1D 2CO0C 3MKQA 4GGCA 3RLMD 3C6OB 1N6FA 5I5IA 2XL2A 4AN1A 4L1QD 1U8CA 4J87A 5I5JA 3MUOA 3RFGA 4PBZA 4OWRA 1RI6A 5GXHA 2I3TA 3HFQA 4JSPC 3RRMC 2JHAA 1GG2B 2H9MA 4E54B 4I79A 3PSLA 3QEIA 1UOPA 4KHSA 3EQ9A 2UZXB 5C86A 3SVWD 1YR2A 5THAA 3EG6A 2G9AA 4YVDA 1U4CA 4A7JA 3MZLA 2P9LC 3OW8A 1N1CA 3F3GA 4KFMB 4DTNA 3SUOA 1PI6A 4WJKA 4U7AA 5M5RA 3IJCA 3RMDA 4A09B 3OKTA 2VDPA 3DXKC 4M3XA 3L2OB 3RMZD 4A0BA 4JHPC 3VA6A 2P1NB 4HCBA 4X3EA 1O6FA 3EWEA 4DNWA 3A0FA 1GXRA 3MKSB 4ADOA 3KRWB 2B7MA 1NR0A 4E5ZB 3JROA 2P5OA 3L1NA 2DTUA 1PEVA 2P1PB 1I2MB 3F3FA 3IIWA 3O4HA 4M3WA 3S9HA 2FW3A 4PSWB 3FM0A 5GMKn 4WK0A 1XKSA 4FJJA 3UKUC 4FJNA 1VE6A 4J79A 5IGOA 4MMXA 3O4JA 1IH7A 1FZ1E 5TF2A 5AFU3 3DM0A 4D0KA 5M5SA 4MMZA 3GREA 1FZ0E 3BG1A 3UIQA 4J78A 2IUQA 4OZUA 3QNNA 4FK0A 3UO2A 3AFCA 3QETA 2HU5A 3NIDA 4ADNA 3CFOA 3ODTA 3K27A 4JS4A 3OL2B 1MTYG 4JHNA 4BUJC 2LF3A 1WAJA 5K19A 3OGLB 3E4WA 1A12A 4E4BA 5EMMB 2J55H 1L0QA 2AQ5A 3TAEA 3IJEA 3PE7A 5M5UA 3LZJA 1O6GA 2Z2OA 2BBKH 4L1MA 2QXFA 2OYQA 4I9LA 1N6EA 2XU7A 5HE3B 3LDBA 3EI1A 3FCSA 1GOGA 1TBGA 5FFGA 3SNNA 3DDUA 3QHYB 3NAEA 1PGUA 3O4IA 2P9PC 2XL3A 3ZE1A 3ZE2A 3SBQA 3RFHA 3I7PA 1FZ3E 4A0AA 3L0MA 4O9DA 1A0RB 1XVEE 4HCCA 2EICA 5TDHB 1FZHE 2UZYB 5FA5B 3VI3A 3I7HA 1VYHC 3IUJA 2PM7B 2OVPB 4GM3A 1GOFA 3RWUA 3RN0D 4FJLA 2P5GA 3SXTD 4JD2C 3UVOA 5JWZA 3SFZA 4AI6A 4FJKA 3V5WB 4X63B 2OZSA 4DTPA 2P1QB 5C9ZB 1GP2B 1VZ2A 3C75H 4M3RA 1JW2A 1FWXA 2QXVA 4DTUA 4U1EI 3ZE0A 1YFQA 4H5IA 1C9IA 4QQEA 4Z7QA 3EI1B 3QESA 4DU4A 2IUVA 4J77A 5CXBB 2HKRA 4LGNA 4XYIA 4DTRA 3EQ8A 3J27A 3QEVA 2JHPA 4X5NA 1XL3C 2H9NA 2YB5A 2YMUA 2J56H 3AH8B 3DXMC 3NIGA 4JS5A 4Y7RA 4PBYA 5HE0B 3UVMA 2E31A 3L4MD 1WAFA 3JPXA 2OVRB 3K26A 4J81A 5C2VB 4MMYA 2HU8A 2YNNA 1XMGE 4M3UA 2AGYA 5K1CC 4A0BB 2AGZA 1QFMA 4O02A 4A11A 1K3IA 4CC9A 4HDJA 2JQTA 2IURA 1XMFE 4KI4A 4J8BA 2IUPA 3SQ4A 2YBAA 3V4PA 4KHYA 4J84A 2OK6A 1XIPA 2JKXA 4M3YA 4GMBA 3W15A 4Z7NA 1FZ4E 3OF7A 4E5ZA 3GFCA 2JH8A 3OGMB 5H17A 2EBSA 3OTTA 2MTAH 4UI9R 1R5MA 2H6KA 4RE5A 5FFOA 5FKRA 3CQ8A 3E4YA 3V4VA 3PXTD 3V9FA 4BP8A 4CY1A 4J82A 3ZDYA 2VDRA 5HQGA 3BVOA 2CE8A 4K3ID 1XU3E 3J2PA 1SQJA 2WQ8A 4L3HD 4DTSA 1XVGE 1JTDB 1B9XA 1FZIE 1MG2A 4AEZA 3KD1E 3SPYA 3TAGA 2IWFA 3SQ1A 4A0AB 1K8KC 4O2WA 2G99A 2I0TA 3IUMA 4I9QA 3SJJA 4KHQA 3I8CA 4M42A 1MMOG 3SBPA 3SWSD 3EI2A 3SBRA 2H4TA 2AGWA 3SQ0A 4EP9A 2HJ4A 5E6RA 4IMMA 2EIBA 4Z7OA 4E54A 1FZ7E 4KI6A 2H9PA 3HGLA 4EPHA 4FJ7A 1MDAH 2H9LA 4ZOZA 4BP9A 3IJ1A 4A2LA 4FVMA 1JMZB 4O1QD 3SJLD 3P4FA 5EALA 4CZVA 3IURA 3DSMA 2JHCA 1XVBE 4M3ZA 1JJUB 3UVKA 4ZOXA 5IJ7E 4GQBB 2CNXA 3SQ2A 4KHWA 3I7OA 4FAVD 4GQ1A 4TZ4A 3IUNA 2OJYA 3K6SA 1SQ9A 2K5SA 3CFSB 3GC3B 5EMJB 4JSVC 3SCYA 5CXCB 4GM8A 5I5MA 3LD8A 4GAMC 3U4YA 2VJ4A 4A11B 2P9NC 3SUNA 3O4GA 4RNGA 3L8BA 5FQDA
chains in the Genus database with same CATH topology
4Y5RD 2I0SA 3EI3A 3SVIA 4E3SA 3ULEC 4K3JB 5IGQA 4FB1D 4JRQA 3NHGA 2H6QA 1XHMA 1N6DA 3I2NA 2P1MB 5GSAA 1SHYB 2Z2NA 4BH6A 3SPZA 3EMHA 3OKWA 3VGZA 4FA1D 4ERZA 3C5MA 2VJ5A 4M41A 4FJGA 3ORVD 3SI6A 3AL8B 2ATQA 4CY3A 5IZ7A 4ZOYA 4ZN4A 3C6PB 3UR4A 4JRPA 4XEIC 5IC7A 3BWSA 2B8IA 4CY2A 3EI2B 4PXWA 3NCIA 4ERYA 4A09A 4ERQA 4BL0A 1P22A 3PVWB 2FYOA 2PM9B 3EI3B 4ESGA 4ES0A 3QEXA 4CZXA 2OK4A 2PBIB 5FKTA 4ZOVA 1MHYG 4FJXA 3NVQA 4CI1A 2YNOA 2OIZA 5H1MA 1FXXA 2H3XA 3OKYB 4J2EA 2JH9A 4FA4D 2HYEA 3LDSA 4X60B 2H6NA 3AL9A 1LDKE 3QEPA 2Q7QA 3I8EA 5CYKA 3SMRA 3PSCB 4FK4A 4DTMA 3CFVA 2CO0A 5EARA 5SXMA 5A2Qg 3JZNA 4FA5D 2PFVA 4IA9A 1CLQA 3RMBA 2H13A 3JZHA 3PVUB 4XYHA 4MK0B 3C95A 1TYQC 4H5JA 4Z8LA 5FKQA 3RSEC 1IG9A 4CI3A 3N1EA 5EAMA 2P9IC 3JZGA 1FZ5E 3N1BA 2P9SC 4A08B 2B5LA 4J0WA 4A2MA 5AMSA 3BG0A 2E32A 4FK2A 4N14A 5CXBA 1FS1A 4FA9D 4J2BA 4KHNA 3LZIA 4DTOA 4GGAA 3N0EA 4G56B 3B7FA 4FJIA 4R7AB 4FJ5A 3KRXB 3F3PA 3IKOA 2H14A 2J57G 3MZKA 2I3SA 2AH0A 5GXIA 3C6NB 1K32A 4QRJA 3AL8A 5CXCA 2GC7A 2HXCA 2H68A 2H47A 3EI4A 5C2WB 1GOTB 2OVQB 4GQ2P 3PXSD 4PNKB 3FRXA 3VH0A 1FZ8E 2RCUA 4AKGA 4D6VA 4LG8A 2YB8B 3QNOA 4J2AA 2TRCB 1FZ9E 4A08A 5HE1B 3E0CA 3JB9L 5H37A 3SLED 4AKHA 2W18A 5CYKB 4CY5A 1FZ6E 2P9UC 4CI2A 2XYIA 3HL8A 4PC0A 2HESX 3RMCA 2Z2PA 5IT9g 4GGDA 3NGIA 3CFPA 2AH1A 4JT6C 3C94A 3TJYA 1XVCE 3C9CA 5FXYA 1XVDE 4FJHA 3JRPA 4JXMA 5HYNB 2MZWB 3TL8B 3MMYA 1U2VC 3UVLA 3I89A 3NE6A 3J81g 3QEWA 4GM9A 4DTJA 3ZWLB 4EYWA 1Q9XA 4L3GD 3QERA 2B5NA 4CI8A 2PM9A 5EM2A 3SUQA 4JSXC 3HGKE 2JPNA 4FAND 3I7NA 2HKMA 1S4UX 4AOWA 3OKYA 4GZ8A 4FHLA 4O3UB 1MHZG 4J73A 2PFTA 4J8GA 3NVNA 3NDKA 2QC5A 3TAFA 5EMLB 4L9OA 3SUPA 2DEBA 3K2OA 2CN2A 2I0RA 2MMBA 3IIYA 2IWKA 4J0XA 2B1EA 2GC4A 1B9YA 5KDOB 5EMKB 2VIXA 2B4EA 2P1OB 3KD5E 2GNQA 5AJAA 4JT5C 1PBYB 3J80g 4RG8A 3CIKB 4CZYA 4J2DA 2B5MA 4LG9A 3FGBA 3I7KA 3PXWD 1XU5E 4DTXA 2OZMA 2IAAA 4PSXB 4FWWA 1FYZE 2LF6A 1MG3A 4M3TA 3DWLC 3NVXA 5B4WA 2HJBA 1JOFA 5FKSA 3I7LA 4J86A 3SHFA 1XVFE 1QNIA 4QL1A 1NEXB 3UVNA 1OLZA 2CE9A 3RMAA 4FJ9A 1FZ2E 3SN6B 4QNDA 2AGLA 3EI4B 1ERJA 5IBKB 4QT8A 3UKRC 5TEEA 3OL2A 4DU1A 2AGXA 2P9KC 4DU3A 3MXXA 4RL5A 3HP9A 4M45A 3JAMg 5H14A 1OMWB 3N0DA 4FJ8A 2BCJB 3TABA 5IREA 2DY4A 2PM6B 3L4OD 4FJMA 5HE2B 5EM2B 3SCXA 4QNCA 4KHUA 2HD0A 5IJ8E 3V7DB 4EWRA 2YNPA 5FLXg 4X5MA 1JMXB 5EAPA 3EU7A 4JSNC 4NSXA 4X61B 3WSOA 4O3TB 2CN3A 4B08A 5TEFA 4AKIA 3OGKB 3C99A 4O45A 4I6JB 3CFRA 1Q47A 1Q9YA 3IJ0A 1XMHE 2O9KA 3RN1D 2CO0C 3MKQA 4GGCA 3RLMD 3C6OB 1N6FA 5I5IA 2XL2A 4L1QD 4J87A 5I5JA 3RFGA 4PBZA 4OWRA 1RI6A 5GXHA 2I3TA 3HFQA 4JSPC 3RRMC 2JHAA 1GG2B 2H9MA 4E54B 4I79A 3PSLA 3QEIA 4KHSA 2UZXB 5THAA 3EG6A 2G9AA 4YVDA 1U4CA 4A7JA 3MZLA 2P9LC 3OW8A 3F3GA 4KFMB 4DTNA 3SUOA 1PI6A 4U7AA 3IJCA 3RMDA 4A09B 3OKTA 3DXKC 4M3XA 3L2OB 3RMZD 4A0BA 3VA6A 2P1NB 4HCBA 4X3EA 3EWEA 3A0FA 1GXRA 3MKSB 4ADOA 3KRWB 2B7MA 1NR0A 4E5ZB 3JROA 2P5OA 3L1NA 2DTUA 1PEVA 2P1PB 3F3FA 3IIWA 4M3WA 3S9HA 2FW3A 4PSWB 3FM0A 5GMKn 1XKSA 4FJJA 3UKUC 4FJNA 4J79A 5IGOA 5TF2A 1IH7A 1FZ1E 5AFU3 3DM0A 4D0KA 3GREA 1FZ0E 3BG1A 3UIQA 4J78A 2IUQA 4OZUA 3QNNA 4FK0A 3AFCA 3ODTA 3QETA 4ADNA 3CFOA 3K27A 4JS4A 3OL2B 1MTYG 4BUJC 2LF3A 1WAJA 5K19A 3OGLB 3E4WA 4E4BA 5EMMB 2J55H 1L0QA 2AQ5A 3TAEA 3PE7A 3LZJA 2Z2OA 2BBKH 2QXFA 2OYQA 4I9LA 1N6EA 2XU7A 5HE3B 3LDBA 3EI1A 1TBGA 3SNNA 3NAEA 1PGUA 2P9PC 2XL3A 3SBQA 3RFHA 3I7PA 1FZ3E 4A0AA 3L0MA 4O9DA 1A0RB 1XVEE 4HCCA 5TDHB 1FZHE 2UZYB 5FA5B 3I7HA 1VYHC 2PM7B 2OVPB 4GM3A 3RWUA 3RN0D 4FJLA 2P5GA 3SXTD 4JD2C 3UVOA 5JWZA 3SFZA 4AI6A 4FJKA 3V5WB 4X63B 2OZSA 4DTPA 2P1QB 5C9ZB 1GP2B 3C75H 4M3RA 1FWXA 2QXVA 4U1EI 4DTUA 3SVWD 1YFQA 4H5IA 4QQEA 3EI1B 3QESA 4DU4A 2IUVA 4J77A 5CXBB 2HKRA 4LGNA 4XYIA 4DTRA 3J27A 3QEVA 2JHPA 4X5NA 1XL3C 2H9NA 2YB5A 2YMUA 2J56H 3AH8B 3DXMC 4Y7RA 4JS5A 4PBYA 5HE0B 3UVMA 2E31A 3L4MD 1WAFA 3JPXA 2OVRB 3K26A 4J81A 5C2VB 2YNNA 1XMGE 4M3UA 2AGYA 5K1CC 4A0BB 2AGZA 4A11A 4CC9A 4HDJA 2IURA 1XMFE 4KI4A 4J8BA 2IUPA 3SQ4A 2YBAA 4KHYA 4J84A 2OK6A 1XIPA 4M3YA 4GMBA 3W15A 1FZ4E 4E5ZA 3GFCA 2JH8A 3OGMB 5H17A 2EBSA 3OTTA 2MTAH 4UI9R 1R5MA 2H6KA 5FKRA 3V9FA 3CQ8A 3E4YA 3PXTD 4CY1A 4J82A 5HQGA 2CE8A 4K3ID 1XU3E 3J2PA 1SQJA 4L3HD 4DTSA 1XVGE 1B9XA 1FZIE 1MG2A 4AEZA 3KD1E 3SPYA 3TAGA 2IWFA 3SQ1A 4A0AB 1K8KC 2G99A 2I0TA 4I9QA 3SJJA 4KHQA 3I8CA 4M42A 1MMOG 3SBPA 3SWSD 3EI2A 3SBRA 2H4TA 2AGWA 3SQ0A 4EP9A 2HJ4A 4IMMA 4E54A 1FZ7E 4KI6A 2H9PA 3HGLA 4EPHA 4FJ7A 2H9LA 1MDAH 4ZOZA 3IJ1A 4A2LA 4FVMA 1JMZB 4O1QD 3SJLD 3P4FA 5EALA 4CZVA 3DSMA 2JHCA 1XVBE 4M3ZA 1JJUB 3UVKA 4ZOXA 5IJ7E 4GQBB 2CNXA 3SQ2A 4KHWA 3I7OA 4FAVD 4GQ1A 4TZ4A 2OJYA 1SQ9A 3CFSB 5EMJB 4JSVC 3SCYA 5CXCB 4GM8A 5I5MA 3LD8A 4GAMC 3U4YA 2VJ4A 4A11B 2P9NC 3SUNA 4RNGA 3L8BA 5FQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y5R D;  2I0S A;  3EI3 A;  3ULE C;  4K3J B;  5IGQ A;  4FB1 D;  2H6Q A;  1XHM A;  1N6D A;  3I2N A;  2P1M B;  5GSA A;  1SHY B;  2Z2N A;  4BH6 A;  3EMH A;  3OKW A;  3VGZ A;  4FA1 D;  4ERZ A;  3C5M A;  3ORV D;  3AL8 B;  4CY3 A;  4ZOY A;  4ZN4 A;  3C6P B;  3UR4 A;  4XEI C;  5IC7 A;  3BWS A;  4CY2 A;  3EI2 B;  4PXW A;  4ERY A;  4A09 A;  4ERQ A;  4BL0 A;  1P22 A;  3PVW B;  3EI3 B;  2PM9 B;  4ESG A;  4ES0 A;  4CZX A;  2OK4 A;  2PBI B;  5FKT A;  4ZOV A;  3NVQ A;  4CI1 A;  2YNO A;  2OIZ A;  5H1M A;  2H3X A;  3OKY B;  4FA4 D;  2HYE A;  4X60 B;  2H6N A;  3AL9 A;  1LDK E;  2Q7Q A;  3I8E A;  5CYK A;  3SMR A;  3PSC B;  3CFV A;  2CO0 A;  5EAR A;  5SXM A;  5A2Q g;  3JZN A;  4FA5 D;  4IA9 A;  2H13 A;  3JZH A;  3PVU B;  4XYH A;  4MK0 B;  4Z8L A;  1TYQ C;  4H5J A;  5FKQ A;  3RSE C;  4CI3 A;  5EAM A;  2P9I C;  3JZG A;  2P9S C;  4A08 B;  2B5L A;  4J0W A;  4A2M A;  5AMS A;  3BG0 A;  2E32 A;  4N14 A;  5CXB A;  1FS1 A;  4FA9 D;  4GGA A;  3N0E A;  4G56 B;  3B7F A;  4R7A B;  3KRX B;  3F3P A;  3IKO A;  2H14 A;  2J57 G;  3MZK A;  2I3S A;  2AH0 A;  5GXI A;  4QRJ A;  3C6N B;  1K32 A;  3AL8 A;  5CXC A;  2GC7 A;  2HXC A;  2H68 A;  2H47 A;  3EI4 A;  5C2W B;  1GOT B;  2OVQ B;  4GQ2 P;  3PXS D;  4PNK B;  3FRX A;  3VH0 A;  4D6V A;  4LG8 A;  2YB8 B;  2TRC B;  4A08 A;  5HE1 B;  3E0C A;  3JB9 L;  3SLE D;  2W18 A;  5CYK B;  4CY5 A;  2P9U C;  4CI2 A;  2XYI A;  4PC0 A;  5IT9 g;  2HES X;  2Z2P A;  4GGD A;  2AH1 A;  4JT6 C;  3C9C A;  5FXY A;  3JRP A;  4JXM A;  5HYN B;  3MMY A;  3UVL A;  1U2V C;  3I89 A;  3J81 g;  4GM9 A;  3ZWL B;  4L3G D;  2B5N A;  4CI8 A;  2PM9 A;  5EM2 A;  4JSX C;  4FAN D;  3I7N A;  2HKM A;  1S4U X;  4AOW A;  3OKY A;  4GZ8 A;  4FHL A;  4O3U B;  4J73 A;  4J8G A;  3NVN A;  2QC5 A;  5EML B;  4L9O A;  2CN2 A;  2I0R A;  3IIY A;  2IWK A;  4J0X A;  2GC4 A;  1B9Y A;  5KDO B;  5EMK B;  2B4E A;  2P1O B;  2GNQ A;  5AJA A;  4JT5 C;  1PBY B;  3J80 g;  3CIK B;  4CZY A;  2B5M A;  4LG9 A;  3FGB A;  3I7K A;  3PXW D;  2IAA A;  4PSX B;  4FWW A;  1MG3 A;  3DWL C;  3NVX A;  5B4W A;  2HJB A;  1JOF A;  5FKS A;  3I7L A;  4J86 A;  3SHF A;  1QNI A;  4QL1 A;  1NEX B;  3UVN A;  1OLZ A;  2CE9 A;  3SN6 B;  2AGL A;  3EI4 B;  1ERJ A;  5IBK B;  4QT8 A;  3UKR C;  5TEE A;  3OL2 A;  2AGX A;  2P9K C;  3MXX A;  3JAM g;  5H14 A;  1OMW B;  3N0D A;  2BCJ B;  2PM6 B;  3L4O D;  5HE2 B;  5EM2 B;  5IJ8 E;  3V7D B;  4EWR A;  2YNP A;  5FLX g;  1JMX B;  5EAP A;  3EU7 A;  4JSN C;  4NSX A;  4X61 B;  4O3T B;  3WSO A;  2CN3 A;  5TEF A;  3OGK B;  3C99 A;  4O45 A;  4I6J B;  1Q47 A;  3IJ0 A;  2O9K A;  3RN1 D;  2CO0 C;  3MKQ A;  4GGC A;  3RLM D;  3C6O B;  1N6F A;  5I5I A;  2XL2 A;  4L1Q D;  4J87 A;  5I5J A;  3RFG A;  4PBZ A;  4OWR A;  1RI6 A;  5GXH A;  2I3T A;  3HFQ A;  4JSP C;  3RRM C;  1GG2 B;  2H9M A;  4E54 B;  4I79 A;  3PSL A;  2UZX B;  5THA A;  3EG6 A;  2G9A A;  4YVD A;  1U4C A;  4A7J A;  3MZL A;  2P9L C;  3OW8 A;  3F3G A;  4KFM B;  1PI6 A;  4U7A A;  3IJC A;  4A09 B;  3OKT A;  3DXK C;  3L2O B;  3RMZ D;  4A0B A;  3VA6 A;  2P1N B;  4X3E A;  3EWE A;  3A0F A;  1GXR A;  3MKS B;  3KRW B;  1NR0 A;  4E5Z B;  3JRO A;  1PEV A;  2P1P B;  3F3F A;  3IIW A;  4PSW B;  3FM0 A;  5GMK n;  1XKS A;  3UKU C;  4J79 A;  5IGO A;  5TF2 A;  5AFU 3;  3DM0 A;  4D0K A;  3GRE A;  4J78 A;  3BG1 A;  2IUQ A;  4OZU A;  3AFC A;  3ODT A;  3K27 A;  3OL2 B;  4BUJ C;  5K19 A;  3OGL B;  5EMM B;  2J55 H;  1L0Q A;  2AQ5 A;  3PE7 A;  2Z2O A;  2BBK H;  1N6E A;  2XU7 A;  5HE3 B;  3EI1 A;  1TBG A;  1PGU A;  2P9P C;  2XL3 A;  3SBQ A;  3RFH A;  3I7P A;  4A0A A;  4O9D A;  1A0R B;  5TDH B;  2UZY B;  5FA5 B;  3I7H A;  1VYH C;  2PM7 B;  2OVP B;  4GM3 A;  3RN0 D;  3SXT D;  4JD2 C;  3UVO A;  5JWZ A;  3SFZ A;  3V5W B;  4X63 B;  2P1Q B;  5C9Z B;  1GP2 B;  3C75 H;  2QXV A;  1FWX A;  4U1E I;  3SVW D;  1YFQ A;  4H5I A;  4QQE A;  3EI1 B;  2IUV A;  4J77 A;  5CXB B;  2HKR A;  4LGN A;  4XYI A;  2YMU A;  3DXM C;  2H9N A;  4Y7R A;  2J56 H;  3AH8 B;  4PBY A;  5HE0 B;  3UVM A;  2E31 A;  3L4M D;  3JPX A;  2OVR B;  3K26 A;  4J81 A;  5C2V B;  2YNN A;  4A0B B;  2AGY A;  5K1C C;  2AGZ A;  4A11 A;  4CC9 A;  4HDJ A;  2IUR A;  4J8B A;  2IUP A;  2YBA A;  4J84 A;  2OK6 A;  1XIP A;  4GMB A;  3W15 A;  4E5Z A;  3GFC A;  3OGM B;  5H17 A;  2EBS A;  3OTT A;  2MTA H;  4UI9 R;  1R5M A;  2H6K A;  5FKR A;  3V9F A;  3PXT D;  4CY1 A;  4J82 A;  5HQG A;  2CE8 A;  4K3I D;  1SQJ A;  4L3H D;  1B9X A;  1MG2 A;  4AEZ A;  2IWF A;  4A0A B;  1K8K C;  2G99 A;  2I0T A;  3SBP A;  3I8C A;  3SWS D;  3EI2 A;  3SBR A;  2AGW A;  2HJ4 A;  4IMM A;  4E54 A;  2H9P A;  1MDA H;  2H9L A;  4ZOZ A;  3IJ1 A;  4A2L A;  4O1Q D;  1JMZ B;  3SJL D;  3P4F A;  5EAL A;  4CZV A;  3DSM A;  1JJU B;  3UVK A;  4ZOX A;  5IJ7 E;  4GQB B;  2CNX A;  3I7O A;  4FAV D;  4GQ1 A;  4TZ4 A;  2OJY A;  1SQ9 A;  3CFS B;  5EMJ B;  4JSV C;  3SCY A;  5CXC B;  4GM8 A;  5I5M A;  3U4Y A;  4A11 B;  2P9N C;  5FQD A; 
#chains in the Genus database with same CATH topology
 4Y5R D;  2I0S A;  3EI3 A;  3SVI A;  4E3S A;  3ULE C;  4K3J B;  5IGQ A;  4FB1 D;  4JRQ A;  3NHG A;  2H6Q A;  3FCU A;  1M1X A;  1JV2 A;  1XHM A;  1N6D A;  3I2N A;  2P1M B;  4AX4 A;  5GSA A;  1SHY B;  3IUQ A;  2Z2N A;  4BH6 A;  3SPZ A;  4AMZ A;  1VE7 A;  3EMH A;  3OKW A;  3VGZ A;  4FA1 D;  4ERZ A;  3C5M A;  2VJ5 A;  1C9L A;  4M41 A;  4NC4 A;  4FJG A;  3ORV D;  3SI6 A;  3AL8 B;  2ATQ A;  2RKH A;  4CY3 A;  5IZ7 A;  4ZOY A;  2QZP A;  4ZN4 A;  3C6P B;  3UR4 A;  4JRP A;  4XEI C;  5IC7 A;  2EID A;  2B8I A;  3BWS A;  4CY2 A;  3EI2 B;  2XE4 A;  4PXW A;  3NCI A;  2VC2 A;  3VI4 A;  4AMY A;  4ERY A;  4A09 A;  4ERQ A;  4BL0 A;  1P22 A;  3PVW B;  2FYO A;  2PM9 B;  3EI3 B;  3IUL A;  4G55 A;  3T3P A;  3QEX A;  4CZX A;  4ES0 A;  2OK4 A;  4ESG A;  2PBI B;  5FKT A;  4ZOV A;  1MHY G;  4FJX A;  3KCI A;  3NVQ A;  3QI0 A;  4CI1 A;  2VDO A;  1L5G A;  2YNO A;  1UOO A;  2OIZ A;  5H1M A;  1FXX A;  2H3X A;  3OKY B;  4J2E A;  2JH9 A;  4FA4 D;  2HYE A;  3LDS A;  1UTC A;  4X60 B;  2H6N A;  3AL9 A;  1LDK E;  4DNV A;  4QAM A;  3QEP A;  2Q7Q A;  1E5T A;  3I8E A;  5CYK A;  3SMR A;  3PSC B;  4FK4 A;  4DTM A;  3CFV A;  2CO0 A;  5EAR A;  5SXM A;  5A2Q g;  3JZN A;  4FA5 D;  2PFV A;  4IA9 A;  1CLQ A;  3RMB A;  2H13 A;  3JZH A;  3PVU B;  4XYH A;  4MK0 B;  3C95 A;  1TYQ C;  4H5J A;  4Z8L A;  5FKQ A;  3RSE C;  1IG9 A;  4CI3 A;  3N1E A;  5EAM A;  2P9I C;  3JZG A;  1FZ5 E;  3N1B A;  2P9S C;  4A08 B;  2B5L A;  4J0W A;  4UM8 A;  5AMS A;  3BG0 A;  4A2M A;  2E32 A;  4FK2 A;  4N14 A;  5CXB A;  4IT5 A;  1FS1 A;  4FA9 D;  4J2B A;  4KHN A;  3LZI A;  4DTO A;  4GGA A;  3N0E A;  1FPO A;  3GD1 I;  4G56 B;  3B7F A;  4FJI A;  4R7A B;  4NEN A;  4FJ5 A;  3KRX B;  3F3P A;  3IKO A;  2H14 A;  5M61 A;  2J57 G;  3MZK A;  2I3S A;  2AH0 A;  2XZG A;  5GXI A;  3C6N B;  1K32 A;  4QRJ A;  3AL8 A;  5CXC A;  2VZ1 A;  2GC7 A;  2HXC A;  2H68 A;  2H47 A;  3EI4 A;  5C2W B;  1H2Y A;  1GOT B;  2OVQ B;  4GQ2 P;  4BCD A;  3PXS D;  4PNK B;  3FRX A;  3VH0 A;  1FZ8 E;  2RCU A;  4AKG A;  4D6V A;  2QR5 A;  4LG8 A;  3MVD K;  2YB8 B;  1H2W A;  3QNO A;  3IVM A;  4J2A A;  3ZDZ A;  2TRC B;  1FZ9 E;  4A08 A;  5HE1 B;  3E0C A;  3JB9 L;  5H37 A;  3SLE D;  5M5V A;  4AKH A;  2W18 A;  5CYK B;  4CY5 A;  1FZ6 E;  4G1M A;  4BCC A;  2P9U C;  4UM9 A;  4CI2 A;  2XYI A;  4NAA A;  3HL8 A;  4PC0 A;  2HES X;  3RMC A;  2Z2P A;  5IT9 g;  2BKL A;  4GGD A;  5E6S A;  3NGI A;  3CFP A;  2AH1 A;  4G1E A;  4JT6 C;  3C94 A;  3TJY A;  1XVC E;  3C9C A;  5FXY A;  4NBM A;  1QFS A;  1XVD E;  4FJH A;  3JRP A;  4JXM A;  5HYN B;  2MZW B;  3TL8 B;  3MMY A;  1U2V C;  3UVL A;  2MW2 A;  3I89 A;  3NE6 A;  3J81 g;  3QEW A;  3NIF A;  4AN0 A;  5E6U A;  4GM9 A;  4DTJ A;  3ZWL B;  4EYW A;  1Q9X A;  4L3G D;  3QER A;  4D9S A;  4RE6 A;  2B5N A;  2HU7 A;  1T2X A;  4CI8 A;  2PM9 A;  5EM2 A;  3SUQ A;  4JSX C;  3HGK E;  3K71 A;  2JPN A;  4WK2 A;  4FAN D;  3I7N A;  2HKM A;  1S4U X;  1H2X A;  4AOW A;  3OKY A;  4GZ8 A;  4FHL A;  4O3U B;  1MHZ G;  4J73 A;  2PFT A;  2VDN A;  4J8G A;  3NVN A;  3NDK A;  2QC5 A;  3TAF A;  5EML B;  1BPO A;  4L9O A;  3SUP A;  2DEB A;  3K2O A;  2CN2 A;  2I0R A;  2MMB A;  2VZ3 A;  4BCB A;  1VZ3 A;  3IIY A;  2IWK A;  2VDL A;  4J0X A;  2B1E A;  2VDM A;  2GC4 A;  1B9Y A;  5KDO B;  5EMK B;  2VIX A;  2B4E A;  2VDK A;  1E8M A;  2P1O B;  3KD5 E;  2GNQ A;  5C92 A;  5AJA A;  4JT5 C;  1PBY B;  3J80 g;  5HDB A;  4RG8 A;  3CIK B;  4CZY A;  4J2D A;  2B5M A;  4LG9 A;  3FGB A;  3I7K A;  3PXW D;  1XU5 E;  4DTX A;  4IRZ A;  2OZM A;  2IAA A;  4PSX B;  4FWW A;  1FYZ E;  2LF6 A;  1MG3 A;  4M3T A;  3DWL C;  3NVX A;  3MUN A;  5B4W A;  1H2Z A;  2HJB A;  1JOF A;  5FKS A;  3I7L A;  4J86 A;  3SHF A;  1XVF E;  1QNI A;  4QL1 A;  1NEX B;  3UVN A;  1OLZ A;  3RMA A;  4FJ9 A;  1FZ2 E;  2CE9 A;  3SN6 B;  4QND A;  2AGL A;  3EI4 B;  1ERJ A;  5IBK B;  4ICG C;  4QT8 A;  3UKR C;  2EIE A;  5TEE A;  3EQ7 A;  3OL2 A;  2VDQ A;  4DU1 A;  1E8N A;  2AGX A;  2P9K C;  4DU3 A;  3MXX A;  3T3M A;  4RL5 A;  3HP9 A;  3K72 A;  4M45 A;  4DNU A;  3JAM g;  2XDW A;  1OMW B;  3N0D A;  5H14 A;  4FJ8 A;  2BCJ B;  3TAB A;  1GOH A;  5IRE A;  2DY4 A;  2PM6 B;  3L4O D;  4FJM A;  5HE2 B;  5EM2 B;  3SCX A;  5M5T A;  4QNC A;  4KHU A;  2HD0 A;  5IJ8 E;  3V7D B;  4EWR A;  2YNP A;  5FLX g;  4X5M A;  1JMX B;  1TYE A;  1UOQ A;  5EAP A;  3EU7 A;  4JSN C;  4WK4 A;  4NSX A;  4X61 B;  3WSO A;  4O3T B;  2CN3 A;  4B08 A;  5TEF A;  3ZDX A;  4AKI A;  3OGK B;  3C99 A;  4O45 A;  3UO3 A;  4I6J B;  3CFR A;  1Q47 A;  1Q9Y A;  3IJ0 A;  1XMH E;  2O9K A;  3RN1 D;  2CO0 C;  3MKQ A;  4GGC A;  3RLM D;  3C6O B;  1N6F A;  5I5I A;  2XL2 A;  4AN1 A;  4L1Q D;  1U8C A;  4J87 A;  5I5J A;  3MUO A;  3RFG A;  4PBZ A;  4OWR A;  1RI6 A;  5GXH A;  2I3T A;  3HFQ A;  4JSP C;  3RRM C;  2JHA A;  1GG2 B;  2H9M A;  4E54 B;  4I79 A;  3PSL A;  3QEI A;  1UOP A;  4KHS A;  3EQ9 A;  2UZX B;  5C86 A;  3SVW D;  1YR2 A;  5THA A;  3EG6 A;  2G9A A;  4YVD A;  1U4C A;  4A7J A;  3MZL A;  2P9L C;  3OW8 A;  1N1C A;  3F3G A;  4KFM B;  4DTN A;  3SUO A;  1PI6 A;  4WJK A;  4U7A A;  5M5R A;  3IJC A;  3RMD A;  4A09 B;  3OKT A;  2VDP A;  3DXK C;  4M3X A;  3L2O B;  3RMZ D;  4A0B A;  4JHP C;  3VA6 A;  2P1N B;  4HCB A;  4X3E A;  1O6F A;  3EWE A;  4DNW A;  3A0F A;  1GXR A;  3MKS B;  4ADO A;  3KRW B;  2B7M A;  1NR0 A;  4E5Z B;  3JRO A;  2P5O A;  3L1N A;  2DTU A;  1PEV A;  2P1P B;  1I2M B;  3F3F A;  3IIW A;  3O4H A;  4M3W A;  3S9H A;  2FW3 A;  4PSW B;  3FM0 A;  5GMK n;  4WK0 A;  1XKS A;  4FJJ A;  3UKU C;  4FJN A;  1VE6 A;  4J79 A;  5IGO A;  4MMX A;  3O4J A;  1IH7 A;  1FZ1 E;  5TF2 A;  5AFU 3;  3DM0 A;  4D0K A;  5M5S A;  4MMZ A;  3GRE A;  1FZ0 E;  3BG1 A;  3UIQ A;  4J78 A;  2IUQ A;  4OZU A;  3QNN A;  4FK0 A;  3UO2 A;  3AFC A;  3QET A;  2HU5 A;  3NID A;  4ADN A;  3CFO A;  3ODT A;  3K27 A;  4JS4 A;  3OL2 B;  1MTY G;  4JHN A;  4BUJ C;  2LF3 A;  1WAJ A;  5K19 A;  3OGL B;  3E4W A;  1A12 A;  4E4B A;  5EMM B;  2J55 H;  1L0Q A;  2AQ5 A;  3TAE A;  3IJE A;  3PE7 A;  5M5U A;  3LZJ A;  1O6G A;  2Z2O A;  2BBK H;  4L1M A;  2QXF A;  2OYQ A;  4I9L A;  1N6E A;  2XU7 A;  5HE3 B;  3LDB A;  3EI1 A;  3FCS A;  1GOG A;  1TBG A;  5FFG A;  3SNN A;  3DDU A;  3QHY B;  3NAE A;  1PGU A;  3O4I A;  2P9P C;  2XL3 A;  3ZE1 A;  3ZE2 A;  3SBQ A;  3RFH A;  3I7P A;  1FZ3 E;  4A0A A;  3L0M A;  4O9D A;  1A0R B;  1XVE E;  4HCC A;  2EIC A;  5TDH B;  1FZH E;  2UZY B;  5FA5 B;  3VI3 A;  3I7H A;  1VYH C;  3IUJ A;  2PM7 B;  2OVP B;  4GM3 A;  1GOF A;  3RWU A;  3RN0 D;  4FJL A;  2P5G A;  3SXT D;  4JD2 C;  3UVO A;  5JWZ A;  3SFZ A;  4AI6 A;  4FJK A;  3V5W B;  4X63 B;  2OZS A;  4DTP A;  2P1Q B;  5C9Z B;  1GP2 B;  1VZ2 A;  3C75 H;  4M3R A;  1JW2 A;  1FWX A;  2QXV A;  4DTU A;  4U1E I;  3ZE0 A;  1YFQ A;  4H5I A;  1C9I A;  4QQE A;  4Z7Q A;  3EI1 B;  3QES A;  4DU4 A;  2IUV A;  4J77 A;  5CXB B;  2HKR A;  4LGN A;  4XYI A;  4DTR A;  3EQ8 A;  3J27 A;  3QEV A;  2JHP A;  4X5N A;  1XL3 C;  2H9N A;  2YB5 A;  2YMU A;  2J56 H;  3AH8 B;  3DXM C;  3NIG A;  4JS5 A;  4Y7R A;  4PBY A;  5HE0 B;  3UVM A;  2E31 A;  3L4M D;  1WAF A;  3JPX A;  2OVR B;  3K26 A;  4J81 A;  5C2V B;  4MMY A;  2HU8 A;  2YNN A;  1XMG E;  4M3U A;  2AGY A;  5K1C C;  4A0B B;  2AGZ A;  1QFM A;  4O02 A;  4A11 A;  1K3I A;  4CC9 A;  4HDJ A;  2JQT A;  2IUR A;  1XMF E;  4KI4 A;  4J8B A;  2IUP A;  3SQ4 A;  2YBA A;  3V4P A;  4KHY A;  4J84 A;  2OK6 A;  1XIP A;  2JKX A;  4M3Y A;  4GMB A;  3W15 A;  4Z7N A;  1FZ4 E;  3OF7 A;  4E5Z A;  3GFC A;  2JH8 A;  3OGM B;  5H17 A;  2EBS A;  3OTT A;  2MTA H;  4UI9 R;  1R5M A;  2H6K A;  4RE5 A;  5FFO A;  5FKR A;  3CQ8 A;  3E4Y A;  3V4V A;  3PXT D;  3V9F A;  4BP8 A;  4CY1 A;  4J82 A;  3ZDY A;  2VDR A;  5HQG A;  3BVO A;  2CE8 A;  4K3I D;  1XU3 E;  3J2P A;  1SQJ A;  2WQ8 A;  4L3H D;  4DTS A;  1XVG E;  1JTD B;  1B9X A;  1FZI E;  1MG2 A;  4AEZ A;  3KD1 E;  3SPY A;  3TAG A;  2IWF A;  3SQ1 A;  4A0A B;  1K8K C;  4O2W A;  2G99 A;  2I0T A;  3IUM A;  4I9Q A;  3SJJ A;  4KHQ A;  3I8C A;  4M42 A;  1MMO G;  3SBP A;  3SWS D;  3EI2 A;  3SBR A;  2H4T A;  2AGW A;  3SQ0 A;  4EP9 A;  2HJ4 A;  5E6R A;  4IMM A;  2EIB A;  4Z7O A;  4E54 A;  1FZ7 E;  4KI6 A;  2H9P A;  3HGL A;  4EPH A;  4FJ7 A;  1MDA H;  2H9L A;  4ZOZ A;  4BP9 A;  3IJ1 A;  4A2L A;  4FVM A;  1JMZ B;  4O1Q D;  3SJL D;  3P4F A;  5EAL A;  4CZV A;  3IUR A;  3DSM A;  2JHC A;  1XVB E;  4M3Z A;  1JJU B;  3UVK A;  4ZOX A;  5IJ7 E;  4GQB B;  2CNX A;  3SQ2 A;  4KHW A;  3I7O A;  4FAV D;  4GQ1 A;  4TZ4 A;  3IUN A;  2OJY A;  3K6S A;  1SQ9 A;  2K5S A;  3CFS B;  3GC3 B;  5EMJ B;  4JSV C;  3SCY A;  5CXC B;  4GM8 A;  5I5M A;  3LD8 A;  4GAM C;  3U4Y A;  2VJ4 A;  4A11 B;  2P9N C;  3SUN A;  3O4G A;  4RNG A;  3L8B A;  5FQD A; 
#chains in the Genus database with same CATH homology
 4Y5R D;  2I0S A;  3EI3 A;  3SVI A;  4E3S A;  3ULE C;  4K3J B;  5IGQ A;  4FB1 D;  4JRQ A;  3NHG A;  2H6Q A;  1XHM A;  1N6D A;  3I2N A;  2P1M B;  5GSA A;  1SHY B;  2Z2N A;  4BH6 A;  3SPZ A;  3EMH A;  3OKW A;  3VGZ A;  4FA1 D;  4ERZ A;  3C5M A;  2VJ5 A;  4M41 A;  4FJG A;  3ORV D;  3SI6 A;  3AL8 B;  2ATQ A;  4CY3 A;  5IZ7 A;  4ZOY A;  4ZN4 A;  3C6P B;  3UR4 A;  4JRP A;  4XEI C;  5IC7 A;  3BWS A;  2B8I A;  4CY2 A;  3EI2 B;  4PXW A;  3NCI A;  4ERY A;  4A09 A;  4ERQ A;  4BL0 A;  1P22 A;  3PVW B;  2FYO A;  2PM9 B;  3EI3 B;  4ESG A;  4ES0 A;  3QEX A;  4CZX A;  2OK4 A;  2PBI B;  5FKT A;  4ZOV A;  1MHY G;  4FJX A;  3NVQ A;  4CI1 A;  2YNO A;  2OIZ A;  5H1M A;  1FXX A;  2H3X A;  3OKY B;  4J2E A;  2JH9 A;  4FA4 D;  2HYE A;  3LDS A;  4X60 B;  2H6N A;  3AL9 A;  1LDK E;  3QEP A;  2Q7Q A;  3I8E A;  5CYK A;  3SMR A;  3PSC B;  4FK4 A;  4DTM A;  3CFV A;  2CO0 A;  5EAR A;  5SXM A;  5A2Q g;  3JZN A;  4FA5 D;  2PFV A;  4IA9 A;  1CLQ A;  3RMB A;  2H13 A;  3JZH A;  3PVU B;  4XYH A;  4MK0 B;  3C95 A;  1TYQ C;  4H5J A;  4Z8L A;  5FKQ A;  3RSE C;  1IG9 A;  4CI3 A;  3N1E A;  5EAM A;  2P9I C;  3JZG A;  1FZ5 E;  3N1B A;  2P9S C;  4A08 B;  2B5L A;  4J0W A;  4A2M A;  5AMS A;  3BG0 A;  2E32 A;  4FK2 A;  4N14 A;  5CXB A;  1FS1 A;  4FA9 D;  4J2B A;  4KHN A;  3LZI A;  4DTO A;  4GGA A;  3N0E A;  4G56 B;  3B7F A;  4FJI A;  4R7A B;  4FJ5 A;  3KRX B;  3F3P A;  3IKO A;  2H14 A;  2J57 G;  3MZK A;  2I3S A;  2AH0 A;  5GXI A;  3C6N B;  1K32 A;  4QRJ A;  3AL8 A;  5CXC A;  2GC7 A;  2HXC A;  2H68 A;  2H47 A;  3EI4 A;  5C2W B;  1GOT B;  2OVQ B;  4GQ2 P;  3PXS D;  4PNK B;  3FRX A;  3VH0 A;  1FZ8 E;  2RCU A;  4AKG A;  4D6V A;  4LG8 A;  2YB8 B;  3QNO A;  4J2A A;  2TRC B;  1FZ9 E;  4A08 A;  5HE1 B;  3E0C A;  3JB9 L;  5H37 A;  3SLE D;  4AKH A;  2W18 A;  5CYK B;  4CY5 A;  1FZ6 E;  2P9U C;  4CI2 A;  2XYI A;  3HL8 A;  4PC0 A;  2HES X;  3RMC A;  2Z2P A;  5IT9 g;  4GGD A;  3NGI A;  3CFP A;  2AH1 A;  4JT6 C;  3C94 A;  3TJY A;  1XVC E;  3C9C A;  5FXY A;  1XVD E;  4FJH A;  3JRP A;  4JXM A;  5HYN B;  2MZW B;  3TL8 B;  3MMY A;  1U2V C;  3UVL A;  3I89 A;  3NE6 A;  3J81 g;  3QEW A;  4GM9 A;  4DTJ A;  3ZWL B;  4EYW A;  1Q9X A;  4L3G D;  3QER A;  2B5N A;  4CI8 A;  2PM9 A;  5EM2 A;  3SUQ A;  4JSX C;  3HGK E;  2JPN A;  4FAN D;  3I7N A;  2HKM A;  1S4U X;  4AOW A;  3OKY A;  4GZ8 A;  4FHL A;  4O3U B;  1MHZ G;  4J73 A;  2PFT A;  4J8G A;  3NVN A;  3NDK A;  2QC5 A;  3TAF A;  5EML B;  4L9O A;  3SUP A;  2DEB A;  3K2O A;  2CN2 A;  2I0R A;  2MMB A;  3IIY A;  2IWK A;  4J0X A;  2B1E A;  2GC4 A;  1B9Y A;  5KDO B;  5EMK B;  2VIX A;  2B4E A;  2P1O B;  3KD5 E;  2GNQ A;  5AJA A;  4JT5 C;  1PBY B;  3J80 g;  4RG8 A;  3CIK B;  4CZY A;  4J2D A;  2B5M A;  4LG9 A;  3FGB A;  3I7K A;  3PXW D;  1XU5 E;  4DTX A;  2OZM A;  2IAA A;  4PSX B;  4FWW A;  1FYZ E;  2LF6 A;  1MG3 A;  4M3T A;  3DWL C;  3NVX A;  5B4W A;  2HJB A;  1JOF A;  5FKS A;  3I7L A;  4J86 A;  3SHF A;  1XVF E;  1QNI A;  4QL1 A;  1NEX B;  3UVN A;  1OLZ A;  2CE9 A;  3RMA A;  4FJ9 A;  1FZ2 E;  3SN6 B;  4QND A;  2AGL A;  3EI4 B;  1ERJ A;  5IBK B;  4QT8 A;  3UKR C;  5TEE A;  3OL2 A;  4DU1 A;  2AGX A;  2P9K C;  4DU3 A;  3MXX A;  4RL5 A;  3HP9 A;  4M45 A;  3JAM g;  5H14 A;  1OMW B;  3N0D A;  4FJ8 A;  2BCJ B;  3TAB A;  5IRE A;  2DY4 A;  2PM6 B;  3L4O D;  4FJM A;  5HE2 B;  5EM2 B;  3SCX A;  4QNC A;  4KHU A;  2HD0 A;  5IJ8 E;  3V7D B;  4EWR A;  2YNP A;  5FLX g;  4X5M A;  1JMX B;  5EAP A;  3EU7 A;  4JSN C;  4NSX A;  4X61 B;  3WSO A;  4O3T B;  2CN3 A;  4B08 A;  5TEF A;  4AKI A;  3OGK B;  3C99 A;  4O45 A;  4I6J B;  3CFR A;  1Q47 A;  1Q9Y A;  3IJ0 A;  1XMH E;  2O9K A;  3RN1 D;  2CO0 C;  3MKQ A;  4GGC A;  3RLM D;  3C6O B;  1N6F A;  5I5I A;  2XL2 A;  4L1Q D;  4J87 A;  5I5J A;  3RFG A;  4PBZ A;  4OWR A;  1RI6 A;  5GXH A;  2I3T A;  3HFQ A;  4JSP C;  3RRM C;  2JHA A;  1GG2 B;  2H9M A;  4E54 B;  4I79 A;  3PSL A;  3QEI A;  4KHS A;  2UZX B;  5THA A;  3EG6 A;  2G9A A;  4YVD A;  1U4C A;  4A7J A;  3MZL A;  2P9L C;  3OW8 A;  3F3G A;  4KFM B;  4DTN A;  3SUO A;  1PI6 A;  4U7A A;  3IJC A;  3RMD A;  4A09 B;  3OKT A;  3DXK C;  4M3X A;  3L2O B;  3RMZ D;  4A0B A;  3VA6 A;  2P1N B;  4HCB A;  4X3E A;  3EWE A;  3A0F A;  1GXR A;  3MKS B;  4ADO A;  3KRW B;  2B7M A;  1NR0 A;  4E5Z B;  3JRO A;  2P5O A;  3L1N A;  2DTU A;  1PEV A;  2P1P B;  3F3F A;  3IIW A;  4M3W A;  3S9H A;  2FW3 A;  4PSW B;  3FM0 A;  5GMK n;  1XKS A;  4FJJ A;  3UKU C;  4FJN A;  4J79 A;  5IGO A;  5TF2 A;  1IH7 A;  1FZ1 E;  5AFU 3;  3DM0 A;  4D0K A;  3GRE A;  1FZ0 E;  3BG1 A;  3UIQ A;  4J78 A;  2IUQ A;  4OZU A;  3QNN A;  4FK0 A;  3AFC A;  3ODT A;  3QET A;  4ADN A;  3CFO A;  3K27 A;  4JS4 A;  3OL2 B;  1MTY G;  4BUJ C;  2LF3 A;  1WAJ A;  5K19 A;  3OGL B;  3E4W A;  4E4B A;  5EMM B;  2J55 H;  1L0Q A;  2AQ5 A;  3TAE A;  3PE7 A;  3LZJ A;  2Z2O A;  2BBK H;  2QXF A;  2OYQ A;  4I9L A;  1N6E A;  2XU7 A;  5HE3 B;  3LDB A;  3EI1 A;  1TBG A;  3SNN A;  3NAE A;  1PGU A;  2P9P C;  2XL3 A;  3SBQ A;  3RFH A;  3I7P A;  1FZ3 E;  4A0A A;  3L0M A;  4O9D A;  1A0R B;  1XVE E;  4HCC A;  5TDH B;  1FZH E;  2UZY B;  5FA5 B;  3I7H A;  1VYH C;  2PM7 B;  2OVP B;  4GM3 A;  3RWU A;  3RN0 D;  4FJL A;  2P5G A;  3SXT D;  4JD2 C;  3UVO A;  5JWZ A;  3SFZ A;  4AI6 A;  4FJK A;  3V5W B;  4X63 B;  2OZS A;  4DTP A;  2P1Q B;  5C9Z B;  1GP2 B;  3C75 H;  4M3R A;  1FWX A;  2QXV A;  4U1E I;  4DTU A;  3SVW D;  1YFQ A;  4H5I A;  4QQE A;  3EI1 B;  3QES A;  4DU4 A;  2IUV A;  4J77 A;  5CXB B;  2HKR A;  4LGN A;  4XYI A;  4DTR A;  3J27 A;  3QEV A;  2JHP A;  4X5N A;  1XL3 C;  2H9N A;  2YB5 A;  2YMU A;  2J56 H;  3AH8 B;  3DXM C;  4Y7R A;  4JS5 A;  4PBY A;  5HE0 B;  3UVM A;  2E31 A;  3L4M D;  1WAF A;  3JPX A;  2OVR B;  3K26 A;  4J81 A;  5C2V B;  2YNN A;  1XMG E;  4M3U A;  2AGY A;  5K1C C;  4A0B B;  2AGZ A;  4A11 A;  4CC9 A;  4HDJ A;  2IUR A;  1XMF E;  4KI4 A;  4J8B A;  2IUP A;  3SQ4 A;  2YBA A;  4KHY A;  4J84 A;  2OK6 A;  1XIP A;  4M3Y A;  4GMB A;  3W15 A;  1FZ4 E;  4E5Z A;  3GFC A;  2JH8 A;  3OGM B;  5H17 A;  2EBS A;  3OTT A;  2MTA H;  4UI9 R;  1R5M A;  2H6K A;  5FKR A;  3V9F A;  3CQ8 A;  3E4Y A;  3PXT D;  4CY1 A;  4J82 A;  5HQG A;  2CE8 A;  4K3I D;  1XU3 E;  3J2P A;  1SQJ A;  4L3H D;  4DTS A;  1XVG E;  1B9X A;  1FZI E;  1MG2 A;  4AEZ A;  3KD1 E;  3SPY A;  3TAG A;  2IWF A;  3SQ1 A;  4A0A B;  1K8K C;  2G99 A;  2I0T A;  4I9Q A;  3SJJ A;  4KHQ A;  3I8C A;  4M42 A;  1MMO G;  3SBP A;  3SWS D;  3EI2 A;  3SBR A;  2H4T A;  2AGW A;  3SQ0 A;  4EP9 A;  2HJ4 A;  4IMM A;  4E54 A;  1FZ7 E;  4KI6 A;  2H9P A;  3HGL A;  4EPH A;  4FJ7 A;  2H9L A;  1MDA H;  4ZOZ A;  3IJ1 A;  4A2L A;  4FVM A;  1JMZ B;  4O1Q D;  3SJL D;  3P4F A;  5EAL A;  4CZV A;  3DSM A;  2JHC A;  1XVB E;  4M3Z A;  1JJU B;  3UVK A;  4ZOX A;  5IJ7 E;  4GQB B;  2CNX A;  3SQ2 A;  4KHW A;  3I7O A;  4FAV D;  4GQ1 A;  4TZ4 A;  2OJY A;  1SQ9 A;  3CFS B;  5EMJ B;  4JSV C;  3SCY A;  5CXC B;  4GM8 A;  5I5M A;  3LD8 A;  4GAM C;  3U4Y A;  2VJ4 A;  4A11 B;  2P9N C;  3SUN A;  4RNG A;  3L8B A;  5FQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...