2OVQB

Structure of the skp1-fbw7-cyclinedegc complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
444
structure length
444
Chain Sequence
TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 126
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovqB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovqB02
4J79A 4A09B 2OJYA 3RN0D 2B5MA 3IJ1A 4J86A 3ZWLB 3UVOA 4GMBA 2CN2A 4JXMA 3K27A 4E54B 3V7DB 4O9DA 2EBSA 3RFHA 1VYHC 4CY3A 2I0SA 5IGQA 3I7LA 5IBKB 4JT5C 3ULEC 5GXHA 3AL8B 2P9LC 5CXBB 5TDHB 2BCJB 3RLMD 2P9SC 4BL0A 4QT8A 3C5MA 5GMKn 3BWSA 2H14A 3SMRA 3SBRA 4J0XA 2YNOA 3VH0A 1SQJA 3BG1A 5TEEA 1U2VC 4JSXC 5EAMA 3PSLA 1YFQA 1NR0A 4E5ZB 4CZVA 1FWXA 5EMMB 2IUVA 2PM9A 3SBQA 2B5LA 2GNQA 3EI1B 4CI1A 2I0TA 1JMZB 2Z2OA 2IAAA 1PEVA 4PSXB 4CY2A 3K26A 1JMXB 3FGBA 2H9LA 2AGLA 4J8GA 3F3GA 3RN1D 4Z8LA 2CNXA 2IURA 4LG9A 4J84A 4PNKB 5H17A 3RRMC 2P1NB 3I89A 3JB9L 3C6OB 4FHLA 4XYIA 3EU7A 3SHFA 5FKRA 3JAMg 2HKMA 2B5NA 4JSPC 2GC7A 2YNNA 3OTTA 5EAPA 4ERYA 1LDKE 5CXCA 1B9XA 2PM7B 4FA1D 3F3PA 4X63B 3J80g 2E31A 4HDJA 1RI6A 3C6PB 5HE3B 2OVQB 5JWZA 4A2MA 4PBZA 3SBPA 4NSXA 4FAVD 1GG2B 2I3SA 3AH8B 3PVUB 4H5JA 3N0DA 2Z2PA 3OGLB 4TZ4A 4ERQA 4PXWA 5HQGA 2Z2NA 4FA9D 3N0EA 4GGCA 2AH0A 4QQEA 4N14A 4IMMA 4QL1A 2AGYA 1L0QA 3SFZA 1Q47A 2MTAH 5CYKA 5FKQA 3EI3A 3OW8A 5FKTA 4A0AA 3SXTD 2AGXA 2H6NA 5EM2B 4FB1D 4GGDA 5I5JA 3GREA 1K8KC 5EMJB 1FS1A 1GXRA 2O9KA 2XYIA 3UKUC 2J55H 4PC0A 2IUPA 3IIWA 4MK0B 5HE0B 2CE8A 2P1QB 3I7OA 3UVLA 2P1OB 2HYEA 1MG2A 5FQDA 5C2WB 3EI2B 5B4WA 4FAND 3DXMC 4CI3A 3DM0A 3C99A 3IJCA 2BBKH 3DXKC 3PVWB 3EWEA 5THAA 2OIZA 1PBYB 3W15A 2P9PC 4GQ2P 4XYHA 3CIKB 3I2NA 5IT9g 1GP2B 3UVNA 4CI8A 2YNPA 4ZOVA 1SHYB 1XHMA 5IGOA 3OL2A 3PE7A 5K19A 1U4CA 2P9KC 4UI9R 4A09A 4LGNA 3SCYA 4I79A 2AGWA 4ERZA 4OWRA 3I7KA 1QNIA 4L3GD 4E54A 4A08A 3RFGA 5HYNB 3JZNA 3JPXA 4K3ID 4J8BA 3AL8A 4ESGA 4X61B 2PBIB 4YVDA 3OKTA 2H68A 3JRPA 4PBYA 2AQ5A 3I7PA 3A0FA 4FA4D 3EG6A 4R7AB 2UZYB 3E0CA 2GC4A 1B9YA 3CFSB 4JSNC 4GM8A 4E5ZA 5K1CC 2CO0A 2HJ4A 5GSAA 4A0BB 2HXCA 5AJAA 4CI2A 4Y7RA 3UVMA 1XIPA 4JSVC 3I8EA 2G9AA 3FM0A 2CE9A 1JOFA 1PGUA 1R5MA 3F3FA 2TRCB 3FRXA 3NVNA 5FLXg 4L9OA 4KFMB 3OGMB 3C6NB 2XU7A 3AL9A 2IWKA 5AFU3 4A11A 2P1PB 2UZXB 2HJBA 4J77A 2G99A 2IUQA 5C9ZB 3BG0A 5H1MA 3DSMA 4ZOZA 4CY1A 1XKSA 3L4OD 3SLED 2Q7QA 5EARA 3KRXB 3EI4A 3DWLC 1MG3A 2H13A 3MZLA 4A0AB 4ES0A 3GFCA 4J78A 4EWRA 5EMKB 4D0KA 3IKOA 2P9IC 3OKYA 3PXWD 2I0RA 2YB8B 3C75H 5FKSA 2YMUA 1TYQC 1ERJA 1A0RB 3SWSD 4OZUA 4O3UB 1GOTB 3UVKA 3J81g 4JT6C 5AMSA 4LG8A 4L3HD 1MDAH 4I6JB 1S4UX 2OK6A 3RMZD 2H9MA 5I5MA 3ODTA 1N6FA 3EMHA 3ORVD 2P9UC 4ZOYA 3OL2B 2XL2A 2OK4A 4U7AA 3RSEC 3B7FA 1N6DA 1PI6A 3MXXA 2H3XA 5KDOB 5SXMA 4L1QD 1TBGA 4GQBB 2W18A 5EM2A 2PM9B 3MMYA 4K3JB 4AOWA 3SJLD 4X60B 4J0WA 4A2LA 4A08B 4FWWA 3WSOA 4GQ1A 4O45A 2HKRA 3UR4A 2J57G 4ZN4A 5A2Qg 3I7HA 3L2OB 2QXVA 3EI2A 3IIYA 3SVWD 2OVRB 4J81A 2H9NA 3VA6A 1N6EA 3MKSB 2XL3A 3HFQA 4O3TB 3MZKA 5TEFA 2H6QA 5CXBA 2P1MB 3CFVA 4A7JA 4CZXA 2H6KA 4U1EI 2H9PA 3AFCA 4IA9A 5I5IA 5CXCB 1OMWB 5FXYA 2I3TA 2CO0C 5EALA 3OKWA 4O1QD 3I8CA 4J82A 4ZOXA 3EI1A 4XEIC 4CZYA 4X3EA 4A11B 3V5WB 3OGKB 4GZ8A 5IJ8E 2H47A 3JZHA 4Y5RD 3PXSD 4PSWB 3SN6B 3KRWB 3EI4B 2J56H 4AEZA 1OLZA 2B4EA 2QC5A 3NVQA 5EMLB 3V9FA 4BUJC 3L4MD 3JROA 2AH1A 3PXTD 4GM9A 3OKYB 4J87A 4JD2C 4QRJA 4CY5A 5CYKB 4FA5D 3MKQA 5HE2B 3EI3B 4A0BA 5IJ7E 4GM3A 5TF2A 3VGZA 2YBAA 3UKRC 5C2VB 2IWFA 4G56B 2HESX 3P4FA 4J73A 1NEXB 4BH6A 2OVPB 5IC7A 1K32A 5FA5B 5GXIA 3IJ0A 2PM6B 3C9CA 3NVXA 1SQ9A 5HE1B 2AGZA 1JJUB 1P22A 3U4YA 3PSCB 4CC9A 4GGAA 2E32A 2CN3A 4H5IA 3JZGA 4D6VA 3I7NA 2P9NC 5H14A
chains in the Genus database with same CATH superfamily
4J79A 4A09B 4KHYA 2OJYA 3V4PA 3RN0D 4MMZA 2B5MA 3IJ1A 1XVGE 4FK4A 4J86A 2JHAA 3ZWLB 3NE6A 3UVOA 4GMBA 2CN2A 4JXMA 3K27A 2P5GA 2B1EA 2PFVA 1BPOA 4E54B 3V7DB 4WJKA 4O9DA 2EBSA 3RFHA 1VYHC 4JHPC 4CY3A 2I0SA 5IGQA 4FJ8A 3I7LA 5IBKB 1VZ2A 4JT5C 3ULEC 3AL8B 5GXHA 2P9LC 4KI4A 5CXBB 2VDLA 5TDHB 2BCJB 3RLMD 2P9SC 4BL0A 4QT8A 3C5MA 2JPNA 5GMKn 3BWSA 3NAEA 2H14A 2LF3A 3K2OA 1U8CA 1XVFE 3SMRA 3SBRA 4J0XA 2VDOA 4L1MA 2YNOA 2LF6A 3SPZA 3VH0A 1SQJA 3BG1A 3FCUA 5TEEA 3SUPA 1U2VC 4AX4A 4JSXC 5EAMA 3S9HA 4AKGA 1JTDB 3PSLA 1YFQA 1NR0A 4E5ZB 1XVDE 4AI6A 1FWXA 4CZVA 3GC3B 4NENA 5EMMB 4KHWA 2IUVA 4EYWA 4DTPA 1Q9XA 2PM9A 3SBQA 2B5LA 2GNQA 3EI1B 4CI1A 2I0TA 1JMZB 1I2MB 2Z2OA 2IAAA 1PEVA 4PSXB 4CY2A 3KD5E 1JMXB 3FGBA 3K26A 1GOFA 2H9LA 2AGLA 4J8GA 2EIBA 4DU3A 3F3GA 3RN1D 3HGKE 4Z8LA 1YR2A 4FJGA 2CNXA 3NCIA 2MZWB 2IURA 4LG9A 3UIQA 4J84A 3IUMA 3NDKA 4RG8A 4PNKB 5H17A 3RRMC 2P1NB 3I89A 3JB9L 3C6OB 4X5MA 4JRQA 1JW2A 2ATQA 4FHLA 3C94A 4XYIA 3EU7A 4EP9A 3SHFA 5FKRA 3JAMg 4ADOA 2HKMA 2B5NA 4JSPC 2GC7A 3O4HA 4AN1A 1FZ3E 4FJIA 4O02A 2RCUA 4FJLA 3QEVA 2YNNA 4EPHA 3OTTA 1XVBE 5EAPA 4DU4A 4BCBA 4ERYA 5M5TA 1LDKE 5CXCA 1B9XA 2PM7B 4FA1D 3F3PA 4X63B 3J80g 1C9LA 2E31A 2HD0A 3O4GA 4HDJA 1FZ8E 1XVEE 5E6SA 1RI6A 3IUNA 2HU7A 5M5RA 1E8NA 3C6PB 5HE3B 1FZ4E 2OVQB 5JWZA 3RMAA 4A2MA 4JS4A 4PBZA 3SBPA 4E4BA 4NSXA 4FK2A 1CLQA 4G1MA 4FAVD 1GG2B 1T2XA 2I3SA 4DTJA 2VDKA 3AH8B 4AN0A 3KCIA 3PVUB 4H5JA 3N0DA 2Z2PA 2EIEA 1MMOG 3MUOA 3OGLB 4TZ4A 4ERQA 2QZPA 4FJXA 1GOGA 4PXWA 5HQGA 1FZ0E 3NIGA 2Z2NA 4FA9D 4I9QA 3N0EA 4D9SA 3O4JA 1TYEA 4GGCA 2AH0A 4QQEA 4N14A 4IMMA 2XZGA 1MHZG 3IURA 4QL1A 2AGYA 1L0QA 3SFZA 1H2WA 1Q47A 2MTAH 1E5TA 5CYKA 5FKQA 3EI3A 2YB5A 3TJYA 3OW8A 5FKTA 4A0AA 3SXTD 2EIDA 2AGXA 2H6NA 5EM2B 4FJ5A 3NIDA 5E6RA 3VI3A 4FB1D 4GAMC 4GGDA 5I5JA 3GREA 1K8KC 5EMJB 3VI4A 1FS1A 1GXRA 4KHUA 4FJ7A 2O9KA 2XYIA 3UKUC 2J55H 4PC0A 2IUPA 3IIWA 4MK0B 5HE0B 2CE8A 3MVDK 2P1QB 3IJEA 3I7OA 3UVLA 2P1OB 3TAGA 1MG2A 5FQDA 3ZE0A 2HYEA 3CFRA 4UM8A 5C2WB 3EI2B 3RWUA 5B4WA 4FJHA 2VZ1A 3DXMC 4FAND 4CI3A 3DM0A 3C99A 3CFPA 3IJCA 2BBKH 3DXKC 3PVWB 3EWEA 5THAA 2OIZA 1PBYB 3W15A 2P9PC 3QEIA 4GQ2P 2JH9A 4XYHA 3CIKB 3I2NA 5IT9g 4I9LA 1GP2B 3UVNA 4CI8A 1FXXA 2QXFA 2YNPA 4ZOVA 1SHYB 4BP8A 4JS5A 1XHMA 5IGOA 3OL2A 3LZJA 1VE6A 3PE7A 5K19A 1U4CA 2P9KC 3TABA 1FZHE 1QFMA 4UI9R 3T3MA 4M41A 4A09A 5C92A 4LGNA 1FZ1E 3SCYA 1FZ7E 4I79A 3RMDA 2AGWA 2MMBA 2VJ4A 2VIXA 4OWRA 4ERZA 3I7KA 1QNIA 4WK2A 2OZSA 4L3GD 2XDWA 3RMBA 4IT5A 4E54A 4E3SA 4A08A 1UTCA 3RFGA 2VDQA 5HYNB 4RE6A 3JZNA 3CFOA 5M5UA 2QR5A 3DDUA 3QETA 3JPXA 5C86A 4K3ID 4KHSA 2HU8A 4J8BA 4J2EA 2VDNA 4RL5A 3AL8A 4ESGA 4X61B 3LDSA 2PBIB 4YVDA 4KI6A 3OKTA 4Z7QA 3LZIA 2H68A 3SUQA 3JRPA 2MW2A 1UOQA 4MMYA 4PBYA 4M42A 1WAFA 2AQ5A 4BCDA 4M3ZA 3I7PA 3A0FA 4FA4D 4IRZA 5M5SA 3EQ9A 2VDMA 3EG6A 4R7AB 2UZYB 3E0CA 3NGIA 2GC4A 1B9YA 4QAMA 3CFSB 1K3IA 4JSNC 4GM8A 1VZ3A 3T3PA 4E5ZA 2BKLA 5K1CC 2H4TA 2CO0A 4J2BA 2HJ4A 5GSAA 4A0BB 2HXCA 5AJAA 4CI2A 5M5VA 4Y7RA 4M3WA 3SQ1A 1XIPA 4JSVC 3UVMA 3I8EA 1MHYG 4B08A 2G9AA 1UOOA 4AMZA 4DNVA 3FM0A 1A12A 2CE9A 1JOFA 1PGUA 1R5MA 1FPOA 2RKHA 1FYZE 2HU5A 3SQ2A 2TRCB 3F3FA 3FRXA 4AKIA 3J2PA 1IH7A 3LDBA 3NVNA 4KFMB 4L9OA 3OGMB 3C6NB 2XU7A 2OYQA 3SUNA 3AL9A 3SCXA 3OF7A 5IZ7A 4O2WA 2IWKA 5AFU3 4A11A 2P1PB 2UZXB 4FJMA 4NBMA 2HJBA 4J77A 2G99A 1VE7A 4DNUA 2IUQA 5C9ZB 4DTXA 3BG0A 5H1MA 3DSMA 2FW3A 4J2DA 1XKSA 4QNCA 4ZOZA 4CY1A 3K71A 3L4OD 3SLED 2Q7QA 5EARA 3E4YA 3KRXB 3EI4A 3DWLC 1MG3A 3IVMA 3HGLA 2H13A 3MZLA 4A0AB 1FZ5E 4ES0A 3HL8A 3GFCA 4J78A 4EWRA 5EMKB 4D0KA 3L1NA 4ADNA 3MUNA 2DY4A 3IKOA 2P9IC 3OKYA 1MTYG 3HP9A 4DTOA 3TAEA 4KHNA 4FJKA 2I0RA 3SNNA 2YB8B 3PXWD 2VDPA 3FCSA 3C75H 3ZE1A 4G55A 5FKSA 2YMUA 2VDRA 1TYQC 1ERJA 1A0RB 3SWSD 2WQ8A 1XVCE 4OZUA 1QFSA 1GOTB 4O3UB 3UVKA 3J81g 4JT6C 3NIFA 5AMSA 2JKXA 4HCCA 3QESA 3QERA 4M3RA 4LG8A 1O6FA 4L3HD 1H2YA 1MDAH 4I6JB 1S4UX 4M3TA 2OK6A 3RMZD 2H9MA 1XU3E 4FJNA 2JHCA 4DNWA 3IUQA 5I5MA 1FZ6E 3ODTA 1N6FA 2B7MA 3EMHA 3ORVD 4Z7NA 1O6GA 2P9UC 4FVMA 4ZOYA 3V4VA 4M3UA 3OL2B 4MMXA 2DTUA 2OK4A 2XL2A 3L0MA 3EQ7A 3GD1I 4U7AA 3RSEC 3ZE2A 3B7FA 5E6UA 1N6DA 1PI6A 3C95A 2H3XA 3MXXA 3E4WA 4DTNA 5KDOB 5SXMA 4J2AA 4L1QD 1TBGA 4GQBB 2W18A 5EM2A 4DTSA 3TAFA 4FK0A 2PM9B 2EICA 3MMYA 4K3JB 4AOWA 5M61A 3SJLD 4X60B 4J0WA 4A2LA 3SI6A 4A08B 1WAJA 3K72A 4FWWA 3WSOA 4GQ1A 4O45A 2HKRA 3ZDYA 3SUOA 3L8BA 3UR4A 2J57G 4NAAA 4ZN4A 4RNGA 3CQ8A 1H2XA 4JRPA 5A2Qg 4UM9A 1E8MA 3I7HA 2FYOA 3SJJA 3L2OB 2QXVA 4M3YA 3O4IA 3EI2A 3QEWA 3IIYA 3SVWD 2K5SA 4BP9A 2OVRB 4J81A 3UO2A 2H9NA 3VA6A 1N6EA 3J27A 3MKSB 2XL3A 3HFQA 4O3TB 3MZKA 5TEFA 5FLXg 4HCBA 2H6QA 5CXBA 2P1MB 5IREA 3CFVA 1M1XA 4DTRA 4A7JA 4CZXA 2H6KA 4U1EI 2H9PA 3AFCA 3QNNA 4IA9A 5I5IA 5CXCB 5FFGA 3SPYA 1OMWB 5FXYA 2I3TA 3SQ0A 2CO0C 1C9IA 2P5OA 5EALA 1GOHA 3OKWA 4O1QD 3I8CA 4J82A 4G1EA 3QNOA 4ZOXA 3TL8B 3NHGA 4XEIC 3EI1A 4CZYA 4X3EA 2VJ5A 3KD1E 4ICGC 4DTUA 4A11B 3QHYB 3V5WB 1IG9A 3OGKB 1XMHE 2DEBA 4GZ8A 1XU5E 5FFOA 5IJ8E 2H47A 1FZIE 3JZHA 2OZMA 1XMFE 3PXSD 4Y5RD 4PSWB 3SN6B 3KRWB 3LD8A 3EI4B 2J56H 4AEZA 2JH8A 3N1BA 1OLZA 2B4EA 2QC5A 3NVQA 5EMLB 3V9FA 4BUJC 4X5NA 5H37A 3L4MD 4AMYA 3JROA 1FZ9E 2AH1A 3PXTD 4FJ9A 4GM9A 1N1CA 4M3XA 3OKYB 1UOPA 4J87A 4JHNA 4JD2C 1H2ZA 1FZ2E 4QRJA 4CY5A 3SQ4A 5CYKB 2VC2A 4FA5D 3MKQA 5HE2B 3EI3B 3QI0A 4A0BA 2JHPA 4Z7OA 5IJ7E 3IUJA 4GM3A 3ZDZA 5TF2A 3VGZA 3BVOA 1L5GA 3SVIA 2YBAA 5HDBA 3UKRC 1JV2A 5C2VB 2IWFA 4G56B 2PFTA 2JQTA 4M45A 2HESX 3P4FA 4J73A 1NEXB 4BH6A 3QEPA 4RE5A 2OVPB 5IC7A 4NC4A 4KHQA 1K32A 5FA5B 4BCCA 3IJ0A 5GXIA 2PM6B 3C9CA 3NVXA 3RMCA 4QNDA 1SQ9A 4WK4A 5HE1B 3QEXA 2AGZA 3N1EA 1JJUB 1P22A 3UO3A 1Q9YA 3EQ8A 3IULA 1XMGE 2B8IA 1XL3C 4AKHA 3U4YA 4DTMA 3ZDXA 2XE4A 2VZ3A 3PSCB 4WK0A 4CC9A 3K6SA 4GGAA 2E32A 2CN3A 4DU1A 4H5IA 4FJJA 3JZGA 4D6VA 3I7NA 2P9NC 5H14A
chains in the Genus database with same CATH topology
4J79A 4A09B 4KHYA 2OJYA 3RN0D 2B5MA 3IJ1A 1XVGE 4FK4A 4J86A 2JHAA 3ZWLB 3NE6A 3UVOA 4GMBA 2CN2A 4JXMA 3K27A 2P5GA 2B1EA 2PFVA 4E54B 3V7DB 4O9DA 2EBSA 3RFHA 1VYHC 4CY3A 2I0SA 5IGQA 4FJ8A 3I7LA 5IBKB 4JT5C 3ULEC 5GXHA 3AL8B 2P9LC 4KI4A 5CXBB 5TDHB 2BCJB 3RLMD 2P9SC 4BL0A 4QT8A 3C5MA 2JPNA 5GMKn 3BWSA 3NAEA 2H14A 2LF3A 3K2OA 1XVFE 3SMRA 3SBRA 4J0XA 2YNOA 2LF6A 3SPZA 3VH0A 1SQJA 3BG1A 5TEEA 3SUPA 1U2VC 4JSXC 5EAMA 3S9HA 4AKGA 3PSLA 1YFQA 1NR0A 4E5ZB 1XVDE 4AI6A 1FWXA 4CZVA 5EMMB 4KHWA 2IUVA 4EYWA 4DTPA 1Q9XA 2PM9A 3SBQA 2B5LA 2GNQA 3EI1B 4CI1A 2I0TA 1JMZB 2Z2OA 2IAAA 1PEVA 4PSXB 4CY2A 3KD5E 1JMXB 3FGBA 3K26A 2H9LA 2AGLA 4J8GA 4DU3A 3F3GA 3RN1D 3HGKE 4Z8LA 4FJGA 2CNXA 3NCIA 2MZWB 2IURA 4LG9A 3UIQA 4J84A 4PNKB 3NDKA 4RG8A 5H17A 3RRMC 2P1NB 3I89A 3JB9L 3C6OB 4X5MA 4JRQA 4FHLA 2ATQA 3C94A 4XYIA 3EU7A 4EP9A 3SHFA 5FKRA 3JAMg 4ADOA 2HKMA 2B5NA 4JSPC 2GC7A 1FZ3E 4FJIA 2RCUA 4FJLA 3QEVA 2YNNA 4EPHA 3OTTA 1XVBE 5EAPA 4DU4A 4ERYA 1LDKE 5CXCA 1B9XA 2PM7B 4FA1D 3F3PA 4X63B 3J80g 2E31A 2HD0A 4HDJA 1FZ8E 1XVEE 1RI6A 3C6PB 5HE3B 1FZ4E 2OVQB 5JWZA 3RMAA 4A2MA 4JS4A 4PBZA 3SBPA 4E4BA 4NSXA 4FK2A 1CLQA 4FAVD 1GG2B 2I3SA 4DTJA 3AH8B 3PVUB 4H5JA 3N0DA 2Z2PA 1MMOG 3OGLB 4TZ4A 4ERQA 4FJXA 4PXWA 5HQGA 1FZ0E 2Z2NA 4FA9D 4I9QA 3N0EA 4GGCA 2AH0A 4QQEA 4N14A 4IMMA 1MHZG 4QL1A 2AGYA 1L0QA 3SFZA 1Q47A 2MTAH 5CYKA 5FKQA 3EI3A 2YB5A 3TJYA 3OW8A 5FKTA 4A0AA 3SXTD 2AGXA 2H6NA 5EM2B 4FJ5A 4FB1D 4GAMC 4GGDA 5I5JA 3GREA 1K8KC 5EMJB 1FS1A 1GXRA 4KHUA 4FJ7A 2O9KA 2XYIA 3UKUC 2J55H 4PC0A 2IUPA 3IIWA 4MK0B 5HE0B 2CE8A 2P1QB 3I7OA 3UVLA 2P1OB 3TAGA 1MG2A 5FQDA 2HYEA 3CFRA 5C2WB 3EI2B 3RWUA 5B4WA 4FJHA 4FAND 3DXMC 4CI3A 3DM0A 3C99A 3CFPA 3IJCA 2BBKH 3DXKC 3PVWB 3EWEA 5THAA 2OIZA 1PBYB 3W15A 2P9PC 3QEIA 4GQ2P 2JH9A 4XYHA 3CIKB 3I2NA 5IT9g 4I9LA 1GP2B 3UVNA 4CI8A 1FXXA 2QXFA 2YNPA 4ZOVA 1SHYB 4JS5A 1XHMA 5IGOA 3OL2A 3LZJA 3PE7A 5K19A 1U4CA 2P9KC 3TABA 1FZHE 4UI9R 4M41A 4A09A 4LGNA 1FZ1E 3SCYA 1FZ7E 4I79A 3RMDA 2AGWA 2MMBA 2VJ4A 2VIXA 4OWRA 4ERZA 3I7KA 1QNIA 2OZSA 4L3GD 3RMBA 4E54A 4E3SA 4A08A 3RFGA 5HYNB 3JZNA 3CFOA 3QETA 3JPXA 4K3ID 4KHSA 4J8BA 4J2EA 4RL5A 3AL8A 4ESGA 4X61B 3LDSA 2PBIB 4YVDA 4KI6A 3OKTA 3LZIA 2H68A 3SUQA 3JRPA 4PBYA 4M42A 1WAFA 2AQ5A 4M3ZA 3I7PA 3A0FA 4FA4D 3EG6A 4R7AB 2UZYB 3E0CA 3NGIA 2GC4A 1B9YA 3CFSB 4JSNC 4GM8A 4E5ZA 5K1CC 2H4TA 2CO0A 4J2BA 2HJ4A 5GSAA 4A0BB 2HXCA 5AJAA 4CI2A 4Y7RA 4M3WA 3SQ1A 1XIPA 4JSVC 3UVMA 3I8EA 1MHYG 4B08A 2G9AA 3FM0A 2CE9A 1JOFA 1PGUA 1R5MA 1FYZE 3F3FA 3SQ2A 2TRCB 3FRXA 3NVNA 4AKIA 3J2PA 1IH7A 3LDBA 4KFMB 4L9OA 5FLXg 3OGMB 3C6NB 2XU7A 2OYQA 3SUNA 3AL9A 3SCXA 5IZ7A 2IWKA 5AFU3 4A11A 2P1PB 2UZXB 4FJMA 2HJBA 4J77A 2G99A 2IUQA 5C9ZB 4DTXA 3BG0A 5H1MA 3DSMA 2FW3A 4J2DA 1XKSA 4QNCA 4ZOZA 4CY1A 3L4OD 3SLED 2Q7QA 5EARA 3E4YA 3KRXB 3EI4A 3DWLC 1MG3A 3HGLA 2H13A 3MZLA 4A0AB 1FZ5E 4ES0A 3HL8A 3GFCA 4J78A 4EWRA 5EMKB 4D0KA 3L1NA 4ADNA 2DY4A 3IKOA 2P9IC 3OKYA 1MTYG 3HP9A 4DTOA 3TAEA 4KHNA 4FJKA 2I0RA 3SNNA 2YB8B 3PXWD 3C75H 5FKSA 2YMUA 1TYQC 1ERJA 1A0RB 3SWSD 1XVCE 4OZUA 4O3UB 1GOTB 3UVKA 3J81g 4JT6C 5AMSA 4HCCA 3QESA 3QERA 4M3RA 4LG8A 4L3HD 1MDAH 4I6JB 1S4UX 4M3TA 2OK6A 3RMZD 2H9MA 1XU3E 4FJNA 2JHCA 5I5MA 1FZ6E 3ODTA 1N6FA 2B7MA 3EMHA 3ORVD 2P9UC 4FVMA 4ZOYA 4M3UA 3OL2B 2DTUA 2OK4A 2XL2A 3L0MA 4U7AA 3RSEC 3B7FA 1N6DA 1PI6A 3C95A 2H3XA 3MXXA 3E4WA 4DTNA 5KDOB 5SXMA 4J2AA 4L1QD 1TBGA 4GQBB 2W18A 5EM2A 4DTSA 3TAFA 4FK0A 2PM9B 3MMYA 4K3JB 4AOWA 3SJLD 4X60B 4J0WA 4A2LA 3SI6A 4A08B 1WAJA 4FWWA 3WSOA 4GQ1A 4O45A 2HKRA 3SUOA 3L8BA 3UR4A 2J57G 4ZN4A 4RNGA 3CQ8A 4JRPA 5A2Qg 3I7HA 2FYOA 3SJJA 3L2OB 2QXVA 4M3YA 3EI2A 3QEWA 3IIYA 3SVWD 2OVRB 4J81A 2H9NA 3VA6A 1N6EA 3J27A 3MKSB 2XL3A 3HFQA 4O3TB 3MZKA 5TEFA 4HCBA 2H6QA 5CXBA 2P1MB 5IREA 3CFVA 4DTRA 4A7JA 4CZXA 2H6KA 4U1EI 2H9PA 3AFCA 3QNNA 4IA9A 5I5IA 5CXCB 3SPYA 1OMWB 5FXYA 2I3TA 3SQ0A 2CO0C 2P5OA 5EALA 3OKWA 4O1QD 3I8CA 4J82A 4ZOXA 3QNOA 3TL8B 3NHGA 4XEIC 3EI1A 4CZYA 4X3EA 2VJ5A 3KD1E 4DTUA 4A11B 3V5WB 1IG9A 3OGKB 1XMHE 2DEBA 4GZ8A 1XU5E 5IJ8E 2H47A 1FZIE 3JZHA 2OZMA 1XMFE 3PXSD 4Y5RD 4PSWB 3SN6B 3KRWB 3LD8A 3EI4B 2J56H 4AEZA 2JH8A 3N1BA 1OLZA 2B4EA 2QC5A 3NVQA 5EMLB 3V9FA 4BUJC 4X5NA 5H37A 3L4MD 3JROA 1FZ9E 2AH1A 3PXTD 4FJ9A 4GM9A 4M3XA 3OKYB 4J87A 4JD2C 1FZ2E 4QRJA 4CY5A 3SQ4A 5CYKB 4FA5D 3MKQA 5HE2B 3EI3B 4A0BA 2JHPA 5IJ7E 4GM3A 5TF2A 3VGZA 3SVIA 2YBAA 3UKRC 5C2VB 2IWFA 4G56B 2PFTA 2HESX 4M45A 3P4FA 4J73A 1NEXB 4BH6A 3QEPA 2OVPB 5IC7A 4KHQA 1K32A 5FA5B 5GXIA 3IJ0A 2PM6B 3C9CA 3NVXA 3RMCA 4QNDA 1SQ9A 5HE1B 3QEXA 2AGZA 3N1EA 1JJUB 1P22A 1Q9YA 1XMGE 2B8IA 1XL3C 4AKHA 3U4YA 4DTMA 3PSCB 4CC9A 4GGAA 2E32A 2CN3A 4DU1A 4H5IA 4FJJA 3JZGA 4D6VA 3I7NA 2P9NC 5H14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J79 A;  4A09 B;  2OJY A;  3RN0 D;  2B5M A;  3IJ1 A;  4J86 A;  3ZWL B;  3UVO A;  4GMB A;  2CN2 A;  4JXM A;  3K27 A;  4E54 B;  3V7D B;  4O9D A;  2EBS A;  3RFH A;  1VYH C;  4CY3 A;  2I0S A;  5IGQ A;  3I7L A;  5IBK B;  4JT5 C;  3ULE C;  5GXH A;  3AL8 B;  2P9L C;  5CXB B;  5TDH B;  2BCJ B;  3RLM D;  2P9S C;  4BL0 A;  4QT8 A;  3C5M A;  5GMK n;  3BWS A;  2H14 A;  3SMR A;  3SBR A;  4J0X A;  2YNO A;  3VH0 A;  1SQJ A;  3BG1 A;  5TEE A;  1U2V C;  4JSX C;  5EAM A;  3PSL A;  1YFQ A;  1NR0 A;  4E5Z B;  4CZV A;  1FWX A;  5EMM B;  2IUV A;  2PM9 A;  3SBQ A;  2B5L A;  2GNQ A;  3EI1 B;  4CI1 A;  2I0T A;  1JMZ B;  2Z2O A;  2IAA A;  1PEV A;  4PSX B;  4CY2 A;  3K26 A;  1JMX B;  3FGB A;  2H9L A;  2AGL A;  4J8G A;  3F3G A;  3RN1 D;  4Z8L A;  2CNX A;  2IUR A;  4LG9 A;  4J84 A;  4PNK B;  5H17 A;  3RRM C;  2P1N B;  3I89 A;  3JB9 L;  3C6O B;  4FHL A;  4XYI A;  3EU7 A;  3SHF A;  5FKR A;  3JAM g;  2HKM A;  2B5N A;  4JSP C;  2GC7 A;  2YNN A;  3OTT A;  5EAP A;  4ERY A;  1LDK E;  5CXC A;  1B9X A;  2PM7 B;  4FA1 D;  3F3P A;  4X63 B;  3J80 g;  2E31 A;  4HDJ A;  1RI6 A;  3C6P B;  5HE3 B;  2OVQ B;  5JWZ A;  4A2M A;  4PBZ A;  3SBP A;  4NSX A;  4FAV D;  1GG2 B;  2I3S A;  3AH8 B;  3PVU B;  4H5J A;  3N0D A;  2Z2P A;  3OGL B;  4TZ4 A;  4ERQ A;  4PXW A;  5HQG A;  2Z2N A;  4FA9 D;  3N0E A;  4GGC A;  2AH0 A;  4QQE A;  4N14 A;  4IMM A;  4QL1 A;  2AGY A;  1L0Q A;  3SFZ A;  1Q47 A;  2MTA H;  5CYK A;  5FKQ A;  3EI3 A;  3OW8 A;  5FKT A;  4A0A A;  3SXT D;  2AGX A;  2H6N A;  5EM2 B;  4FB1 D;  4GGD A;  5I5J A;  3GRE A;  1K8K C;  5EMJ B;  1FS1 A;  1GXR A;  2O9K A;  2XYI A;  3UKU C;  2J55 H;  4PC0 A;  2IUP A;  3IIW A;  4MK0 B;  5HE0 B;  2CE8 A;  2P1Q B;  3I7O A;  3UVL A;  2P1O B;  2HYE A;  1MG2 A;  5FQD A;  5C2W B;  3EI2 B;  5B4W A;  4FAN D;  3DXM C;  4CI3 A;  3DM0 A;  3C99 A;  3IJC A;  2BBK H;  3DXK C;  3PVW B;  3EWE A;  5THA A;  2OIZ A;  1PBY B;  3W15 A;  2P9P C;  4GQ2 P;  4XYH A;  3CIK B;  3I2N A;  5IT9 g;  1GP2 B;  3UVN A;  4CI8 A;  2YNP A;  4ZOV A;  1SHY B;  1XHM A;  5IGO A;  3OL2 A;  3PE7 A;  5K19 A;  1U4C A;  2P9K C;  4UI9 R;  4A09 A;  4LGN A;  3SCY A;  4I79 A;  2AGW A;  4ERZ A;  4OWR A;  3I7K A;  1QNI A;  4L3G D;  4E54 A;  4A08 A;  3RFG A;  5HYN B;  3JZN A;  3JPX A;  4K3I D;  4J8B A;  3AL8 A;  4ESG A;  4X61 B;  2PBI B;  4YVD A;  3OKT A;  2H68 A;  3JRP A;  4PBY A;  2AQ5 A;  3I7P A;  3A0F A;  4FA4 D;  3EG6 A;  4R7A B;  2UZY B;  3E0C A;  2GC4 A;  1B9Y A;  3CFS B;  4JSN C;  4GM8 A;  4E5Z A;  5K1C C;  2CO0 A;  2HJ4 A;  5GSA A;  4A0B B;  2HXC A;  5AJA A;  4CI2 A;  4Y7R A;  3UVM A;  1XIP A;  4JSV C;  3I8E A;  2G9A A;  3FM0 A;  2CE9 A;  1JOF A;  1PGU A;  1R5M A;  3F3F A;  2TRC B;  3FRX A;  3NVN A;  5FLX g;  4L9O A;  4KFM B;  3OGM B;  3C6N B;  2XU7 A;  3AL9 A;  2IWK A;  5AFU 3;  4A11 A;  2P1P B;  2UZX B;  2HJB A;  4J77 A;  2G99 A;  2IUQ A;  5C9Z B;  3BG0 A;  5H1M A;  3DSM A;  4ZOZ A;  4CY1 A;  1XKS A;  3L4O D;  3SLE D;  2Q7Q A;  5EAR A;  3KRX B;  3EI4 A;  3DWL C;  1MG3 A;  2H13 A;  3MZL A;  4A0A B;  4ES0 A;  3GFC A;  4J78 A;  4EWR A;  5EMK B;  4D0K A;  3IKO A;  2P9I C;  3OKY A;  3PXW D;  2I0R A;  2YB8 B;  3C75 H;  5FKS A;  2YMU A;  1TYQ C;  1ERJ A;  1A0R B;  3SWS D;  4OZU A;  4O3U B;  1GOT B;  3UVK A;  3J81 g;  4JT6 C;  5AMS A;  4LG8 A;  4L3H D;  1MDA H;  4I6J B;  1S4U X;  2OK6 A;  3RMZ D;  2H9M A;  5I5M A;  3ODT A;  1N6F A;  3EMH A;  3ORV D;  2P9U C;  4ZOY A;  3OL2 B;  2XL2 A;  2OK4 A;  4U7A A;  3RSE C;  3B7F A;  1N6D A;  1PI6 A;  3MXX A;  2H3X A;  5KDO B;  5SXM A;  4L1Q D;  1TBG A;  4GQB B;  2W18 A;  5EM2 A;  2PM9 B;  3MMY A;  4K3J B;  4AOW A;  3SJL D;  4X60 B;  4J0W A;  4A2L A;  4A08 B;  4FWW A;  3WSO A;  4GQ1 A;  4O45 A;  2HKR A;  3UR4 A;  2J57 G;  4ZN4 A;  5A2Q g;  3I7H A;  3L2O B;  2QXV A;  3EI2 A;  3IIY A;  3SVW D;  2OVR B;  4J81 A;  2H9N A;  3VA6 A;  1N6E A;  3MKS B;  2XL3 A;  3HFQ A;  4O3T B;  3MZK A;  5TEF A;  2H6Q A;  5CXB A;  2P1M B;  3CFV A;  4A7J A;  4CZX A;  2H6K A;  4U1E I;  2H9P A;  3AFC A;  4IA9 A;  5I5I A;  5CXC B;  1OMW B;  5FXY A;  2I3T A;  2CO0 C;  5EAL A;  3OKW A;  4O1Q D;  3I8C A;  4J82 A;  4ZOX A;  3EI1 A;  4XEI C;  4CZY A;  4X3E A;  4A11 B;  3V5W B;  3OGK B;  4GZ8 A;  5IJ8 E;  2H47 A;  3JZH A;  4Y5R D;  3PXS D;  4PSW B;  3SN6 B;  3KRW B;  3EI4 B;  2J56 H;  4AEZ A;  1OLZ A;  2B4E A;  2QC5 A;  3NVQ A;  5EML B;  3V9F A;  4BUJ C;  3L4M D;  3JRO A;  2AH1 A;  3PXT D;  4GM9 A;  3OKY B;  4J87 A;  4JD2 C;  4QRJ A;  4CY5 A;  5CYK B;  4FA5 D;  3MKQ A;  5HE2 B;  3EI3 B;  4A0B A;  5IJ7 E;  4GM3 A;  5TF2 A;  3VGZ A;  2YBA A;  3UKR C;  5C2V B;  2IWF A;  4G56 B;  2HES X;  3P4F A;  4J73 A;  1NEX B;  4BH6 A;  2OVP B;  5IC7 A;  1K32 A;  5FA5 B;  5GXI A;  3IJ0 A;  2PM6 B;  3C9C A;  3NVX A;  1SQ9 A;  5HE1 B;  2AGZ A;  1JJU B;  1P22 A;  3U4Y A;  3PSC B;  4CC9 A;  4GGA A;  2E32 A;  2CN3 A;  4H5I A;  3JZG A;  4D6V A;  3I7N A;  2P9N C;  5H14 A; 
#chains in the Genus database with same CATH topology
 4J79 A;  4A09 B;  4KHY A;  2OJY A;  3V4P A;  3RN0 D;  4MMZ A;  2B5M A;  3IJ1 A;  1XVG E;  4FK4 A;  4J86 A;  2JHA A;  3ZWL B;  3NE6 A;  3UVO A;  4GMB A;  2CN2 A;  4JXM A;  3K27 A;  2P5G A;  2B1E A;  2PFV A;  1BPO A;  4E54 B;  3V7D B;  4WJK A;  4O9D A;  2EBS A;  3RFH A;  1VYH C;  4JHP C;  4CY3 A;  2I0S A;  5IGQ A;  4FJ8 A;  3I7L A;  5IBK B;  1VZ2 A;  4JT5 C;  3ULE C;  3AL8 B;  5GXH A;  2P9L C;  4KI4 A;  5CXB B;  2VDL A;  5TDH B;  2BCJ B;  3RLM D;  2P9S C;  4BL0 A;  4QT8 A;  3C5M A;  2JPN A;  5GMK n;  3BWS A;  3NAE A;  2H14 A;  2LF3 A;  3K2O A;  1U8C A;  1XVF E;  3SMR A;  3SBR A;  4J0X A;  2VDO A;  4L1M A;  2YNO A;  2LF6 A;  3SPZ A;  3VH0 A;  1SQJ A;  3BG1 A;  3FCU A;  5TEE A;  3SUP A;  1U2V C;  4AX4 A;  4JSX C;  5EAM A;  3S9H A;  4AKG A;  1JTD B;  3PSL A;  1YFQ A;  1NR0 A;  4E5Z B;  1XVD E;  4AI6 A;  1FWX A;  4CZV A;  3GC3 B;  4NEN A;  5EMM B;  4KHW A;  2IUV A;  4EYW A;  4DTP A;  1Q9X A;  2PM9 A;  3SBQ A;  2B5L A;  2GNQ A;  3EI1 B;  4CI1 A;  2I0T A;  1JMZ B;  1I2M B;  2Z2O A;  2IAA A;  1PEV A;  4PSX B;  4CY2 A;  3KD5 E;  1JMX B;  3FGB A;  3K26 A;  1GOF A;  2H9L A;  2AGL A;  4J8G A;  2EIB A;  4DU3 A;  3F3G A;  3RN1 D;  3HGK E;  4Z8L A;  1YR2 A;  4FJG A;  2CNX A;  3NCI A;  2MZW B;  2IUR A;  4LG9 A;  3UIQ A;  4J84 A;  3IUM A;  3NDK A;  4RG8 A;  4PNK B;  5H17 A;  3RRM C;  2P1N B;  3I89 A;  3JB9 L;  3C6O B;  4X5M A;  4JRQ A;  1JW2 A;  2ATQ A;  4FHL A;  3C94 A;  4XYI A;  3EU7 A;  4EP9 A;  3SHF A;  5FKR A;  3JAM g;  4ADO A;  2HKM A;  2B5N A;  4JSP C;  2GC7 A;  3O4H A;  4AN1 A;  1FZ3 E;  4FJI A;  4O02 A;  2RCU A;  4FJL A;  3QEV A;  2YNN A;  4EPH A;  3OTT A;  1XVB E;  5EAP A;  4DU4 A;  4BCB A;  4ERY A;  5M5T A;  1LDK E;  5CXC A;  1B9X A;  2PM7 B;  4FA1 D;  3F3P A;  4X63 B;  3J80 g;  1C9L A;  2E31 A;  2HD0 A;  3O4G A;  4HDJ A;  1FZ8 E;  1XVE E;  5E6S A;  1RI6 A;  3IUN A;  2HU7 A;  5M5R A;  1E8N A;  3C6P B;  5HE3 B;  1FZ4 E;  2OVQ B;  5JWZ A;  3RMA A;  4A2M A;  4JS4 A;  4PBZ A;  3SBP A;  4E4B A;  4NSX A;  4FK2 A;  1CLQ A;  4G1M A;  4FAV D;  1GG2 B;  1T2X A;  2I3S A;  4DTJ A;  2VDK A;  3AH8 B;  4AN0 A;  3KCI A;  3PVU B;  4H5J A;  3N0D A;  2Z2P A;  2EIE A;  1MMO G;  3MUO A;  3OGL B;  4TZ4 A;  4ERQ A;  2QZP A;  4FJX A;  1GOG A;  4PXW A;  5HQG A;  1FZ0 E;  3NIG A;  2Z2N A;  4FA9 D;  4I9Q A;  3N0E A;  4D9S A;  3O4J A;  1TYE A;  4GGC A;  2AH0 A;  4QQE A;  4N14 A;  4IMM A;  2XZG A;  1MHZ G;  3IUR A;  4QL1 A;  2AGY A;  1L0Q A;  3SFZ A;  1H2W A;  1Q47 A;  2MTA H;  1E5T A;  5CYK A;  5FKQ A;  3EI3 A;  2YB5 A;  3TJY A;  3OW8 A;  5FKT A;  4A0A A;  3SXT D;  2EID A;  2AGX A;  2H6N A;  5EM2 B;  4FJ5 A;  3NID A;  5E6R A;  3VI3 A;  4FB1 D;  4GAM C;  4GGD A;  5I5J A;  3GRE A;  1K8K C;  5EMJ B;  3VI4 A;  1FS1 A;  1GXR A;  4KHU A;  4FJ7 A;  2O9K A;  2XYI A;  3UKU C;  2J55 H;  4PC0 A;  2IUP A;  3IIW A;  4MK0 B;  5HE0 B;  2CE8 A;  3MVD K;  2P1Q B;  3IJE A;  3I7O A;  3UVL A;  2P1O B;  3TAG A;  1MG2 A;  5FQD A;  3ZE0 A;  2HYE A;  3CFR A;  4UM8 A;  5C2W B;  3EI2 B;  3RWU A;  5B4W A;  4FJH A;  2VZ1 A;  3DXM C;  4FAN D;  4CI3 A;  3DM0 A;  3C99 A;  3CFP A;  3IJC A;  2BBK H;  3DXK C;  3PVW B;  3EWE A;  5THA A;  2OIZ A;  1PBY B;  3W15 A;  2P9P C;  3QEI A;  4GQ2 P;  2JH9 A;  4XYH A;  3CIK B;  3I2N A;  5IT9 g;  4I9L A;  1GP2 B;  3UVN A;  4CI8 A;  1FXX A;  2QXF A;  2YNP A;  4ZOV A;  1SHY B;  4BP8 A;  4JS5 A;  1XHM A;  5IGO A;  3OL2 A;  3LZJ A;  1VE6 A;  3PE7 A;  5K19 A;  1U4C A;  2P9K C;  3TAB A;  1FZH E;  1QFM A;  4UI9 R;  3T3M A;  4M41 A;  4A09 A;  5C92 A;  4LGN A;  1FZ1 E;  3SCY A;  1FZ7 E;  4I79 A;  3RMD A;  2AGW A;  2MMB A;  2VJ4 A;  2VIX A;  4OWR A;  4ERZ A;  3I7K A;  1QNI A;  4WK2 A;  2OZS A;  4L3G D;  2XDW A;  3RMB A;  4IT5 A;  4E54 A;  4E3S A;  4A08 A;  1UTC A;  3RFG A;  2VDQ A;  5HYN B;  4RE6 A;  3JZN A;  3CFO A;  5M5U A;  2QR5 A;  3DDU A;  3QET A;  3JPX A;  5C86 A;  4K3I D;  4KHS A;  2HU8 A;  4J8B A;  4J2E A;  2VDN A;  4RL5 A;  3AL8 A;  4ESG A;  4X61 B;  3LDS A;  2PBI B;  4YVD A;  4KI6 A;  3OKT A;  4Z7Q A;  3LZI A;  2H68 A;  3SUQ A;  3JRP A;  2MW2 A;  1UOQ A;  4MMY A;  4PBY A;  4M42 A;  1WAF A;  2AQ5 A;  4BCD A;  4M3Z A;  3I7P A;  3A0F A;  4FA4 D;  4IRZ A;  5M5S A;  3EQ9 A;  2VDM A;  3EG6 A;  4R7A B;  2UZY B;  3E0C A;  3NGI A;  2GC4 A;  1B9Y A;  4QAM A;  3CFS B;  1K3I A;  4JSN C;  4GM8 A;  1VZ3 A;  3T3P A;  4E5Z A;  2BKL A;  5K1C C;  2H4T A;  2CO0 A;  4J2B A;  2HJ4 A;  5GSA A;  4A0B B;  2HXC A;  5AJA A;  4CI2 A;  5M5V A;  4Y7R A;  4M3W A;  3SQ1 A;  1XIP A;  4JSV C;  3UVM A;  3I8E A;  1MHY G;  4B08 A;  2G9A A;  1UOO A;  4AMZ A;  4DNV A;  3FM0 A;  1A12 A;  2CE9 A;  1JOF A;  1PGU A;  1R5M A;  1FPO A;  2RKH A;  1FYZ E;  2HU5 A;  3SQ2 A;  2TRC B;  3F3F A;  3FRX A;  4AKI A;  3J2P A;  1IH7 A;  3LDB A;  3NVN A;  4KFM B;  4L9O A;  3OGM B;  3C6N B;  2XU7 A;  2OYQ A;  3SUN A;  3AL9 A;  3SCX A;  3OF7 A;  5IZ7 A;  4O2W A;  2IWK A;  5AFU 3;  4A11 A;  2P1P B;  2UZX B;  4FJM A;  4NBM A;  2HJB A;  4J77 A;  2G99 A;  1VE7 A;  4DNU A;  2IUQ A;  5C9Z B;  4DTX A;  3BG0 A;  5H1M A;  3DSM A;  2FW3 A;  4J2D A;  1XKS A;  4QNC A;  4ZOZ A;  4CY1 A;  3K71 A;  3L4O D;  3SLE D;  2Q7Q A;  5EAR A;  3E4Y A;  3KRX B;  3EI4 A;  3DWL C;  1MG3 A;  3IVM A;  3HGL A;  2H13 A;  3MZL A;  4A0A B;  1FZ5 E;  4ES0 A;  3HL8 A;  3GFC A;  4J78 A;  4EWR A;  5EMK B;  4D0K A;  3L1N A;  4ADN A;  3MUN A;  2DY4 A;  3IKO A;  2P9I C;  3OKY A;  1MTY G;  3HP9 A;  4DTO A;  3TAE A;  4KHN A;  4FJK A;  2I0R A;  3SNN A;  2YB8 B;  3PXW D;  2VDP A;  3FCS A;  3C75 H;  3ZE1 A;  4G55 A;  5FKS A;  2YMU A;  2VDR A;  1TYQ C;  1ERJ A;  1A0R B;  3SWS D;  2WQ8 A;  1XVC E;  4OZU A;  1QFS A;  1GOT B;  4O3U B;  3UVK A;  3J81 g;  4JT6 C;  3NIF A;  5AMS A;  2JKX A;  4HCC A;  3QES A;  3QER A;  4M3R A;  4LG8 A;  1O6F A;  4L3H D;  1H2Y A;  1MDA H;  4I6J B;  1S4U X;  4M3T A;  2OK6 A;  3RMZ D;  2H9M A;  1XU3 E;  4FJN A;  2JHC A;  4DNW A;  3IUQ A;  5I5M A;  1FZ6 E;  3ODT A;  1N6F A;  2B7M A;  3EMH A;  3ORV D;  4Z7N A;  1O6G A;  2P9U C;  4FVM A;  4ZOY A;  3V4V A;  4M3U A;  3OL2 B;  4MMX A;  2DTU A;  2OK4 A;  2XL2 A;  3L0M A;  3EQ7 A;  3GD1 I;  4U7A A;  3RSE C;  3ZE2 A;  3B7F A;  5E6U A;  1N6D A;  1PI6 A;  3C95 A;  2H3X A;  3MXX A;  3E4W A;  4DTN A;  5KDO B;  5SXM A;  4J2A A;  4L1Q D;  1TBG A;  4GQB B;  2W18 A;  5EM2 A;  4DTS A;  3TAF A;  4FK0 A;  2PM9 B;  2EIC A;  3MMY A;  4K3J B;  4AOW A;  5M61 A;  3SJL D;  4X60 B;  4J0W A;  4A2L A;  3SI6 A;  4A08 B;  1WAJ A;  3K72 A;  4FWW A;  3WSO A;  4GQ1 A;  4O45 A;  2HKR A;  3ZDY A;  3SUO A;  3L8B A;  3UR4 A;  2J57 G;  4NAA A;  4ZN4 A;  4RNG A;  3CQ8 A;  1H2X A;  4JRP A;  5A2Q g;  4UM9 A;  1E8M A;  3I7H A;  2FYO A;  3SJJ A;  3L2O B;  2QXV A;  4M3Y A;  3O4I A;  3EI2 A;  3QEW A;  3IIY A;  3SVW D;  2K5S A;  4BP9 A;  2OVR B;  4J81 A;  3UO2 A;  2H9N A;  3VA6 A;  1N6E A;  3J27 A;  3MKS B;  2XL3 A;  3HFQ A;  4O3T B;  3MZK A;  5TEF A;  5FLX g;  4HCB A;  2H6Q A;  5CXB A;  2P1M B;  5IRE A;  3CFV A;  1M1X A;  4DTR A;  4A7J A;  4CZX A;  2H6K A;  4U1E I;  2H9P A;  3AFC A;  3QNN A;  4IA9 A;  5I5I A;  5CXC B;  5FFG A;  3SPY A;  1OMW B;  5FXY A;  2I3T A;  3SQ0 A;  2CO0 C;  1C9I A;  2P5O A;  5EAL A;  1GOH A;  3OKW A;  4O1Q D;  3I8C A;  4J82 A;  4G1E A;  3QNO A;  4ZOX A;  3TL8 B;  3NHG A;  4XEI C;  3EI1 A;  4CZY A;  4X3E A;  2VJ5 A;  3KD1 E;  4ICG C;  4DTU A;  4A11 B;  3QHY B;  3V5W B;  1IG9 A;  3OGK B;  1XMH E;  2DEB A;  4GZ8 A;  1XU5 E;  5FFO A;  5IJ8 E;  2H47 A;  1FZI E;  3JZH A;  2OZM A;  1XMF E;  3PXS D;  4Y5R D;  4PSW B;  3SN6 B;  3KRW B;  3LD8 A;  3EI4 B;  2J56 H;  4AEZ A;  2JH8 A;  3N1B A;  1OLZ A;  2B4E A;  2QC5 A;  3NVQ A;  5EML B;  3V9F A;  4BUJ C;  4X5N A;  5H37 A;  3L4M D;  4AMY A;  3JRO A;  1FZ9 E;  2AH1 A;  3PXT D;  4FJ9 A;  4GM9 A;  1N1C A;  4M3X A;  3OKY B;  1UOP A;  4J87 A;  4JHN A;  4JD2 C;  1H2Z A;  1FZ2 E;  4QRJ A;  4CY5 A;  3SQ4 A;  5CYK B;  2VC2 A;  4FA5 D;  3MKQ A;  5HE2 B;  3EI3 B;  3QI0 A;  4A0B A;  2JHP A;  4Z7O A;  5IJ7 E;  3IUJ A;  4GM3 A;  3ZDZ A;  5TF2 A;  3VGZ A;  3BVO A;  1L5G A;  3SVI A;  2YBA A;  5HDB A;  3UKR C;  1JV2 A;  5C2V B;  2IWF A;  4G56 B;  2PFT A;  2JQT A;  4M45 A;  2HES X;  3P4F A;  4J73 A;  1NEX B;  4BH6 A;  3QEP A;  4RE5 A;  2OVP B;  5IC7 A;  4NC4 A;  4KHQ A;  1K32 A;  5FA5 B;  4BCC A;  3IJ0 A;  5GXI A;  2PM6 B;  3C9C A;  3NVX A;  3RMC A;  4QND A;  1SQ9 A;  4WK4 A;  5HE1 B;  3QEX A;  2AGZ A;  3N1E A;  1JJU B;  1P22 A;  3UO3 A;  1Q9Y A;  3EQ8 A;  3IUL A;  1XMG E;  2B8I A;  1XL3 C;  4AKH A;  3U4Y A;  4DTM A;  3ZDX A;  2XE4 A;  2VZ3 A;  3PSC B;  4WK0 A;  4CC9 A;  3K6S A;  4GGA A;  2E32 A;  2CN3 A;  4DU1 A;  4H5I A;  4FJJ A;  3JZG A;  4D6V A;  3I7N A;  2P9N C;  5H14 A; 
#chains in the Genus database with same CATH homology
 4J79 A;  4A09 B;  4KHY A;  2OJY A;  3RN0 D;  2B5M A;  3IJ1 A;  1XVG E;  4FK4 A;  4J86 A;  2JHA A;  3ZWL B;  3NE6 A;  3UVO A;  4GMB A;  2CN2 A;  4JXM A;  3K27 A;  2P5G A;  2B1E A;  2PFV A;  4E54 B;  3V7D B;  4O9D A;  2EBS A;  3RFH A;  1VYH C;  4CY3 A;  2I0S A;  5IGQ A;  4FJ8 A;  3I7L A;  5IBK B;  4JT5 C;  3ULE C;  5GXH A;  3AL8 B;  2P9L C;  4KI4 A;  5CXB B;  5TDH B;  2BCJ B;  3RLM D;  2P9S C;  4BL0 A;  4QT8 A;  3C5M A;  2JPN A;  5GMK n;  3BWS A;  3NAE A;  2H14 A;  2LF3 A;  3K2O A;  1XVF E;  3SMR A;  3SBR A;  4J0X A;  2YNO A;  2LF6 A;  3SPZ A;  3VH0 A;  1SQJ A;  3BG1 A;  5TEE A;  3SUP A;  1U2V C;  4JSX C;  5EAM A;  3S9H A;  4AKG A;  3PSL A;  1YFQ A;  1NR0 A;  4E5Z B;  1XVD E;  4AI6 A;  1FWX A;  4CZV A;  5EMM B;  4KHW A;  2IUV A;  4EYW A;  4DTP A;  1Q9X A;  2PM9 A;  3SBQ A;  2B5L A;  2GNQ A;  3EI1 B;  4CI1 A;  2I0T A;  1JMZ B;  2Z2O A;  2IAA A;  1PEV A;  4PSX B;  4CY2 A;  3KD5 E;  1JMX B;  3FGB A;  3K26 A;  2H9L A;  2AGL A;  4J8G A;  4DU3 A;  3F3G A;  3RN1 D;  3HGK E;  4Z8L A;  4FJG A;  2CNX A;  3NCI A;  2MZW B;  2IUR A;  4LG9 A;  3UIQ A;  4J84 A;  4PNK B;  3NDK A;  4RG8 A;  5H17 A;  3RRM C;  2P1N B;  3I89 A;  3JB9 L;  3C6O B;  4X5M A;  4JRQ A;  4FHL A;  2ATQ A;  3C94 A;  4XYI A;  3EU7 A;  4EP9 A;  3SHF A;  5FKR A;  3JAM g;  4ADO A;  2HKM A;  2B5N A;  4JSP C;  2GC7 A;  1FZ3 E;  4FJI A;  2RCU A;  4FJL A;  3QEV A;  2YNN A;  4EPH A;  3OTT A;  1XVB E;  5EAP A;  4DU4 A;  4ERY A;  1LDK E;  5CXC A;  1B9X A;  2PM7 B;  4FA1 D;  3F3P A;  4X63 B;  3J80 g;  2E31 A;  2HD0 A;  4HDJ A;  1FZ8 E;  1XVE E;  1RI6 A;  3C6P B;  5HE3 B;  1FZ4 E;  2OVQ B;  5JWZ A;  3RMA A;  4A2M A;  4JS4 A;  4PBZ A;  3SBP A;  4E4B A;  4NSX A;  4FK2 A;  1CLQ A;  4FAV D;  1GG2 B;  2I3S A;  4DTJ A;  3AH8 B;  3PVU B;  4H5J A;  3N0D A;  2Z2P A;  1MMO G;  3OGL B;  4TZ4 A;  4ERQ A;  4FJX A;  4PXW A;  5HQG A;  1FZ0 E;  2Z2N A;  4FA9 D;  4I9Q A;  3N0E A;  4GGC A;  2AH0 A;  4QQE A;  4N14 A;  4IMM A;  1MHZ G;  4QL1 A;  2AGY A;  1L0Q A;  3SFZ A;  1Q47 A;  2MTA H;  5CYK A;  5FKQ A;  3EI3 A;  2YB5 A;  3TJY A;  3OW8 A;  5FKT A;  4A0A A;  3SXT D;  2AGX A;  2H6N A;  5EM2 B;  4FJ5 A;  4FB1 D;  4GAM C;  4GGD A;  5I5J A;  3GRE A;  1K8K C;  5EMJ B;  1FS1 A;  1GXR A;  4KHU A;  4FJ7 A;  2O9K A;  2XYI A;  3UKU C;  2J55 H;  4PC0 A;  2IUP A;  3IIW A;  4MK0 B;  5HE0 B;  2CE8 A;  2P1Q B;  3I7O A;  3UVL A;  2P1O B;  3TAG A;  1MG2 A;  5FQD A;  2HYE A;  3CFR A;  5C2W B;  3EI2 B;  3RWU A;  5B4W A;  4FJH A;  4FAN D;  3DXM C;  4CI3 A;  3DM0 A;  3C99 A;  3CFP A;  3IJC A;  2BBK H;  3DXK C;  3PVW B;  3EWE A;  5THA A;  2OIZ A;  1PBY B;  3W15 A;  2P9P C;  3QEI A;  4GQ2 P;  2JH9 A;  4XYH A;  3CIK B;  3I2N A;  5IT9 g;  4I9L A;  1GP2 B;  3UVN A;  4CI8 A;  1FXX A;  2QXF A;  2YNP A;  4ZOV A;  1SHY B;  4JS5 A;  1XHM A;  5IGO A;  3OL2 A;  3LZJ A;  3PE7 A;  5K19 A;  1U4C A;  2P9K C;  3TAB A;  1FZH E;  4UI9 R;  4M41 A;  4A09 A;  4LGN A;  1FZ1 E;  3SCY A;  1FZ7 E;  4I79 A;  3RMD A;  2AGW A;  2MMB A;  2VJ4 A;  2VIX A;  4OWR A;  4ERZ A;  3I7K A;  1QNI A;  2OZS A;  4L3G D;  3RMB A;  4E54 A;  4E3S A;  4A08 A;  3RFG A;  5HYN B;  3JZN A;  3CFO A;  3QET A;  3JPX A;  4K3I D;  4KHS A;  4J8B A;  4J2E A;  4RL5 A;  3AL8 A;  4ESG A;  4X61 B;  3LDS A;  2PBI B;  4YVD A;  4KI6 A;  3OKT A;  3LZI A;  2H68 A;  3SUQ A;  3JRP A;  4PBY A;  4M42 A;  1WAF A;  2AQ5 A;  4M3Z A;  3I7P A;  3A0F A;  4FA4 D;  3EG6 A;  4R7A B;  2UZY B;  3E0C A;  3NGI A;  2GC4 A;  1B9Y A;  3CFS B;  4JSN C;  4GM8 A;  4E5Z A;  5K1C C;  2H4T A;  2CO0 A;  4J2B A;  2HJ4 A;  5GSA A;  4A0B B;  2HXC A;  5AJA A;  4CI2 A;  4Y7R A;  4M3W A;  3SQ1 A;  1XIP A;  4JSV C;  3UVM A;  3I8E A;  1MHY G;  4B08 A;  2G9A A;  3FM0 A;  2CE9 A;  1JOF A;  1PGU A;  1R5M A;  1FYZ E;  3F3F A;  3SQ2 A;  2TRC B;  3FRX A;  3NVN A;  4AKI A;  3J2P A;  1IH7 A;  3LDB A;  4KFM B;  4L9O A;  5FLX g;  3OGM B;  3C6N B;  2XU7 A;  2OYQ A;  3SUN A;  3AL9 A;  3SCX A;  5IZ7 A;  2IWK A;  5AFU 3;  4A11 A;  2P1P B;  2UZX B;  4FJM A;  2HJB A;  4J77 A;  2G99 A;  2IUQ A;  5C9Z B;  4DTX A;  3BG0 A;  5H1M A;  3DSM A;  2FW3 A;  4J2D A;  1XKS A;  4QNC A;  4ZOZ A;  4CY1 A;  3L4O D;  3SLE D;  2Q7Q A;  5EAR A;  3E4Y A;  3KRX B;  3EI4 A;  3DWL C;  1MG3 A;  3HGL A;  2H13 A;  3MZL A;  4A0A B;  1FZ5 E;  4ES0 A;  3HL8 A;  3GFC A;  4J78 A;  4EWR A;  5EMK B;  4D0K A;  3L1N A;  4ADN A;  2DY4 A;  3IKO A;  2P9I C;  3OKY A;  1MTY G;  3HP9 A;  4DTO A;  3TAE A;  4KHN A;  4FJK A;  2I0R A;  3SNN A;  2YB8 B;  3PXW D;  3C75 H;  5FKS A;  2YMU A;  1TYQ C;  1ERJ A;  1A0R B;  3SWS D;  1XVC E;  4OZU A;  4O3U B;  1GOT B;  3UVK A;  3J81 g;  4JT6 C;  5AMS A;  4HCC A;  3QES A;  3QER A;  4M3R A;  4LG8 A;  4L3H D;  1MDA H;  4I6J B;  1S4U X;  4M3T A;  2OK6 A;  3RMZ D;  2H9M A;  1XU3 E;  4FJN A;  2JHC A;  5I5M A;  1FZ6 E;  3ODT A;  1N6F A;  2B7M A;  3EMH A;  3ORV D;  2P9U C;  4FVM A;  4ZOY A;  4M3U A;  3OL2 B;  2DTU A;  2OK4 A;  2XL2 A;  3L0M A;  4U7A A;  3RSE C;  3B7F A;  1N6D A;  1PI6 A;  3C95 A;  2H3X A;  3MXX A;  3E4W A;  4DTN A;  5KDO B;  5SXM A;  4J2A A;  4L1Q D;  1TBG A;  4GQB B;  2W18 A;  5EM2 A;  4DTS A;  3TAF A;  4FK0 A;  2PM9 B;  3MMY A;  4K3J B;  4AOW A;  3SJL D;  4X60 B;  4J0W A;  4A2L A;  3SI6 A;  4A08 B;  1WAJ A;  4FWW A;  3WSO A;  4GQ1 A;  4O45 A;  2HKR A;  3SUO A;  3L8B A;  3UR4 A;  2J57 G;  4ZN4 A;  4RNG A;  3CQ8 A;  4JRP A;  5A2Q g;  3I7H A;  2FYO A;  3SJJ A;  3L2O B;  2QXV A;  4M3Y A;  3EI2 A;  3QEW A;  3IIY A;  3SVW D;  2OVR B;  4J81 A;  2H9N A;  3VA6 A;  1N6E A;  3J27 A;  3MKS B;  2XL3 A;  3HFQ A;  4O3T B;  3MZK A;  5TEF A;  4HCB A;  2H6Q A;  5CXB A;  2P1M B;  5IRE A;  3CFV A;  4DTR A;  4A7J A;  4CZX A;  2H6K A;  4U1E I;  2H9P A;  3AFC A;  3QNN A;  4IA9 A;  5I5I A;  5CXC B;  3SPY A;  1OMW B;  5FXY A;  2I3T A;  3SQ0 A;  2CO0 C;  2P5O A;  5EAL A;  3OKW A;  4O1Q D;  3I8C A;  4J82 A;  4ZOX A;  3QNO A;  3TL8 B;  3NHG A;  4XEI C;  3EI1 A;  4CZY A;  4X3E A;  2VJ5 A;  3KD1 E;  4DTU A;  4A11 B;  3V5W B;  1IG9 A;  3OGK B;  1XMH E;  2DEB A;  4GZ8 A;  1XU5 E;  5IJ8 E;  2H47 A;  1FZI E;  3JZH A;  2OZM A;  1XMF E;  3PXS D;  4Y5R D;  4PSW B;  3SN6 B;  3KRW B;  3LD8 A;  3EI4 B;  2J56 H;  4AEZ A;  2JH8 A;  3N1B A;  1OLZ A;  2B4E A;  2QC5 A;  3NVQ A;  5EML B;  3V9F A;  4BUJ C;  4X5N A;  5H37 A;  3L4M D;  3JRO A;  1FZ9 E;  2AH1 A;  3PXT D;  4FJ9 A;  4GM9 A;  4M3X A;  3OKY B;  4J87 A;  4JD2 C;  1FZ2 E;  4QRJ A;  4CY5 A;  3SQ4 A;  5CYK B;  4FA5 D;  3MKQ A;  5HE2 B;  3EI3 B;  4A0B A;  2JHP A;  5IJ7 E;  4GM3 A;  5TF2 A;  3VGZ A;  3SVI A;  2YBA A;  3UKR C;  5C2V B;  2IWF A;  4G56 B;  2PFT A;  2HES X;  4M45 A;  3P4F A;  4J73 A;  1NEX B;  4BH6 A;  3QEP A;  2OVP B;  5IC7 A;  4KHQ A;  1K32 A;  5FA5 B;  5GXI A;  3IJ0 A;  2PM6 B;  3C9C A;  3NVX A;  3RMC A;  4QND A;  1SQ9 A;  5HE1 B;  3QEX A;  2AGZ A;  3N1E A;  1JJU B;  1P22 A;  1Q9Y A;  1XMG E;  2B8I A;  1XL3 C;  4AKH A;  3U4Y A;  4DTM A;  3PSC B;  4CC9 A;  4GGA A;  2E32 A;  2CN3 A;  4DU1 A;  4H5I A;  4FJJ A;  3JZG A;  4D6V A;  3I7N A;  2P9N C;  5H14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...