2OVQB

Structure of the skp1-fbw7-cyclinedegc complex
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
444
structure length
444
Chain Sequence
b'TQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S-phase kinase-associated protein 1A
publication title Structure of a Fbw7-Skp1-Cyclin E Complex: Multisite-Phosphorylated Substrate Recognition by SCF Ubiquitin Ligases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/cell cycle
total genus 126
structure length 444
sequence length 444
ec nomenclature
pdb deposition date 2007-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
B PF12937 F-box-like F-box-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.50 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2ovqB01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ovqB02
1PI6A 4L9OA 2GC7A 5FKTA 3UVMA 4JSNC 4A09A 2OJYA 2HXCA 4OWRA 4O45A 4ERQA 5EARA 2IWKA 3C99A 2BCJB 1XKSA 3DM0A 4GZ8A 3OL2A 4J79A 4X60B 1XHMA 2OK4A 5FQDA 5B4WA 1LDKE 1S4UX 1N6EA 4J73A 3MKQA 4CZXA 5FLXg 2H9MA 1MG3A 2IWFA 1QNIA 4GGDA 3B7FA 2P1PB 5EMLB 3MKSB 2AQ5A 5AJAA 3MXXA 3I7OA 3N0EA 4Z8LA 3RN1D 3OGMB 3IJCA 4J84A 3C75H 4LGNA 3P4FA 4LG9A 4CZYA 2GNQA 2B5LA 2IUPA 3JAMg 4A09B 3OW8A 4PSWB 5EALA 3JROA 2I0SA 4GM8A 1JMZB 3OL2B 4BUJC 3PSCB 3CIKB 5IC7A 2H6KA 4CY1A 5KDOB 5H14A 3L4OD 4JSXC 2B5NA 4IMMA 3UVNA 5EMKB 2P9PC 3SBPA 3F3PA 4U7AA 3PSLA 2OVRB 2E31A 3VGZA 2OVPB 2XU7A 5EM2A 3I7LA 2O9KA 4E54A 2QXVA 2PM6B 3L2OB 3SXTD 2Z2PA 5EMJB 4ZOXA 5GXIA 3OGLB 2CO0A 3IIYA 1JOFA 3RRMC 2H47A 4ERZA 5HYNB 4CY3A 2PM9B 5TDHB 3OTTA 4EWRA 4CI3A 5C2WB 4XYIA 3DWLC 3EWEA 5CYKA 3SVWD 4R7AB 2H9LA 4ZOVA 3CFVA 4FA1D 3SN6B 4J8BA 2AGXA 4L3HD 4L3GD 3RFGA 4O1QD 2TRCB 2E32A 3W15A 3HFQA 2OIZA 4NSXA 4PBZA 4I79A 4I6JB 3BG0A 2XYIA 3EMHA 3UKRC 2H3XA 5TEEA 2W18A 4CY2A 4J8GA 3RSEC 2AGWA 5HE3B 1ERJA 4E54B 4PC0A 3FM0A 3EI1A 3UVKA 3SBQA 4G56B 3K26A 3IJ1A 2QC5A 3IKOA 2HYEA 4X61B 3EI4A 3F3FA 3J81g 1TBGA 2YNPA 5IGQA 2I3SA 4L1QD 4GQ1A 2CN3A 5CXBA 2CNXA 3OKYA 5CYKB 4HDJA 3DXKC 5EAPA 2GC4A 3IIWA 3I7HA 1SQ9A 2AH1A 4A11B 2CN2A 1GG2B 4GM9A 4BL0A 1MG2A 2I0TA 5FXYA 5A2Qg 2IUQA 1P22A 3C6PB 2Q7QA 5SXMA 2AGLA 3AFCA 1K8KC 4Y7RA 3EI1B 5FKRA 2P1OB 3BWSA 5I5MA 2P1QB 3EG6A 2P9NC 3FGBA 4PNKB 2PM9A 4GGAA 2HKMA 4J0XA 1SQJA 4X63B 3SLED 4J78A 3PVUB 4CZVA 5CXCA 3EI4B 2H14A 5K1CC 3JZNA 5GMKn 3C9CA 5HQGA 5CXBB 1VYHC 5HE1B 3A0FA 2IAAA 3DSMA 2HKRA 3KRXB 4FWWA 4KFMB 3OKYB 3E0CA 2XL2A 1L0QA 4E5ZA 5AMSA 4JSPC 5H1MA 3F3GA 2P9IC 3EI2B 3AL8A 3FRXA 5H17A 3OGKB 4BH6A 4YVDA 2H68A 2HJBA 4J86A 4QRJA 1RI6A 3ORVD 3EU7A 2BBKH 4D6VA 2B5MA 3I7NA 1YFQA 1PGUA 3PXWD 2PBIB 2I0RA 3U4YA 4TZ4A 4O3UB 2YBAA 2P9UC 4JSVC 3MZLA 4FB1D 5CXCB 4ZOZA 3WSOA 1PEVA 2AGZA 4MK0B 3V7DB 5IJ7E 3RFHA 4H5IA 3UKUC 4GQ2P 4A11A 3SCYA 3SMRA 4CY5A 4PXWA 2UZXB 3I89A 2IURA 4XYHA 4U1EI 3JRPA 3SWSD 3JZHA 4A0BB 4AEZA 2P1NB 4E5ZB 4K3ID 3AL8B 4IA9A 3VH0A 4X3EA 4O3TB 3CFSB 4H5JA 1FWXA 4QT8A 4J77A 5TF2A 3V9FA 2CE9A 4CI1A 3SHFA 4OZUA 3OKWA 1Q47A 4QL1A 3MZKA 4K3JB 4A2MA 4FA5D 4GMBA 3RMZD 3PXSD 2YMUA 3I8CA 4FAND 3DXMC 5EAMA 4AOWA 4A08B 5HE2B 1U2VC 4CI8A 3SJLD 3J80g 1GP2B 4A0AB 1XIPA 4JT5C 2H9NA 4J0WA 5IT9g 3EI2A 5I5IA 2CE8A 2J57G 5AFU3 2P1MB 3K27A 2PM7B 1MDAH 4GQBB 2HESX 2YNNA 1TYQC 4ZN4A 2Z2OA 4LG8A 2OVQB 3NVXA 1JJUB 1NR0A 4J81A 3NVNA 2J56H 4O9DA 5C2VB 1B9XA 3IJ0A 4GM3A 3I2NA 5TEFA 3AL9A 2H6QA 2OK6A 3EI3A 3SBRA 2YNOA 3KRWB 5FA5B 4ES0A 4ESGA 3AH8B 4D0KA 5THAA 4GGCA 4CC9A 3PE7A 2P9LC 3I7KA 3PVWB 5IGOA 2J55H 2H9PA 4A0BA 1OMWB 1N6FA 3N0DA 1GXRA 5K19A 3ODTA 3V5WB 2UZYB 2Z2NA 1N6DA 3JZGA 4ERYA 1GOTB 2P9KC 4J87A 1PBYB 3ZWLB 3OKTA 2B4EA 4PBYA 2P9SC 3RLMD 3GFCA 5FKQA 4QQEA 4A08A 2G9AA 5HE0B 1SHYB 3I8EA 1R5MA 4N14A 3EI3B 4Y5RD 3PXTD 3BG1A 3NVQA 2HJ4A 5C9ZB 4ZOYA 1B9YA 4A0AA 4FHLA 4JXMA 4JT6C 4FAVD 3UVLA 2G99A 2EBSA 4CI2A 2CO0C 4PSXB 5GSAA 3C5MA 5EMMB 2AGYA 2AH0A 1U4CA 2I3TA 3UVOA 4A2LA 4FA4D 2H6NA 4A7JA 5I5JA 1K32A 3VA6A 3L4MD 5JWZA 3MMYA 5FKSA 3ULEC 1OLZA 3SFZA 4FA9D 1NEXB 3C6NB 5IBKB 3JB9L 5GXHA 1FS1A 1A0RB 1JMXB 3RN0D 2H13A 3GREA 5IJ8E 3JPXA 3UR4A 2XL3A 3I7PA 2YB8B 4XEIC 2IUVA 2MTAH 4UI9R 3C6OB 4JD2C 5EM2B 4J82A
chains in the Genus database with same CATH superfamily
3ZDYA 1PI6A 4L9OA 2GC7A 5FKTA 3UVMA 1XMFE 4JSNC 5M5UA 3LZIA 2OJYA 4A09A 2HXCA 4OWRA 4O45A 2YB5A 4ERQA 5EARA 1BPOA 2IWKA 3E4YA 2VDKA 4FJJA 2RCUA 3C99A 3CFRA 2BCJB 1XKSA 3DM0A 4GZ8A 4KHYA 2MW2A 3OL2A 1UOPA 3J27A 2JHAA 4J79A 4JHNA 1A12A 4X60B 1XHMA 2OK4A 2LF3A 5FQDA 5B4WA 1LDKE 3E4WA 1S4UX 2PFVA 1FZ6E 1N6EA 3IUJA 3MKQA 4J73A 4CZXA 5FLXg 2DTUA 4M3TA 1VE6A 2H9MA 1MG3A 1T2XA 2IWFA 4YVDA 1QNIA 4GGDA 3B7FA 2P1PB 2EIBA 4D9SA 5EMLB 3MKSB 2AQ5A 5AJAA 3MXXA 4J2BA 3O4HA 2JHCA 4Z7NA 3I7OA 3QEIA 3N0EA 4Z8LA 4NAAA 3RN1D 3OGMB 3IJCA 4J84A 3C75H 5E6UA 2XZGA 4LGNA 3P4FA 4UM9A 4DNWA 4JHPC 4LG9A 4CZYA 3DDUA 2GNQA 2B5LA 2IUPA 3JAMg 3MUOA 4A09B 3OW8A 4M41A 3HL8A 4PSWB 5EALA 1O6FA 3JROA 2I0SA 4DNUA 1XL3C 3QEXA 4GM8A 4BCBA 1JMZB 3QERA 1U8CA 3OL2B 1XU3E 4BUJC 3PSCB 3CIKB 5IC7A 4B08A 2H6KA 4CY1A 5KDOB 5H14A 3L4OD 4JSXC 3SPYA 2B5NA 1H2XA 4IMMA 3UVNA 5EMKB 3UO2A 2P9PC 3SBPA 3F3PA 4U7AA 4QNCA 3PSLA 2OVRB 2E31A 4DTSA 1I2MB 3VGZA 2OVPB 2XU7A 5EM2A 3I7LA 1JV2A 2O9KA 4E54A 2QXVA 2PM6B 4G1EA 3L2OB 4E3SA 3SXTD 1MHZG 3TL8B 2Z2PA 3N1BA 3V4PA 4M3RA 4ZOXA 5EMJB 5GXIA 3OGLB 2CO0A 3IIYA 3BVOA 3VI4A 1JOFA 3K71A 1WAFA 3TAFA 4X5MA 3NAEA 3RMAA 3RRMC 2H47A 4NBMA 3SQ4A 1Q9XA 4ERZA 5HYNB 1M1XA 4CY3A 4G55A 4G1MA 2OYQA 2PM9B 1YR2A 3OTTA 4AKHA 1E5TA 3QEVA 5TDHB 4EWRA 5C2WB 4CI3A 4XYIA 2QXFA 3DWLC 3EWEA 5CYKA 1UOQA 3SVWD 4R7AB 2VDLA 3SUNA 4BP9A 2H9LA 2JH8A 4RNGA 2RKHA 4I9LA 4ZOVA 3CFVA 4FA1D 2P5OA 2ATQA 3MUNA 3SN6B 4J8BA 2AGXA 4L3HD 3KD5E 4L3GD 3RFGA 4O1QD 3C95A 3K2OA 2E32A 2TRCB 3HFQA 2OIZA 4NSXA 4PBZA 3W15A 4I79A 4I6JB 3BG0A 4FK2A 2XYIA 3EMHA 3UKRC 2H3XA 5TEEA 2W18A 1XVEE 4FJXA 4CY2A 4DNVA 4J8GA 2OZSA 4J2AA 3RSEC 2AGWA 4JS4A 5HE3B 4DTRA 1ERJA 4E54B 2JH9A 4PC0A 3FM0A 3EI1A 3UVKA 4DU3A 1O6GA 3OF7A 4G56B 1FZIE 3SBQA 3K26A 3CQ8A 2QC5A 3IJ1A 3IKOA 3L0MA 3RMBA 4NENA 3QHYB 4RE6A 4KHQA 3SNNA 4FK4A 3QESA 3SCXA 4X61B 2HYEA 3EI4A 1VE7A 2H4TA 3F3FA 3IJEA 3ZE0A 1TBGA 3J81g 4HCCA 2YNPA 5IGQA 2I3SA 4L1QD 4GQ1A 4M45A 2CN3A 5CXBA 3MVDK 5M5RA 2CNXA 3OKYA 4QAMA 4QNDA 5CYKB 4HCBA 4HDJA 2MZWB 4MMYA 3LDSA 3DXKC 5EAPA 2GC4A 3IIWA 3I7HA 1SQ9A 2AH1A 4A11B 1FZ9E 4DTMA 2CN2A 1GG2B 3NIFA 4GM9A 5FFGA 4BL0A 1FZHE 5M5VA 5M5SA 4AX4A 1GOFA 1MG2A 3O4IA 2I0TA 4O2WA 5FXYA 4KI6A 5A2Qg 4EP9A 2IUQA 1P22A 3C6PB 2Q7QA 3KD1E 5SXMA 3IUNA 1H2ZA 2AGLA 3AFCA 1K8KC 4Y7RA 3EI1B 5FKRA 4FJLA 5HDBA 5C86A 2P1OB 3BWSA 3NIGA 3NE6A 5I5MA 1VZ2A 3EQ7A 2P1QB 1IG9A 2JQTA 2P9NC 3EG6A 3FGBA 4PNKB 2PM9A 4GGAA 2HKMA 4J0XA 1SQJA 4X63B 3SVIA 1GOHA 3IUQA 3SLED 4J78A 3PVUB 4CZVA 5CXCA 4FJKA 3EI4B 2H14A 5K1CC 3JZNA 2MMBA 5GMKn 3QNNA 3C9CA 5HQGA 4FJHA 4M3ZA 5CXBB 1VYHC 4DU4A 5HE1B 3A0FA 2IAAA 3DSMA 2HKRA 3KRXB 4FWWA 4KFMB 3OKYB 3E0CA 1MTYG 4DU1A 2WQ8A 3QEPA 3LDBA 2XL2A 1FZ7E 3VI3A 1L0QA 4KI4A 1FZ3E 3O4JA 5AMSA 3V4VA 4E5ZA 4JSPC 3EQ9A 5H1MA 3F3GA 2P9IC 3EI2B 4IT5A 2VDMA 3RMDA 3AL8A 4J2DA 4KHSA 3FRXA 5H17A 3OGKB 3GC3B 4BH6A 4L1MA 2H68A 2HJBA 4J86A 5IZ7A 4NC4A 4QRJA 2HU7A 1RI6A 4AKGA 3ORVD 3EU7A 2BBKH 4DTUA 4D6VA 4MMZA 2B5MA 3I7NA 1YFQA 1PGUA 3S9HA 3PXWD 1N1CA 2VIXA 4KHNA 2PBIB 2QR5A 5E6RA 1FZ0E 2I0RA 3U4YA 4TZ4A 3SUOA 4FJMA 3IVMA 4O3UB 3QETA 5E6SA 2YBAA 3SUPA 4AN1A 4FJ9A 2P9UC 3ZDXA 2VJ5A 3IULA 4JSVC 3MZLA 4FB1D 2HD0A 4AKIA 4I9QA 2JPNA 4M42A 5CXCB 4ZOZA 3WSOA 1PEVA 2AGZA 4MK0B 3V7DB 3NCIA 5IJ7E 3RFHA 4H5IA 3UKUC 4GQ2P 4AN0A 1JTDB 4A11A 3SCYA 3GD1I 4WK4A 3SMRA 4CY5A 4PXWA 2UZXB 3I89A 3SI6A 2FW3A 4WK0A 2IURA 4X5NA 4XYHA 4AMZA 1XVGE 4U1EI 3IUMA 3JRPA 3SWSD 4M3YA 4RL5A 3K72A 3JZHA 4Z7OA 2VZ3A 4A0BB 4AEZA 2P1NB 4E5ZB 3O4GA 4K3ID 1C9IA 2VDNA 3QI0A 3AL8B 3HP9A 4IA9A 3VH0A 4EYWA 4X3EA 4DTOA 2K5SA 3LZJA 4O3TB 4AMYA 3CFSB 3RMCA 4H5JA 4Z7QA 1FWXA 5IREA 3NGIA 4M3UA 4QT8A 2DY4A 4J77A 5TF2A 3V9FA 2CE9A 4CI1A 3SHFA 4E4BA 3OKWA 4OZUA 1Q47A 4QL1A 3MZKA 2QZPA 1XMGE 4K3JB 4A2MA 4KHUA 2VC2A 4FA5D 1MHYG 4GMBA 3PXSD 3RMZD 2YMUA 4WJKA 4JRQA 3I8CA 3HGLA 4RE5A 3TJYA 4FAND 3RWUA 3UO3A 3UIQA 4FVMA 3NDKA 3DXMC 5EAMA 4AOWA 4A08B 5HE2B 1U2VC 4CI8A 3SJLD 3J80g 1GP2B 4KHWA 1FZ5E 3KCIA 4A0AB 1XIPA 5C92A 4JT5C 2H9NA 1UOOA 4J0WA 5IT9g 3EI2A 1FZ4E 2EIEA 2CE8A 2J57G 5AFU3 2P1MB 4GAMC 3K27A 5I5IA 2PM7B 1MDAH 1XVFE 4JRPA 1L5GA 1FZ8E 4GQBB 4DTXA 3SPZA 2HESX 4FJ5A 2VDRA 2YNNA 4BP8A 1TYQC 3ZE2A 1QFSA 4ZN4A 2Z2OA 4LG8A 2OVQB 1XVDE 2JKXA 2JHPA 1NR0A 1JJUB 3C94A 3NVXA 4J81A 5H37A 3NVNA 2J56H 2B8IA 3L8BA 4FK0A 1B9XA 3IJ0A 4O9DA 5C2VB 4GM3A 2PFTA 1E8NA 3I2NA 5TEFA 2B1EA 3AL9A 1C9LA 3EQ8A 2H6QA 2OK6A 3EI3A 1JW2A 5FFOA 3SBRA 2YNOA 3NIDA 3KRWB 5FA5B 4ES0A 4UM8A 3QNOA 4ESGA 3AH8B 5M61A 4D0KA 4ICGC 1Q9YA 1MMOG 5THAA 3SQ2A 4GGCA 3LD8A 2BKLA 4CC9A 2VDQA 4FJ8A 1VZ3A 1E8MA 3PE7A 4WK2A 1QFMA 2P9LC 3I7KA 4DTNA 1CLQA 3PVWB 2J55H 2H9PA 5IGOA 3ZDZA 4A0BA 1OMWB 5M5TA 1N6FA 3N0DA 1XVBE 1GXRA 5K19A 3ODTA 3V5WB 2P5GA 2UZYB 2Z2NA 4ADNA 1N6DA 2EIDA 2VDPA 3JZGA 4ERYA 1GOTB 2P9KC 4J87A 1PBYB 3FCSA 4JS5A 3TAEA 3N1EA 2OZMA 4J2EA 3T3MA 3ZWLB 3OKTA 4MMXA 1XMHE 2B4EA 3IURA 4PBYA 2P9SC 3RLMD 2XDWA 2DEBA 3GFCA 5FKQA 4QQEA 2VZ1A 4RG8A 1FXXA 2VDOA 4AI6A 3TABA 4FJNA 4M3XA 4DTJA 4A08A 2G9AA 5HE0B 1SHYB 3I8EA 1R5MA 4DTPA 4N14A 2HU8A 4EPHA 3EI3B 4Y5RD 3ZE1A 1UTCA 3PXTD 1WAJA 4ADOA 3L1NA 3BG1A 4BCCA 3NVQA 2HJ4A 5C9ZB 4ZOYA 4M3WA 1B9YA 4A0AA 4FHLA 4JXMA 4JT6C 4FAVD 3UVLA 2G99A 2EBSA 3FCUA 4CI2A 2CO0C 4PSXB 5GSAA 3C5MA 5EMMB 2AGYA 2AH0A 2LF6A 1U4CA 2I3TA 3UVOA 4A2LA 4FA4D 2H6NA 4A7JA 5I5JA 1K32A 1FZ1E 1IH7A 3VA6A 3L4MD 4J82A 2VJ4A 3SQ1A 2HU5A 5JWZA 3MMYA 5FKSA 1H2WA 3ULEC 1OLZA 3SFZA 3J2PA 4FA9D 4IRZA 1NEXB 3C6NB 5IBKB 3JB9L 4FJIA 3SUQA 1FZ2E 2FYOA 4BCDA 1FS1A 5GXHA 3SQ0A 1JMXB 1A0RB 3RN0D 3SJJA 3T3PA 4FJ7A 1XU5E 2H13A 1TYEA 3QEWA 3GREA 5IJ8E 2EICA 3JPXA 3UR4A 3K6SA 1H2YA 3CFOA 1FYZE 1GOGA 3TAGA 2XL3A 3I7PA 2YB8B 4XEIC 2IUVA 2MTAH 3NHGA 3C6OB 4FJGA 4O02A 4JD2C 1K3IA 4UI9R 2XE4A 3HGKE 1FPOA 5EM2B 3CFPA 2B7MA 1XVCE
chains in the Genus database with same CATH topology
1PI6A 4L9OA 2GC7A 5FKTA 3UVMA 1XMFE 4JSNC 4A09A 3LZIA 2OJYA 2HXCA 4OWRA 4O45A 2YB5A 4ERQA 5EARA 2IWKA 3E4YA 4FJJA 2RCUA 3C99A 3CFRA 2BCJB 1XKSA 3DM0A 4GZ8A 4KHYA 3OL2A 3J27A 2JHAA 4J79A 4X60B 1XHMA 2OK4A 2LF3A 5FQDA 5B4WA 1LDKE 3E4WA 1S4UX 2PFVA 1FZ6E 1N6EA 4J73A 3MKQA 4CZXA 5FLXg 2DTUA 4M3TA 2H9MA 1MG3A 2IWFA 1QNIA 4GGDA 3B7FA 2P1PB 5EMLB 3MKSB 2AQ5A 5AJAA 3MXXA 4J2BA 2JHCA 3I7OA 3QEIA 3N0EA 4Z8LA 3RN1D 3OGMB 3IJCA 4J84A 3C75H 4LGNA 3P4FA 4LG9A 4CZYA 2GNQA 2B5LA 2IUPA 3JAMg 4A09B 3OW8A 4M41A 3HL8A 4PSWB 5EALA 3JROA 2I0SA 1XL3C 3QEXA 4GM8A 1JMZB 3QERA 3OL2B 1XU3E 4BUJC 3PSCB 3CIKB 5IC7A 4B08A 2H6KA 4CY1A 5KDOB 5H14A 3L4OD 4JSXC 3SPYA 2B5NA 4IMMA 3UVNA 5EMKB 2P9PC 3SBPA 3F3PA 4U7AA 4QNCA 3PSLA 2OVRB 2E31A 4DTSA 3VGZA 2OVPB 2XU7A 5EM2A 3I7LA 2O9KA 4E54A 2QXVA 2PM6B 3L2OB 4E3SA 3SXTD 1MHZG 3TL8B 2Z2PA 3N1BA 4M3RA 4ZOXA 5EMJB 5GXIA 3OGLB 2CO0A 3IIYA 1JOFA 1WAFA 3TAFA 4X5MA 3NAEA 3RMAA 3RRMC 2H47A 3SQ4A 1Q9XA 4ERZA 5HYNB 4CY3A 2OYQA 2PM9B 5TDHB 3OTTA 4AKHA 4EWRA 3QEVA 4CI3A 5C2WB 4XYIA 2QXFA 3DWLC 3EWEA 5CYKA 3SVWD 4R7AB 3SUNA 2H9LA 2JH8A 4RNGA 4ZOVA 4I9LA 3CFVA 4FA1D 2P5OA 2ATQA 3SN6B 4J8BA 2AGXA 4L3HD 3KD5E 4L3GD 3RFGA 4O1QD 3C95A 3K2OA 2E32A 2TRCB 3HFQA 2OIZA 4NSXA 4PBZA 3W15A 4I79A 4I6JB 3BG0A 4FK2A 2XYIA 3EMHA 3UKRC 2H3XA 5TEEA 2W18A 1XVEE 4FJXA 4CY2A 4J8GA 2OZSA 4J2AA 3RSEC 2AGWA 4JS4A 5HE3B 4DTRA 1ERJA 4E54B 2JH9A 4PC0A 3FM0A 3EI1A 3UVKA 4DU3A 3SBQA 4G56B 1FZIE 3K26A 3CQ8A 2QC5A 3IJ1A 3IKOA 3L0MA 3RMBA 4KHQA 3SNNA 4FK4A 3QESA 3SCXA 4X61B 2HYEA 3EI4A 2H4TA 3F3FA 3J81g 1TBGA 4HCCA 2YNPA 5IGQA 2I3SA 4L1QD 4GQ1A 4M45A 2CN3A 5CXBA 2CNXA 3OKYA 4QNDA 5CYKB 4HCBA 4HDJA 2MZWB 3LDSA 3DXKC 5EAPA 2GC4A 3IIWA 3I7HA 1SQ9A 2AH1A 4A11B 1FZ9E 4DTMA 2CN2A 1GG2B 4GM9A 4BL0A 1FZHE 1MG2A 2I0TA 5FXYA 4KI6A 5A2Qg 4EP9A 2IUQA 1P22A 3C6PB 2Q7QA 3KD1E 5SXMA 2AGLA 3AFCA 1K8KC 4Y7RA 3EI1B 5FKRA 4FJLA 2P1OB 3BWSA 5I5MA 3NE6A 2P1QB 1IG9A 2P9NC 3EG6A 3FGBA 4PNKB 2PM9A 4GGAA 2HKMA 4J0XA 1SQJA 4X63B 3SVIA 3SLED 4J78A 3PVUB 4CZVA 5CXCA 4FJKA 3EI4B 2H14A 5K1CC 3JZNA 2MMBA 5GMKn 3QNNA 3C9CA 5HQGA 4FJHA 4M3ZA 5CXBB 1VYHC 4DU4A 5HE1B 3A0FA 2IAAA 3DSMA 2HKRA 3KRXB 4FWWA 4KFMB 3OKYB 3E0CA 1MTYG 4DU1A 3QEPA 3LDBA 2XL2A 1FZ7E 1L0QA 4KI4A 1FZ3E 5AMSA 4E5ZA 4JSPC 5H1MA 3F3GA 2P9IC 3EI2B 3AL8A 3RMDA 4J2DA 4KHSA 3FRXA 5H17A 3OGKB 4BH6A 4YVDA 2H68A 2HJBA 4J86A 5IZ7A 4QRJA 1RI6A 4AKGA 3ORVD 3EU7A 2BBKH 4DTUA 4D6VA 2B5MA 3I7NA 1YFQA 1PGUA 3S9HA 3PXWD 2VIXA 4KHNA 2PBIB 1FZ0E 2I0RA 3U4YA 4TZ4A 3SUOA 4FJMA 4O3UB 3QETA 2YBAA 3SUPA 4FJ9A 2P9UC 2VJ5A 4JSVC 3MZLA 4FB1D 2HD0A 4AKIA 4I9QA 2JPNA 4M42A 5CXCB 4ZOZA 3WSOA 1PEVA 2AGZA 4MK0B 3V7DB 3NCIA 5IJ7E 3RFHA 4H5IA 3UKUC 4GQ2P 4A11A 3SCYA 3SMRA 4CY5A 4PXWA 2UZXB 3I89A 3SI6A 2FW3A 2IURA 4X5NA 4XYHA 1XVGE 4U1EI 3JRPA 3SWSD 4M3YA 4RL5A 3JZHA 4A0BB 4AEZA 2P1NB 4E5ZB 4K3ID 3AL8B 3HP9A 4IA9A 3VH0A 4EYWA 4X3EA 4DTOA 3LZJA 4O3TB 3CFSB 3RMCA 4H5JA 1FWXA 5IREA 3NGIA 4M3UA 4QT8A 2DY4A 4J77A 5TF2A 3V9FA 2CE9A 4CI1A 3SHFA 4E4BA 3OKWA 4OZUA 1Q47A 4QL1A 3MZKA 1XMGE 4K3JB 4A2MA 4KHUA 4FA5D 1MHYG 4GMBA 3PXSD 3RMZD 2YMUA 4JRQA 3I8CA 3HGLA 3TJYA 4FAND 3RWUA 3UIQA 4FVMA 3NDKA 3DXMC 5EAMA 4AOWA 4A08B 5HE2B 1U2VC 4CI8A 3SJLD 3J80g 1GP2B 4KHWA 1FZ5E 4A0AB 1XIPA 4JT5C 2H9NA 4J0WA 5IT9g 3EI2A 1FZ4E 5I5IA 2CE8A 2J57G 5AFU3 2P1MB 4GAMC 3K27A 2PM7B 1MDAH 1XVFE 4JRPA 1FZ8E 4GQBB 4DTXA 3SPZA 2HESX 4FJ5A 2YNNA 1TYQC 4ZN4A 2Z2OA 4LG8A 2OVQB 1XVDE 2JHPA 1JJUB 1NR0A 3C94A 3NVXA 4J81A 5H37A 3NVNA 2J56H 2B8IA 3L8BA 4FK0A 1B9XA 3IJ0A 4O9DA 5C2VB 4GM3A 2PFTA 3I2NA 5TEFA 2B1EA 3AL9A 2H6QA 2OK6A 3EI3A 3SBRA 2YNOA 3KRWB 5FA5B 4ES0A 3QNOA 4ESGA 3AH8B 4D0KA 1Q9YA 5THAA 1MMOG 3SQ2A 4GGCA 3LD8A 4CC9A 4FJ8A 3PE7A 2P9LC 3I7KA 4DTNA 1CLQA 3PVWB 2J55H 2H9PA 5IGOA 4A0BA 1OMWB 1N6FA 3N0DA 1XVBE 1GXRA 5K19A 3ODTA 3V5WB 2P5GA 2UZYB 2Z2NA 4ADNA 1N6DA 3JZGA 4ERYA 1GOTB 2P9KC 4J87A 1PBYB 4JS5A 3TAEA 3N1EA 2OZMA 4J2EA 3ZWLB 3OKTA 1XMHE 2B4EA 4PBYA 2P9SC 3RLMD 2DEBA 3GFCA 5FKQA 4QQEA 4RG8A 1FXXA 4AI6A 3TABA 4FJNA 4M3XA 4DTJA 4A08A 2G9AA 5HE0B 1SHYB 3I8EA 1R5MA 4DTPA 4N14A 4EPHA 3EI3B 4Y5RD 3PXTD 1WAJA 4ADOA 3L1NA 3BG1A 3NVQA 2HJ4A 5C9ZB 4ZOYA 4M3WA 1B9YA 4A0AA 4FHLA 4JXMA 4JT6C 4FAVD 3UVLA 2G99A 2EBSA 4CI2A 2CO0C 4PSXB 5GSAA 3C5MA 5EMMB 2AGYA 2AH0A 2LF6A 1U4CA 2I3TA 3UVOA 4A2LA 4FA4D 2H6NA 4A7JA 5I5JA 1K32A 1FZ1E 1IH7A 3VA6A 3L4MD 4J82A 2VJ4A 3SQ1A 5JWZA 3MMYA 5FKSA 3ULEC 1OLZA 3SFZA 3J2PA 4FA9D 1NEXB 3C6NB 5IBKB 3JB9L 4FJIA 3SUQA 1FZ2E 2FYOA 5GXHA 1FS1A 3SQ0A 1JMXB 1A0RB 3RN0D 3SJJA 4FJ7A 1XU5E 2H13A 3GREA 3QEWA 5IJ8E 3JPXA 3UR4A 3CFOA 1FYZE 3TAGA 2XL3A 3I7PA 2YB8B 4XEIC 2IUVA 2MTAH 3NHGA 3C6OB 4FJGA 4UI9R 4JD2C 5EM2B 3HGKE 3CFPA 2B7MA 1XVCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI6 A;  4L9O A;  2GC7 A;  5FKT A;  3UVM A;  4JSN C;  4A09 A;  2OJY A;  2HXC A;  4OWR A;  4O45 A;  4ERQ A;  5EAR A;  2IWK A;  3C99 A;  2BCJ B;  1XKS A;  3DM0 A;  4GZ8 A;  3OL2 A;  4J79 A;  4X60 B;  1XHM A;  2OK4 A;  5FQD A;  5B4W A;  1LDK E;  1S4U X;  1N6E A;  4J73 A;  3MKQ A;  4CZX A;  5FLX g;  2H9M A;  1MG3 A;  2IWF A;  1QNI A;  4GGD A;  3B7F A;  2P1P B;  5EML B;  3MKS B;  2AQ5 A;  5AJA A;  3MXX A;  3I7O A;  3N0E A;  4Z8L A;  3RN1 D;  3OGM B;  3IJC A;  4J84 A;  3C75 H;  4LGN A;  3P4F A;  4LG9 A;  4CZY A;  2GNQ A;  2B5L A;  2IUP A;  3JAM g;  4A09 B;  3OW8 A;  4PSW B;  5EAL A;  3JRO A;  2I0S A;  4GM8 A;  1JMZ B;  3OL2 B;  4BUJ C;  3PSC B;  3CIK B;  5IC7 A;  2H6K A;  4CY1 A;  5KDO B;  5H14 A;  3L4O D;  4JSX C;  2B5N A;  4IMM A;  3UVN A;  5EMK B;  2P9P C;  3SBP A;  3F3P A;  4U7A A;  3PSL A;  2OVR B;  2E31 A;  3VGZ A;  2OVP B;  2XU7 A;  5EM2 A;  3I7L A;  2O9K A;  4E54 A;  2QXV A;  2PM6 B;  3L2O B;  3SXT D;  2Z2P A;  5EMJ B;  4ZOX A;  5GXI A;  3OGL B;  2CO0 A;  3IIY A;  1JOF A;  3RRM C;  2H47 A;  4ERZ A;  5HYN B;  4CY3 A;  2PM9 B;  5TDH B;  3OTT A;  4EWR A;  4CI3 A;  5C2W B;  4XYI A;  3DWL C;  3EWE A;  5CYK A;  3SVW D;  4R7A B;  2H9L A;  4ZOV A;  3CFV A;  4FA1 D;  3SN6 B;  4J8B A;  2AGX A;  4L3H D;  4L3G D;  3RFG A;  4O1Q D;  2TRC B;  2E32 A;  3W15 A;  3HFQ A;  2OIZ A;  4NSX A;  4PBZ A;  4I79 A;  4I6J B;  3BG0 A;  2XYI A;  3EMH A;  3UKR C;  2H3X A;  5TEE A;  2W18 A;  4CY2 A;  4J8G A;  3RSE C;  2AGW A;  5HE3 B;  1ERJ A;  4E54 B;  4PC0 A;  3FM0 A;  3EI1 A;  3UVK A;  3SBQ A;  4G56 B;  3K26 A;  3IJ1 A;  2QC5 A;  3IKO A;  2HYE A;  4X61 B;  3EI4 A;  3F3F A;  3J81 g;  1TBG A;  2YNP A;  5IGQ A;  2I3S A;  4L1Q D;  4GQ1 A;  2CN3 A;  5CXB A;  2CNX A;  3OKY A;  5CYK B;  4HDJ A;  3DXK C;  5EAP A;  2GC4 A;  3IIW A;  3I7H A;  1SQ9 A;  2AH1 A;  4A11 B;  2CN2 A;  1GG2 B;  4GM9 A;  4BL0 A;  1MG2 A;  2I0T A;  5FXY A;  5A2Q g;  2IUQ A;  1P22 A;  3C6P B;  2Q7Q A;  5SXM A;  2AGL A;  3AFC A;  1K8K C;  4Y7R A;  3EI1 B;  5FKR A;  2P1O B;  3BWS A;  5I5M A;  2P1Q B;  3EG6 A;  2P9N C;  3FGB A;  4PNK B;  2PM9 A;  4GGA A;  2HKM A;  4J0X A;  1SQJ A;  4X63 B;  3SLE D;  4J78 A;  3PVU B;  4CZV A;  5CXC A;  3EI4 B;  2H14 A;  5K1C C;  3JZN A;  5GMK n;  3C9C A;  5HQG A;  5CXB B;  1VYH C;  5HE1 B;  3A0F A;  2IAA A;  3DSM A;  2HKR A;  3KRX B;  4FWW A;  4KFM B;  3OKY B;  3E0C A;  2XL2 A;  1L0Q A;  4E5Z A;  5AMS A;  4JSP C;  5H1M A;  3F3G A;  2P9I C;  3EI2 B;  3AL8 A;  3FRX A;  5H17 A;  3OGK B;  4BH6 A;  4YVD A;  2H68 A;  2HJB A;  4J86 A;  4QRJ A;  1RI6 A;  3ORV D;  3EU7 A;  2BBK H;  4D6V A;  2B5M A;  3I7N A;  1YFQ A;  1PGU A;  3PXW D;  2PBI B;  2I0R A;  3U4Y A;  4TZ4 A;  4O3U B;  2YBA A;  2P9U C;  4JSV C;  3MZL A;  4FB1 D;  5CXC B;  4ZOZ A;  3WSO A;  1PEV A;  2AGZ A;  4MK0 B;  3V7D B;  5IJ7 E;  3RFH A;  4H5I A;  3UKU C;  4GQ2 P;  4A11 A;  3SCY A;  3SMR A;  4CY5 A;  4PXW A;  2UZX B;  3I89 A;  2IUR A;  4XYH A;  4U1E I;  3JRP A;  3SWS D;  3JZH A;  4A0B B;  4AEZ A;  2P1N B;  4E5Z B;  4K3I D;  3AL8 B;  4IA9 A;  3VH0 A;  4X3E A;  4O3T B;  3CFS B;  4H5J A;  1FWX A;  4QT8 A;  4J77 A;  5TF2 A;  3V9F A;  2CE9 A;  4CI1 A;  3SHF A;  4OZU A;  3OKW A;  1Q47 A;  4QL1 A;  3MZK A;  4K3J B;  4A2M A;  4FA5 D;  4GMB A;  3RMZ D;  3PXS D;  2YMU A;  3I8C A;  4FAN D;  3DXM C;  5EAM A;  4AOW A;  4A08 B;  5HE2 B;  1U2V C;  4CI8 A;  3SJL D;  3J80 g;  1GP2 B;  4A0A B;  1XIP A;  4JT5 C;  2H9N A;  4J0W A;  5IT9 g;  3EI2 A;  5I5I A;  2CE8 A;  2J57 G;  5AFU 3;  2P1M B;  3K27 A;  2PM7 B;  1MDA H;  4GQB B;  2HES X;  2YNN A;  1TYQ C;  4ZN4 A;  2Z2O A;  4LG8 A;  2OVQ B;  3NVX A;  1JJU B;  1NR0 A;  4J81 A;  3NVN A;  2J56 H;  4O9D A;  5C2V B;  1B9X A;  3IJ0 A;  4GM3 A;  3I2N A;  5TEF A;  3AL9 A;  2H6Q A;  2OK6 A;  3EI3 A;  3SBR A;  2YNO A;  3KRW B;  5FA5 B;  4ES0 A;  4ESG A;  3AH8 B;  4D0K A;  5THA A;  4GGC A;  4CC9 A;  3PE7 A;  2P9L C;  3I7K A;  3PVW B;  5IGO A;  2J55 H;  2H9P A;  4A0B A;  1OMW B;  1N6F A;  3N0D A;  1GXR A;  5K19 A;  3ODT A;  3V5W B;  2UZY B;  2Z2N A;  1N6D A;  3JZG A;  4ERY A;  1GOT B;  2P9K C;  4J87 A;  1PBY B;  3ZWL B;  3OKT A;  2B4E A;  4PBY A;  2P9S C;  3RLM D;  3GFC A;  5FKQ A;  4QQE A;  4A08 A;  2G9A A;  5HE0 B;  1SHY B;  3I8E A;  1R5M A;  4N14 A;  3EI3 B;  4Y5R D;  3PXT D;  3BG1 A;  3NVQ A;  2HJ4 A;  5C9Z B;  4ZOY A;  1B9Y A;  4A0A A;  4FHL A;  4JXM A;  4JT6 C;  4FAV D;  3UVL A;  2G99 A;  2EBS A;  4CI2 A;  2CO0 C;  4PSX B;  5GSA A;  3C5M A;  5EMM B;  2AGY A;  2AH0 A;  1U4C A;  2I3T A;  3UVO A;  4A2L A;  4FA4 D;  2H6N A;  4A7J A;  5I5J A;  1K32 A;  3VA6 A;  3L4M D;  5JWZ A;  3MMY A;  5FKS A;  3ULE C;  1OLZ A;  3SFZ A;  4FA9 D;  1NEX B;  3C6N B;  5IBK B;  3JB9 L;  5GXH A;  1FS1 A;  1A0R B;  1JMX B;  3RN0 D;  2H13 A;  3GRE A;  5IJ8 E;  3JPX A;  3UR4 A;  2XL3 A;  3I7P A;  2YB8 B;  4XEI C;  2IUV A;  2MTA H;  4UI9 R;  3C6O B;  4JD2 C;  5EM2 B;  4J82 A; 
#chains in the Genus database with same CATH topology
 3ZDY A;  1PI6 A;  4L9O A;  2GC7 A;  5FKT A;  3UVM A;  1XMF E;  4JSN C;  5M5U A;  3LZI A;  2OJY A;  4A09 A;  2HXC A;  4OWR A;  4O45 A;  2YB5 A;  4ERQ A;  5EAR A;  1BPO A;  2IWK A;  3E4Y A;  2VDK A;  4FJJ A;  2RCU A;  3C99 A;  3CFR A;  2BCJ B;  1XKS A;  3DM0 A;  4GZ8 A;  4KHY A;  2MW2 A;  3OL2 A;  1UOP A;  3J27 A;  2JHA A;  4J79 A;  4JHN A;  1A12 A;  4X60 B;  1XHM A;  2OK4 A;  2LF3 A;  5FQD A;  5B4W A;  1LDK E;  3E4W A;  1S4U X;  2PFV A;  1FZ6 E;  1N6E A;  3IUJ A;  3MKQ A;  4J73 A;  4CZX A;  5FLX g;  2DTU A;  4M3T A;  1VE6 A;  2H9M A;  1MG3 A;  1T2X A;  2IWF A;  4YVD A;  1QNI A;  4GGD A;  3B7F A;  2P1P B;  2EIB A;  4D9S A;  5EML B;  3MKS B;  2AQ5 A;  5AJA A;  3MXX A;  4J2B A;  3O4H A;  2JHC A;  4Z7N A;  3I7O A;  3QEI A;  3N0E A;  4Z8L A;  4NAA A;  3RN1 D;  3OGM B;  3IJC A;  4J84 A;  3C75 H;  5E6U A;  2XZG A;  4LGN A;  3P4F A;  4UM9 A;  4DNW A;  4JHP C;  4LG9 A;  4CZY A;  3DDU A;  2GNQ A;  2B5L A;  2IUP A;  3JAM g;  3MUO A;  4A09 B;  3OW8 A;  4M41 A;  3HL8 A;  4PSW B;  5EAL A;  1O6F A;  3JRO A;  2I0S A;  4DNU A;  1XL3 C;  3QEX A;  4GM8 A;  4BCB A;  1JMZ B;  3QER A;  1U8C A;  3OL2 B;  1XU3 E;  4BUJ C;  3PSC B;  3CIK B;  5IC7 A;  4B08 A;  2H6K A;  4CY1 A;  5KDO B;  5H14 A;  3L4O D;  4JSX C;  3SPY A;  2B5N A;  1H2X A;  4IMM A;  3UVN A;  5EMK B;  3UO2 A;  2P9P C;  3SBP A;  3F3P A;  4U7A A;  4QNC A;  3PSL A;  2OVR B;  2E31 A;  4DTS A;  1I2M B;  3VGZ A;  2OVP B;  2XU7 A;  5EM2 A;  3I7L A;  1JV2 A;  2O9K A;  4E54 A;  2QXV A;  2PM6 B;  4G1E A;  3L2O B;  4E3S A;  3SXT D;  1MHZ G;  3TL8 B;  2Z2P A;  3N1B A;  3V4P A;  4M3R A;  4ZOX A;  5EMJ B;  5GXI A;  3OGL B;  2CO0 A;  3IIY A;  3BVO A;  3VI4 A;  1JOF A;  3K71 A;  1WAF A;  3TAF A;  4X5M A;  3NAE A;  3RMA A;  3RRM C;  2H47 A;  4NBM A;  3SQ4 A;  1Q9X A;  4ERZ A;  5HYN B;  1M1X A;  4CY3 A;  4G55 A;  4G1M A;  2OYQ A;  2PM9 B;  1YR2 A;  3OTT A;  4AKH A;  1E5T A;  3QEV A;  5TDH B;  4EWR A;  5C2W B;  4CI3 A;  4XYI A;  2QXF A;  3DWL C;  3EWE A;  5CYK A;  1UOQ A;  3SVW D;  4R7A B;  2VDL A;  3SUN A;  4BP9 A;  2H9L A;  2JH8 A;  4RNG A;  2RKH A;  4I9L A;  4ZOV A;  3CFV A;  4FA1 D;  2P5O A;  2ATQ A;  3MUN A;  3SN6 B;  4J8B A;  2AGX A;  4L3H D;  3KD5 E;  4L3G D;  3RFG A;  4O1Q D;  3C95 A;  3K2O A;  2E32 A;  2TRC B;  3HFQ A;  2OIZ A;  4NSX A;  4PBZ A;  3W15 A;  4I79 A;  4I6J B;  3BG0 A;  4FK2 A;  2XYI A;  3EMH A;  3UKR C;  2H3X A;  5TEE A;  2W18 A;  1XVE E;  4FJX A;  4CY2 A;  4DNV A;  4J8G A;  2OZS A;  4J2A A;  3RSE C;  2AGW A;  4JS4 A;  5HE3 B;  4DTR A;  1ERJ A;  4E54 B;  2JH9 A;  4PC0 A;  3FM0 A;  3EI1 A;  3UVK A;  4DU3 A;  1O6G A;  3OF7 A;  4G56 B;  1FZI E;  3SBQ A;  3K26 A;  3CQ8 A;  2QC5 A;  3IJ1 A;  3IKO A;  3L0M A;  3RMB A;  4NEN A;  3QHY B;  4RE6 A;  4KHQ A;  3SNN A;  4FK4 A;  3QES A;  3SCX A;  4X61 B;  2HYE A;  3EI4 A;  1VE7 A;  2H4T A;  3F3F A;  3IJE A;  3ZE0 A;  1TBG A;  3J81 g;  4HCC A;  2YNP A;  5IGQ A;  2I3S A;  4L1Q D;  4GQ1 A;  4M45 A;  2CN3 A;  5CXB A;  3MVD K;  5M5R A;  2CNX A;  3OKY A;  4QAM A;  4QND A;  5CYK B;  4HCB A;  4HDJ A;  2MZW B;  4MMY A;  3LDS A;  3DXK C;  5EAP A;  2GC4 A;  3IIW A;  3I7H A;  1SQ9 A;  2AH1 A;  4A11 B;  1FZ9 E;  4DTM A;  2CN2 A;  1GG2 B;  3NIF A;  4GM9 A;  5FFG A;  4BL0 A;  1FZH E;  5M5V A;  5M5S A;  4AX4 A;  1GOF A;  1MG2 A;  3O4I A;  2I0T A;  4O2W A;  5FXY A;  4KI6 A;  5A2Q g;  4EP9 A;  2IUQ A;  1P22 A;  3C6P B;  2Q7Q A;  3KD1 E;  5SXM A;  3IUN A;  1H2Z A;  2AGL A;  3AFC A;  1K8K C;  4Y7R A;  3EI1 B;  5FKR A;  4FJL A;  5HDB A;  5C86 A;  2P1O B;  3BWS A;  3NIG A;  3NE6 A;  5I5M A;  1VZ2 A;  3EQ7 A;  2P1Q B;  1IG9 A;  2JQT A;  2P9N C;  3EG6 A;  3FGB A;  4PNK B;  2PM9 A;  4GGA A;  2HKM A;  4J0X A;  1SQJ A;  4X63 B;  3SVI A;  1GOH A;  3IUQ A;  3SLE D;  4J78 A;  3PVU B;  4CZV A;  5CXC A;  4FJK A;  3EI4 B;  2H14 A;  5K1C C;  3JZN A;  2MMB A;  5GMK n;  3QNN A;  3C9C A;  5HQG A;  4FJH A;  4M3Z A;  5CXB B;  1VYH C;  4DU4 A;  5HE1 B;  3A0F A;  2IAA A;  3DSM A;  2HKR A;  3KRX B;  4FWW A;  4KFM B;  3OKY B;  3E0C A;  1MTY G;  4DU1 A;  2WQ8 A;  3QEP A;  3LDB A;  2XL2 A;  1FZ7 E;  3VI3 A;  1L0Q A;  4KI4 A;  1FZ3 E;  3O4J A;  5AMS A;  3V4V A;  4E5Z A;  4JSP C;  3EQ9 A;  5H1M A;  3F3G A;  2P9I C;  3EI2 B;  4IT5 A;  2VDM A;  3RMD A;  3AL8 A;  4J2D A;  4KHS A;  3FRX A;  5H17 A;  3OGK B;  3GC3 B;  4BH6 A;  4L1M A;  2H68 A;  2HJB A;  4J86 A;  5IZ7 A;  4NC4 A;  4QRJ A;  2HU7 A;  1RI6 A;  4AKG A;  3ORV D;  3EU7 A;  2BBK H;  4DTU A;  4D6V A;  4MMZ A;  2B5M A;  3I7N A;  1YFQ A;  1PGU A;  3S9H A;  3PXW D;  1N1C A;  2VIX A;  4KHN A;  2PBI B;  2QR5 A;  5E6R A;  1FZ0 E;  2I0R A;  3U4Y A;  4TZ4 A;  3SUO A;  4FJM A;  3IVM A;  4O3U B;  3QET A;  5E6S A;  2YBA A;  3SUP A;  4AN1 A;  4FJ9 A;  2P9U C;  3ZDX A;  2VJ5 A;  3IUL A;  4JSV C;  3MZL A;  4FB1 D;  2HD0 A;  4AKI A;  4I9Q A;  2JPN A;  4M42 A;  5CXC B;  4ZOZ A;  3WSO A;  1PEV A;  2AGZ A;  4MK0 B;  3V7D B;  3NCI A;  5IJ7 E;  3RFH A;  4H5I A;  3UKU C;  4GQ2 P;  4AN0 A;  1JTD B;  4A11 A;  3SCY A;  3GD1 I;  4WK4 A;  3SMR A;  4CY5 A;  4PXW A;  2UZX B;  3I89 A;  3SI6 A;  2FW3 A;  4WK0 A;  2IUR A;  4X5N A;  4XYH A;  4AMZ A;  1XVG E;  4U1E I;  3IUM A;  3JRP A;  3SWS D;  4M3Y A;  4RL5 A;  3K72 A;  3JZH A;  4Z7O A;  2VZ3 A;  4A0B B;  4AEZ A;  2P1N B;  4E5Z B;  3O4G A;  4K3I D;  1C9I A;  2VDN A;  3QI0 A;  3AL8 B;  3HP9 A;  4IA9 A;  3VH0 A;  4EYW A;  4X3E A;  4DTO A;  2K5S A;  3LZJ A;  4O3T B;  4AMY A;  3CFS B;  3RMC A;  4H5J A;  4Z7Q A;  1FWX A;  5IRE A;  3NGI A;  4M3U A;  4QT8 A;  2DY4 A;  4J77 A;  5TF2 A;  3V9F A;  2CE9 A;  4CI1 A;  3SHF A;  4E4B A;  3OKW A;  4OZU A;  1Q47 A;  4QL1 A;  3MZK A;  2QZP A;  1XMG E;  4K3J B;  4A2M A;  4KHU A;  2VC2 A;  4FA5 D;  1MHY G;  4GMB A;  3PXS D;  3RMZ D;  2YMU A;  4WJK A;  4JRQ A;  3I8C A;  3HGL A;  4RE5 A;  3TJY A;  4FAN D;  3RWU A;  3UO3 A;  3UIQ A;  4FVM A;  3NDK A;  3DXM C;  5EAM A;  4AOW A;  4A08 B;  5HE2 B;  1U2V C;  4CI8 A;  3SJL D;  3J80 g;  1GP2 B;  4KHW A;  1FZ5 E;  3KCI A;  4A0A B;  1XIP A;  5C92 A;  4JT5 C;  2H9N A;  1UOO A;  4J0W A;  5IT9 g;  3EI2 A;  1FZ4 E;  2EIE A;  2CE8 A;  2J57 G;  5AFU 3;  2P1M B;  4GAM C;  3K27 A;  5I5I A;  2PM7 B;  1MDA H;  1XVF E;  4JRP A;  1L5G A;  1FZ8 E;  4GQB B;  4DTX A;  3SPZ A;  2HES X;  4FJ5 A;  2VDR A;  2YNN A;  4BP8 A;  1TYQ C;  3ZE2 A;  1QFS A;  4ZN4 A;  2Z2O A;  4LG8 A;  2OVQ B;  1XVD E;  2JKX A;  2JHP A;  1NR0 A;  1JJU B;  3C94 A;  3NVX A;  4J81 A;  5H37 A;  3NVN A;  2J56 H;  2B8I A;  3L8B A;  4FK0 A;  1B9X A;  3IJ0 A;  4O9D A;  5C2V B;  4GM3 A;  2PFT A;  1E8N A;  3I2N A;  5TEF A;  2B1E A;  3AL9 A;  1C9L A;  3EQ8 A;  2H6Q A;  2OK6 A;  3EI3 A;  1JW2 A;  5FFO A;  3SBR A;  2YNO A;  3NID A;  3KRW B;  5FA5 B;  4ES0 A;  4UM8 A;  3QNO A;  4ESG A;  3AH8 B;  5M61 A;  4D0K A;  4ICG C;  1Q9Y A;  1MMO G;  5THA A;  3SQ2 A;  4GGC A;  3LD8 A;  2BKL A;  4CC9 A;  2VDQ A;  4FJ8 A;  1VZ3 A;  1E8M A;  3PE7 A;  4WK2 A;  1QFM A;  2P9L C;  3I7K A;  4DTN A;  1CLQ A;  3PVW B;  2J55 H;  2H9P A;  5IGO A;  3ZDZ A;  4A0B A;  1OMW B;  5M5T A;  1N6F A;  3N0D A;  1XVB E;  1GXR A;  5K19 A;  3ODT A;  3V5W B;  2P5G A;  2UZY B;  2Z2N A;  4ADN A;  1N6D A;  2EID A;  2VDP A;  3JZG A;  4ERY A;  1GOT B;  2P9K C;  4J87 A;  1PBY B;  3FCS A;  4JS5 A;  3TAE A;  3N1E A;  2OZM A;  4J2E A;  3T3M A;  3ZWL B;  3OKT A;  4MMX A;  1XMH E;  2B4E A;  3IUR A;  4PBY A;  2P9S C;  3RLM D;  2XDW A;  2DEB A;  3GFC A;  5FKQ A;  4QQE A;  2VZ1 A;  4RG8 A;  1FXX A;  2VDO A;  4AI6 A;  3TAB A;  4FJN A;  4M3X A;  4DTJ A;  4A08 A;  2G9A A;  5HE0 B;  1SHY B;  3I8E A;  1R5M A;  4DTP A;  4N14 A;  2HU8 A;  4EPH A;  3EI3 B;  4Y5R D;  3ZE1 A;  1UTC A;  3PXT D;  1WAJ A;  4ADO A;  3L1N A;  3BG1 A;  4BCC A;  3NVQ A;  2HJ4 A;  5C9Z B;  4ZOY A;  4M3W A;  1B9Y A;  4A0A A;  4FHL A;  4JXM A;  4JT6 C;  4FAV D;  3UVL A;  2G99 A;  2EBS A;  3FCU A;  4CI2 A;  2CO0 C;  4PSX B;  5GSA A;  3C5M A;  5EMM B;  2AGY A;  2AH0 A;  2LF6 A;  1U4C A;  2I3T A;  3UVO A;  4A2L A;  4FA4 D;  2H6N A;  4A7J A;  5I5J A;  1K32 A;  1FZ1 E;  1IH7 A;  3VA6 A;  3L4M D;  4J82 A;  2VJ4 A;  3SQ1 A;  2HU5 A;  5JWZ A;  3MMY A;  5FKS A;  1H2W A;  3ULE C;  1OLZ A;  3SFZ A;  3J2P A;  4FA9 D;  4IRZ A;  1NEX B;  3C6N B;  5IBK B;  3JB9 L;  4FJI A;  3SUQ A;  1FZ2 E;  2FYO A;  4BCD A;  1FS1 A;  5GXH A;  3SQ0 A;  1JMX B;  1A0R B;  3RN0 D;  3SJJ A;  3T3P A;  4FJ7 A;  1XU5 E;  2H13 A;  1TYE A;  3QEW A;  3GRE A;  5IJ8 E;  2EIC A;  3JPX A;  3UR4 A;  3K6S A;  1H2Y A;  3CFO A;  1FYZ E;  1GOG A;  3TAG A;  2XL3 A;  3I7P A;  2YB8 B;  4XEI C;  2IUV A;  2MTA H;  3NHG A;  3C6O B;  4FJG A;  4O02 A;  4JD2 C;  1K3I A;  4UI9 R;  2XE4 A;  3HGK E;  1FPO A;  5EM2 B;  3CFP A;  2B7M A;  1XVC E; 
#chains in the Genus database with same CATH homology
 1PI6 A;  4L9O A;  2GC7 A;  5FKT A;  3UVM A;  1XMF E;  4JSN C;  4A09 A;  3LZI A;  2OJY A;  2HXC A;  4OWR A;  4O45 A;  2YB5 A;  4ERQ A;  5EAR A;  2IWK A;  3E4Y A;  4FJJ A;  2RCU A;  3C99 A;  3CFR A;  2BCJ B;  1XKS A;  3DM0 A;  4GZ8 A;  4KHY A;  3OL2 A;  3J27 A;  2JHA A;  4J79 A;  4X60 B;  1XHM A;  2OK4 A;  2LF3 A;  5FQD A;  5B4W A;  1LDK E;  3E4W A;  1S4U X;  2PFV A;  1FZ6 E;  1N6E A;  4J73 A;  3MKQ A;  4CZX A;  5FLX g;  2DTU A;  4M3T A;  2H9M A;  1MG3 A;  2IWF A;  1QNI A;  4GGD A;  3B7F A;  2P1P B;  5EML B;  3MKS B;  2AQ5 A;  5AJA A;  3MXX A;  4J2B A;  2JHC A;  3I7O A;  3QEI A;  3N0E A;  4Z8L A;  3RN1 D;  3OGM B;  3IJC A;  4J84 A;  3C75 H;  4LGN A;  3P4F A;  4LG9 A;  4CZY A;  2GNQ A;  2B5L A;  2IUP A;  3JAM g;  4A09 B;  3OW8 A;  4M41 A;  3HL8 A;  4PSW B;  5EAL A;  3JRO A;  2I0S A;  1XL3 C;  3QEX A;  4GM8 A;  1JMZ B;  3QER A;  3OL2 B;  1XU3 E;  4BUJ C;  3PSC B;  3CIK B;  5IC7 A;  4B08 A;  2H6K A;  4CY1 A;  5KDO B;  5H14 A;  3L4O D;  4JSX C;  3SPY A;  2B5N A;  4IMM A;  3UVN A;  5EMK B;  2P9P C;  3SBP A;  3F3P A;  4U7A A;  4QNC A;  3PSL A;  2OVR B;  2E31 A;  4DTS A;  3VGZ A;  2OVP B;  2XU7 A;  5EM2 A;  3I7L A;  2O9K A;  4E54 A;  2QXV A;  2PM6 B;  3L2O B;  4E3S A;  3SXT D;  1MHZ G;  3TL8 B;  2Z2P A;  3N1B A;  4M3R A;  4ZOX A;  5EMJ B;  5GXI A;  3OGL B;  2CO0 A;  3IIY A;  1JOF A;  1WAF A;  3TAF A;  4X5M A;  3NAE A;  3RMA A;  3RRM C;  2H47 A;  3SQ4 A;  1Q9X A;  4ERZ A;  5HYN B;  4CY3 A;  2OYQ A;  2PM9 B;  5TDH B;  3OTT A;  4AKH A;  4EWR A;  3QEV A;  4CI3 A;  5C2W B;  4XYI A;  2QXF A;  3DWL C;  3EWE A;  5CYK A;  3SVW D;  4R7A B;  3SUN A;  2H9L A;  2JH8 A;  4RNG A;  4ZOV A;  4I9L A;  3CFV A;  4FA1 D;  2P5O A;  2ATQ A;  3SN6 B;  4J8B A;  2AGX A;  4L3H D;  3KD5 E;  4L3G D;  3RFG A;  4O1Q D;  3C95 A;  3K2O A;  2E32 A;  2TRC B;  3HFQ A;  2OIZ A;  4NSX A;  4PBZ A;  3W15 A;  4I79 A;  4I6J B;  3BG0 A;  4FK2 A;  2XYI A;  3EMH A;  3UKR C;  2H3X A;  5TEE A;  2W18 A;  1XVE E;  4FJX A;  4CY2 A;  4J8G A;  2OZS A;  4J2A A;  3RSE C;  2AGW A;  4JS4 A;  5HE3 B;  4DTR A;  1ERJ A;  4E54 B;  2JH9 A;  4PC0 A;  3FM0 A;  3EI1 A;  3UVK A;  4DU3 A;  3SBQ A;  4G56 B;  1FZI E;  3K26 A;  3CQ8 A;  2QC5 A;  3IJ1 A;  3IKO A;  3L0M A;  3RMB A;  4KHQ A;  3SNN A;  4FK4 A;  3QES A;  3SCX A;  4X61 B;  2HYE A;  3EI4 A;  2H4T A;  3F3F A;  3J81 g;  1TBG A;  4HCC A;  2YNP A;  5IGQ A;  2I3S A;  4L1Q D;  4GQ1 A;  4M45 A;  2CN3 A;  5CXB A;  2CNX A;  3OKY A;  4QND A;  5CYK B;  4HCB A;  4HDJ A;  2MZW B;  3LDS A;  3DXK C;  5EAP A;  2GC4 A;  3IIW A;  3I7H A;  1SQ9 A;  2AH1 A;  4A11 B;  1FZ9 E;  4DTM A;  2CN2 A;  1GG2 B;  4GM9 A;  4BL0 A;  1FZH E;  1MG2 A;  2I0T A;  5FXY A;  4KI6 A;  5A2Q g;  4EP9 A;  2IUQ A;  1P22 A;  3C6P B;  2Q7Q A;  3KD1 E;  5SXM A;  2AGL A;  3AFC A;  1K8K C;  4Y7R A;  3EI1 B;  5FKR A;  4FJL A;  2P1O B;  3BWS A;  5I5M A;  3NE6 A;  2P1Q B;  1IG9 A;  2P9N C;  3EG6 A;  3FGB A;  4PNK B;  2PM9 A;  4GGA A;  2HKM A;  4J0X A;  1SQJ A;  4X63 B;  3SVI A;  3SLE D;  4J78 A;  3PVU B;  4CZV A;  5CXC A;  4FJK A;  3EI4 B;  2H14 A;  5K1C C;  3JZN A;  2MMB A;  5GMK n;  3QNN A;  3C9C A;  5HQG A;  4FJH A;  4M3Z A;  5CXB B;  1VYH C;  4DU4 A;  5HE1 B;  3A0F A;  2IAA A;  3DSM A;  2HKR A;  3KRX B;  4FWW A;  4KFM B;  3OKY B;  3E0C A;  1MTY G;  4DU1 A;  3QEP A;  3LDB A;  2XL2 A;  1FZ7 E;  1L0Q A;  4KI4 A;  1FZ3 E;  5AMS A;  4E5Z A;  4JSP C;  5H1M A;  3F3G A;  2P9I C;  3EI2 B;  3AL8 A;  3RMD A;  4J2D A;  4KHS A;  3FRX A;  5H17 A;  3OGK B;  4BH6 A;  4YVD A;  2H68 A;  2HJB A;  4J86 A;  5IZ7 A;  4QRJ A;  1RI6 A;  4AKG A;  3ORV D;  3EU7 A;  2BBK H;  4DTU A;  4D6V A;  2B5M A;  3I7N A;  1YFQ A;  1PGU A;  3S9H A;  3PXW D;  2VIX A;  4KHN A;  2PBI B;  1FZ0 E;  2I0R A;  3U4Y A;  4TZ4 A;  3SUO A;  4FJM A;  4O3U B;  3QET A;  2YBA A;  3SUP A;  4FJ9 A;  2P9U C;  2VJ5 A;  4JSV C;  3MZL A;  4FB1 D;  2HD0 A;  4AKI A;  4I9Q A;  2JPN A;  4M42 A;  5CXC B;  4ZOZ A;  3WSO A;  1PEV A;  2AGZ A;  4MK0 B;  3V7D B;  3NCI A;  5IJ7 E;  3RFH A;  4H5I A;  3UKU C;  4GQ2 P;  4A11 A;  3SCY A;  3SMR A;  4CY5 A;  4PXW A;  2UZX B;  3I89 A;  3SI6 A;  2FW3 A;  2IUR A;  4X5N A;  4XYH A;  1XVG E;  4U1E I;  3JRP A;  3SWS D;  4M3Y A;  4RL5 A;  3JZH A;  4A0B B;  4AEZ A;  2P1N B;  4E5Z B;  4K3I D;  3AL8 B;  3HP9 A;  4IA9 A;  3VH0 A;  4EYW A;  4X3E A;  4DTO A;  3LZJ A;  4O3T B;  3CFS B;  3RMC A;  4H5J A;  1FWX A;  5IRE A;  3NGI A;  4M3U A;  4QT8 A;  2DY4 A;  4J77 A;  5TF2 A;  3V9F A;  2CE9 A;  4CI1 A;  3SHF A;  4E4B A;  3OKW A;  4OZU A;  1Q47 A;  4QL1 A;  3MZK A;  1XMG E;  4K3J B;  4A2M A;  4KHU A;  4FA5 D;  1MHY G;  4GMB A;  3PXS D;  3RMZ D;  2YMU A;  4JRQ A;  3I8C A;  3HGL A;  3TJY A;  4FAN D;  3RWU A;  3UIQ A;  4FVM A;  3NDK A;  3DXM C;  5EAM A;  4AOW A;  4A08 B;  5HE2 B;  1U2V C;  4CI8 A;  3SJL D;  3J80 g;  1GP2 B;  4KHW A;  1FZ5 E;  4A0A B;  1XIP A;  4JT5 C;  2H9N A;  4J0W A;  5IT9 g;  3EI2 A;  1FZ4 E;  5I5I A;  2CE8 A;  2J57 G;  5AFU 3;  2P1M B;  4GAM C;  3K27 A;  2PM7 B;  1MDA H;  1XVF E;  4JRP A;  1FZ8 E;  4GQB B;  4DTX A;  3SPZ A;  2HES X;  4FJ5 A;  2YNN A;  1TYQ C;  4ZN4 A;  2Z2O A;  4LG8 A;  2OVQ B;  1XVD E;  2JHP A;  1JJU B;  1NR0 A;  3C94 A;  3NVX A;  4J81 A;  5H37 A;  3NVN A;  2J56 H;  2B8I A;  3L8B A;  4FK0 A;  1B9X A;  3IJ0 A;  4O9D A;  5C2V B;  4GM3 A;  2PFT A;  3I2N A;  5TEF A;  2B1E A;  3AL9 A;  2H6Q A;  2OK6 A;  3EI3 A;  3SBR A;  2YNO A;  3KRW B;  5FA5 B;  4ES0 A;  3QNO A;  4ESG A;  3AH8 B;  4D0K A;  1Q9Y A;  5THA A;  1MMO G;  3SQ2 A;  4GGC A;  3LD8 A;  4CC9 A;  4FJ8 A;  3PE7 A;  2P9L C;  3I7K A;  4DTN A;  1CLQ A;  3PVW B;  2J55 H;  2H9P A;  5IGO A;  4A0B A;  1OMW B;  1N6F A;  3N0D A;  1XVB E;  1GXR A;  5K19 A;  3ODT A;  3V5W B;  2P5G A;  2UZY B;  2Z2N A;  4ADN A;  1N6D A;  3JZG A;  4ERY A;  1GOT B;  2P9K C;  4J87 A;  1PBY B;  4JS5 A;  3TAE A;  3N1E A;  2OZM A;  4J2E A;  3ZWL B;  3OKT A;  1XMH E;  2B4E A;  4PBY A;  2P9S C;  3RLM D;  2DEB A;  3GFC A;  5FKQ A;  4QQE A;  4RG8 A;  1FXX A;  4AI6 A;  3TAB A;  4FJN A;  4M3X A;  4DTJ A;  4A08 A;  2G9A A;  5HE0 B;  1SHY B;  3I8E A;  1R5M A;  4DTP A;  4N14 A;  4EPH A;  3EI3 B;  4Y5R D;  3PXT D;  1WAJ A;  4ADO A;  3L1N A;  3BG1 A;  3NVQ A;  2HJ4 A;  5C9Z B;  4ZOY A;  4M3W A;  1B9Y A;  4A0A A;  4FHL A;  4JXM A;  4JT6 C;  4FAV D;  3UVL A;  2G99 A;  2EBS A;  4CI2 A;  2CO0 C;  4PSX B;  5GSA A;  3C5M A;  5EMM B;  2AGY A;  2AH0 A;  2LF6 A;  1U4C A;  2I3T A;  3UVO A;  4A2L A;  4FA4 D;  2H6N A;  4A7J A;  5I5J A;  1K32 A;  1FZ1 E;  1IH7 A;  3VA6 A;  3L4M D;  4J82 A;  2VJ4 A;  3SQ1 A;  5JWZ A;  3MMY A;  5FKS A;  3ULE C;  1OLZ A;  3SFZ A;  3J2P A;  4FA9 D;  1NEX B;  3C6N B;  5IBK B;  3JB9 L;  4FJI A;  3SUQ A;  1FZ2 E;  2FYO A;  5GXH A;  1FS1 A;  3SQ0 A;  1JMX B;  1A0R B;  3RN0 D;  3SJJ A;  4FJ7 A;  1XU5 E;  2H13 A;  3GRE A;  3QEW A;  5IJ8 E;  3JPX A;  3UR4 A;  3CFO A;  1FYZ E;  3TAG A;  2XL3 A;  3I7P A;  2YB8 B;  4XEI C;  2IUV A;  2MTA H;  3NHG A;  3C6O B;  4FJG A;  4UI9 R;  4JD2 C;  5EM2 B;  3HGK E;  3CFP A;  2B7M A;  1XVC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...