2LF3A

Solution nmr structure of hoppmal_281_385 from pseudomonas syringae pv. maculicola str. es4326, midwest center for structural genomics target apc40104.5 and northeast structural genomics consortium target pst2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
b'SQRPVDRNPPRINLMPTGANRVAMRNRGNNEADAALQALAQNGINMEDLRAALEAYIVWLRPIPLDIANALEGVGITPRFDNPEEAKVDNPLMNLSSALKRRLDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Effector protein hopAB3
publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16847 AvrPtoB_bdg Avirulence AvrPtoB, BAK1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf3A00
3TL8B 2LF3A 2LF6A
chains in the Genus database with same CATH superfamily
4JRPA 4DTRA 4ICGC 4AI6A 2MW2A 3TAGA 4FK0A 2OVQB 3J27A 4M41A 3QESA 3LDBA 3QNNA 1MHYG 4RNGA 2DEBA 2OVPB 4DU3A 3SUNA 4FK2A 4RL5A 3SVIA 4AKGA 1FYZE 4X5NA 4J2AA 1MMOG 3QERA 3QEXA 2H4TA 3SUQA 3QNOA 2FYOA 2HD0A 2JHCA 2PFVA 1FZ0E 3SPZA 2ATQA 5IZ7A 4KI4A 4FJGA 4B08A 3SQ4A 3KD1E 1FZ3E 3TL8B 4FJIA 4AKHA 1FZ2E 3LZJA 3LD8A 3TABA 1IG9A 4FJXA 2P1QB 3RMAA 4KI6A 2PFTA 4M42A 1XU5E 1FZ5E 4DU1A 4DTPA 3C6OB 2E31A 3HP9A 3OGMB 2JH9A 3E4YA 3WSOA 3TAFA 4FJ7A 1XVDE 4GAMC 3NHGA 2JQTA 4DTUA 4FK4A 3NDKA 2LF6A 2VJ5A 4I6JB 4M3XA 4QNDA 5IBKB 4J2DA 1N1CA 1FPOA 3CFRA 1FZ7E 1Q9XA 3N1EA 1IH7A 3OGLB 4E3SA 4KHSA 3TAEA 3RWUA 2P1NB 2P1MB 4KHWA 1WAFA 1XMHE 3TJYA 3HGLA 2VJ4A 3SPYA 3SJJA 5IREA 2OYQA 4M3UA 3QEIA 4FJ9A 4FJ8A 4HCBA 3J2PA 2YB5A 4M3RA 2P5OA 3NE6A 3E4WA 4KHQA 3QEWA 3SQ2A 4I9LA 4ADNA 3SQ0A 1Q9YA 2OZSA 4EPHA 2OVRB 1FZ9E 1XVGE 1XVEE 3SCXA 1NEXB 2MMBA 5H37A 2JHPA 1FZIE 1XVFE 4JRQA 3QETA 3RMCA 3SUPA 2B7MA 4I9QA 1FXXA 4FVMA 3CFOA 4M3TA 2P1PB 2B8IA 3NCIA 1MHZG 4J2BA 1WAJA 4KHYA 1XL3C 4FJ5A 2P5GA 3UIQA 2B1EA 4HCCA 4J2EA 1FS1A 1MTYG 3NAEA 3L8BA 2DTUA 2DY4A 2JHAA 1FZ8E 4DTXA 4M45A 1XVBE 3CQ8A 3L1NA 3NGIA 3V7DB 3KD5E 4FJMA 4E4BA 4KHUA 2P1OB 1FZHE 1CLQA 3SNNA 1FZ4E 3OGKB 4QNCA 4FJNA 2FW3A 4JS5A 4KHNA 3C95A 4X5MA 2E32A 2JPNA 3C94A 1P22A 3MKSB 3S9HA 4M3WA 3SUOA 2QXFA 1XMGE 3BVOA 3CFPA 3QEVA 4IT5A 4FJHA 4JS4A 3UO2A 1XMFE 4FJJA 4DTNA 4FJKA 3SI6A 1LDKE 3LDSA 4ADOA 1FZ6E 3UO3A 3LZIA 2OZMA 3HGKE 4EYWA 4DTMA 4EP9A 4M3YA 1JW2A 4FJLA 1XU3E 3HL8A 3QEPA 2K5SA 4DTOA 4DTSA 3C6NB 1FZ1E 2RKHA 3L2OB 4DTJA 3RMDA 3K2OA 4M3ZA 3C6PB 4DU4A 2VIXA 3N1BA 2LF3A 3RMBA 4AKIA 1XVCE 4RG8A 2RCUA 3SQ1A 2JH8A 3L0MA 2MZWB
chains in the Genus database with same CATH topology
4JRPA 4DTRA 4AI6A 3TAGA 4FK0A 2OVQB 3J27A 4M41A 3QESA 3LDBA 3QNNA 1MHYG 4RNGA 2DEBA 2OVPB 4DU3A 3SUNA 4FK2A 4RL5A 3SVIA 4AKGA 1FYZE 4X5NA 4J2AA 1MMOG 3QERA 3QEXA 2H4TA 3SUQA 3QNOA 2FYOA 2HD0A 2JHCA 2PFVA 1FZ0E 3SPZA 2ATQA 5IZ7A 4KI4A 4FJGA 4B08A 3SQ4A 3KD1E 1FZ3E 3TL8B 4FJIA 4AKHA 1FZ2E 3LZJA 3LD8A 3TABA 1IG9A 4FJXA 2P1QB 3RMAA 4KI6A 2PFTA 4M42A 1XU5E 1FZ5E 4DU1A 4DTPA 3C6OB 2E31A 3HP9A 3OGMB 2JH9A 3E4YA 3WSOA 3TAFA 4FJ7A 1XVDE 4GAMC 3NHGA 4DTUA 4FK4A 3NDKA 2LF6A 2VJ5A 4I6JB 4M3XA 4QNDA 5IBKB 4J2DA 3CFRA 1FZ7E 1Q9XA 3N1EA 1IH7A 3OGLB 4E3SA 4KHSA 3TAEA 3RWUA 2P1NB 2P1MB 4KHWA 1WAFA 1XMHE 3TJYA 3HGLA 2VJ4A 3SPYA 3SJJA 5IREA 2OYQA 4M3UA 3QEIA 4FJ9A 4FJ8A 4HCBA 3J2PA 2YB5A 4M3RA 2P5OA 3NE6A 3E4WA 4KHQA 3QEWA 3SQ2A 4I9LA 4ADNA 3SQ0A 1Q9YA 2OZSA 4EPHA 2OVRB 1FZ9E 1XVGE 1XVEE 3SCXA 1NEXB 2MMBA 5H37A 2JHPA 1FZIE 1XVFE 4JRQA 3QETA 3RMCA 3SUPA 2B7MA 4I9QA 1FXXA 4FVMA 3CFOA 4M3TA 2P1PB 2B8IA 3NCIA 1MHZG 4J2BA 1WAJA 4KHYA 1XL3C 4FJ5A 2P5GA 3UIQA 2B1EA 4HCCA 4J2EA 1FS1A 1MTYG 3NAEA 3L8BA 2DTUA 2DY4A 2JHAA 1FZ8E 4DTXA 4M45A 1XVBE 3CQ8A 3L1NA 3NGIA 3V7DB 3KD5E 4FJMA 4E4BA 4KHUA 2P1OB 1FZHE 1CLQA 3SNNA 1FZ4E 3OGKB 4QNCA 4FJNA 2FW3A 4JS5A 4KHNA 3C95A 4X5MA 2E32A 2JPNA 3C94A 1P22A 3MKSB 3S9HA 4M3WA 3SUOA 2QXFA 1XMGE 3CFPA 3QEVA 4FJHA 4JS4A 1XMFE 4FJJA 4DTNA 4FJKA 3SI6A 1LDKE 3LDSA 4ADOA 1FZ6E 3LZIA 2OZMA 3HGKE 4EYWA 4DTMA 4EP9A 4M3YA 4FJLA 1XU3E 3HL8A 3QEPA 4DTOA 4DTSA 3C6NB 1FZ1E 3L2OB 4DTJA 3RMDA 3K2OA 4M3ZA 3C6PB 4DU4A 2VIXA 3N1BA 2LF3A 3RMBA 4AKIA 1XVCE 4RG8A 2RCUA 3SQ1A 2JH8A 3L0MA 2MZWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TL8 B;  2LF3 A;  2LF6 A; 
#chains in the Genus database with same CATH topology
 4JRP A;  4DTR A;  4ICG C;  4AI6 A;  2MW2 A;  3TAG A;  4FK0 A;  2OVQ B;  3J27 A;  4M41 A;  3QES A;  3LDB A;  3QNN A;  1MHY G;  4RNG A;  2DEB A;  2OVP B;  4DU3 A;  3SUN A;  4FK2 A;  4RL5 A;  3SVI A;  4AKG A;  1FYZ E;  4X5N A;  4J2A A;  1MMO G;  3QER A;  3QEX A;  2H4T A;  3SUQ A;  3QNO A;  2FYO A;  2HD0 A;  2JHC A;  2PFV A;  1FZ0 E;  3SPZ A;  2ATQ A;  5IZ7 A;  4KI4 A;  4FJG A;  4B08 A;  3SQ4 A;  3KD1 E;  1FZ3 E;  3TL8 B;  4FJI A;  4AKH A;  1FZ2 E;  3LZJ A;  3LD8 A;  3TAB A;  1IG9 A;  4FJX A;  2P1Q B;  3RMA A;  4KI6 A;  2PFT A;  4M42 A;  1XU5 E;  1FZ5 E;  4DU1 A;  4DTP A;  3C6O B;  2E31 A;  3HP9 A;  3OGM B;  2JH9 A;  3E4Y A;  3WSO A;  3TAF A;  4FJ7 A;  1XVD E;  4GAM C;  3NHG A;  2JQT A;  4DTU A;  4FK4 A;  3NDK A;  2LF6 A;  2VJ5 A;  4I6J B;  4M3X A;  4QND A;  5IBK B;  4J2D A;  1N1C A;  1FPO A;  3CFR A;  1FZ7 E;  1Q9X A;  3N1E A;  1IH7 A;  3OGL B;  4E3S A;  4KHS A;  3TAE A;  3RWU A;  2P1N B;  2P1M B;  4KHW A;  1WAF A;  1XMH E;  3TJY A;  3HGL A;  2VJ4 A;  3SPY A;  3SJJ A;  5IRE A;  2OYQ A;  4M3U A;  3QEI A;  4FJ9 A;  4FJ8 A;  4HCB A;  3J2P A;  2YB5 A;  4M3R A;  2P5O A;  3NE6 A;  3E4W A;  4KHQ A;  3QEW A;  3SQ2 A;  4I9L A;  4ADN A;  3SQ0 A;  1Q9Y A;  2OZS A;  4EPH A;  2OVR B;  1FZ9 E;  1XVG E;  1XVE E;  3SCX A;  1NEX B;  2MMB A;  5H37 A;  2JHP A;  1FZI E;  1XVF E;  4JRQ A;  3QET A;  3RMC A;  3SUP A;  2B7M A;  4I9Q A;  1FXX A;  4FVM A;  3CFO A;  4M3T A;  2P1P B;  2B8I A;  3NCI A;  1MHZ G;  4J2B A;  1WAJ A;  4KHY A;  1XL3 C;  4FJ5 A;  2P5G A;  3UIQ A;  2B1E A;  4HCC A;  4J2E A;  1FS1 A;  1MTY G;  3NAE A;  3L8B A;  2DTU A;  2DY4 A;  2JHA A;  1FZ8 E;  4DTX A;  4M45 A;  1XVB E;  3CQ8 A;  3L1N A;  3NGI A;  3V7D B;  3KD5 E;  4FJM A;  4E4B A;  4KHU A;  2P1O B;  1FZH E;  1CLQ A;  3SNN A;  1FZ4 E;  3OGK B;  4QNC A;  4FJN A;  2FW3 A;  4JS5 A;  4KHN A;  3C95 A;  4X5M A;  2E32 A;  2JPN A;  3C94 A;  1P22 A;  3MKS B;  3S9H A;  4M3W A;  3SUO A;  2QXF A;  1XMG E;  3BVO A;  3CFP A;  3QEV A;  4IT5 A;  4FJH A;  4JS4 A;  3UO2 A;  1XMF E;  4FJJ A;  4DTN A;  4FJK A;  3SI6 A;  1LDK E;  3LDS A;  4ADO A;  1FZ6 E;  3UO3 A;  3LZI A;  2OZM A;  3HGK E;  4EYW A;  4DTM A;  4EP9 A;  4M3Y A;  1JW2 A;  4FJL A;  1XU3 E;  3HL8 A;  3QEP A;  2K5S A;  4DTO A;  4DTS A;  3C6N B;  1FZ1 E;  2RKH A;  3L2O B;  4DTJ A;  3RMD A;  3K2O A;  4M3Z A;  3C6P B;  4DU4 A;  2VIX A;  3N1B A;  2LF3 A;  3RMB A;  4AKI A;  1XVC E;  4RG8 A;  2RCU A;  3SQ1 A;  2JH8 A;  3L0M A;  2MZW B; 
#chains in the Genus database with same CATH homology
 4JRP A;  4DTR A;  4AI6 A;  3TAG A;  4FK0 A;  2OVQ B;  3J27 A;  4M41 A;  3QES A;  3LDB A;  3QNN A;  1MHY G;  4RNG A;  2DEB A;  2OVP B;  4DU3 A;  3SUN A;  4FK2 A;  4RL5 A;  3SVI A;  4AKG A;  1FYZ E;  4X5N A;  4J2A A;  1MMO G;  3QER A;  3QEX A;  2H4T A;  3SUQ A;  3QNO A;  2FYO A;  2HD0 A;  2JHC A;  2PFV A;  1FZ0 E;  3SPZ A;  2ATQ A;  5IZ7 A;  4KI4 A;  4FJG A;  4B08 A;  3SQ4 A;  3KD1 E;  1FZ3 E;  3TL8 B;  4FJI A;  4AKH A;  1FZ2 E;  3LZJ A;  3LD8 A;  3TAB A;  1IG9 A;  4FJX A;  2P1Q B;  3RMA A;  4KI6 A;  2PFT A;  4M42 A;  1XU5 E;  1FZ5 E;  4DU1 A;  4DTP A;  3C6O B;  2E31 A;  3HP9 A;  3OGM B;  2JH9 A;  3E4Y A;  3WSO A;  3TAF A;  4FJ7 A;  1XVD E;  4GAM C;  3NHG A;  4DTU A;  4FK4 A;  3NDK A;  2LF6 A;  2VJ5 A;  4I6J B;  4M3X A;  4QND A;  5IBK B;  4J2D A;  3CFR A;  1FZ7 E;  1Q9X A;  3N1E A;  1IH7 A;  3OGL B;  4E3S A;  4KHS A;  3TAE A;  3RWU A;  2P1N B;  2P1M B;  4KHW A;  1WAF A;  1XMH E;  3TJY A;  3HGL A;  2VJ4 A;  3SPY A;  3SJJ A;  5IRE A;  2OYQ A;  4M3U A;  3QEI A;  4FJ9 A;  4FJ8 A;  4HCB A;  3J2P A;  2YB5 A;  4M3R A;  2P5O A;  3NE6 A;  3E4W A;  4KHQ A;  3QEW A;  3SQ2 A;  4I9L A;  4ADN A;  3SQ0 A;  1Q9Y A;  2OZS A;  4EPH A;  2OVR B;  1FZ9 E;  1XVG E;  1XVE E;  3SCX A;  1NEX B;  2MMB A;  5H37 A;  2JHP A;  1FZI E;  1XVF E;  4JRQ A;  3QET A;  3RMC A;  3SUP A;  2B7M A;  4I9Q A;  1FXX A;  4FVM A;  3CFO A;  4M3T A;  2P1P B;  2B8I A;  3NCI A;  1MHZ G;  4J2B A;  1WAJ A;  4KHY A;  1XL3 C;  4FJ5 A;  2P5G A;  3UIQ A;  2B1E A;  4HCC A;  4J2E A;  1FS1 A;  1MTY G;  3NAE A;  3L8B A;  2DTU A;  2DY4 A;  2JHA A;  1FZ8 E;  4DTX A;  4M45 A;  1XVB E;  3CQ8 A;  3L1N A;  3NGI A;  3V7D B;  3KD5 E;  4FJM A;  4E4B A;  4KHU A;  2P1O B;  1FZH E;  1CLQ A;  3SNN A;  1FZ4 E;  3OGK B;  4QNC A;  4FJN A;  2FW3 A;  4JS5 A;  4KHN A;  3C95 A;  4X5M A;  2E32 A;  2JPN A;  3C94 A;  1P22 A;  3MKS B;  3S9H A;  4M3W A;  3SUO A;  2QXF A;  1XMG E;  3CFP A;  3QEV A;  4FJH A;  4JS4 A;  1XMF E;  4FJJ A;  4DTN A;  4FJK A;  3SI6 A;  1LDK E;  3LDS A;  4ADO A;  1FZ6 E;  3LZI A;  2OZM A;  3HGK E;  4EYW A;  4DTM A;  4EP9 A;  4M3Y A;  4FJL A;  1XU3 E;  3HL8 A;  3QEP A;  4DTO A;  4DTS A;  3C6N B;  1FZ1 E;  3L2O B;  4DTJ A;  3RMD A;  3K2O A;  4M3Z A;  3C6P B;  4DU4 A;  2VIX A;  3N1B A;  2LF3 A;  3RMB A;  4AKI A;  1XVC E;  4RG8 A;  2RCU A;  3SQ1 A;  2JH8 A;  3L0M A;  2MZW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...