2LF3A

Solution nmr structure of hoppmal_281_385 from pseudomonas syringae pv. maculicola str. es4326, midwest center for structural genomics target apc40104.5 and northeast structural genomics consortium target pst2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
SQRPVDRNPPRINLMPTGANRVAMRNRGNNEADAALQALAQNGINMEDLRAALEAYIVWLRPIPLDIANALEGVGITPRFDNPEEAKVDNPLMNLSSALKRRLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Effector protein hopAB3
publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16847 AvrPtoB_bdg Avirulence AvrPtoB, BAK1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf3A00
2LF6A 2LF3A 3TL8B
chains in the Genus database with same CATH superfamily
3RMDA 3SQ1A 4KHSA 1FZ5E 4I9QA 2JQTA 4FJNA 1XVGE 3TAFA 5H37A 1MMOG 4EPHA 4M3ZA 3LDSA 4X5MA 2JPNA 3RMBA 3NDKA 4DTSA 4AI6A 1IG9A 4E3SA 4AKIA 2DY4A 4IT5A 2LF3A 3SQ2A 2E31A 4M3XA 4JS5A 4AKGA 2JHCA 3BVOA 3C6PB 3OGLB 3NGIA 3SUOA 4FJ8A 1IH7A 4QNDA 3QEIA 3LD8A 3NHGA 3QEXA 3UIQA 3SVIA 4EP9A 3TJYA 2P1NB 1XVCE 2OVQB 4ADOA 4DU1A 3LZJA 2PFTA 2P1QB 3WSOA 1NEXB 4RL5A 4JS4A 3KD1E 3L8BA 4KHQA 3RWUA 4FK2A 3NCIA 5IBKB 4FVMA 1XU5E 2FW3A 3L0MA 4QNCA 4FJXA 3OGMB 2RKHA 4DTRA 3TAEA 3QEVA 3C94A 3K2OA 3QERA 3KD5E 4DTMA 3L2OB 3TABA 1FZ2E 1XVFE 1FZ3E 3SUQA 4HCCA 1FZ0E 3OGKB 4M3TA 2QXFA 3SPYA 2DEBA 1LDKE 2P1MB 2YB5A 3QNOA 1FS1A 2K5SA 2MZWB 4J2EA 2VJ4A 1FZ1E 3UO2A 3RMAA 3NE6A 2JH9A 3C6NB 5IREA 2H4TA 3E4WA 4JRPA 1FZ8E 3SPZA 2VIXA 4X5NA 2OYQA 3N1EA 4M41A 4M45A 1MHYG 2P1PB 3TL8B 3C6OB 4KI6A 3QNNA 4M3UA 1JW2A 4AKHA 3L1NA 4JRQA 1WAFA 1FZ9E 4FJHA 2DTUA 2OVPB 2PFVA 2FYOA 4J2DA 1XVBE 4B08A 3CFRA 4KHWA 4J2BA 2OZSA 1XVEE 2B1EA 3RMCA 1CLQA 3HL8A 4FJ7A 4M3RA 3SCXA 1FZ6E 2E32A 3CQ8A 4DTUA 4GAMC 1Q9XA 1MTYG 3SI6A 1FZHE 3E4YA 3SQ4A 1Q9YA 3LZIA 1FZIE 1XL3C 2MMBA 2RCUA 3J2PA 3SQ0A 4FJMA 3S9HA 1FXXA 4I6JB 4M3WA 1MHZG 3UO3A 4DTJA 1XMHE 3QETA 3N1BA 4FJLA 3HGKE 4FK0A 3SUNA 1WAJA 3SJJA 3HP9A 1FZ7E 4RNGA 3NAEA 4M3YA 4KHYA 5IZ7A 2P5OA 2OZMA 4RG8A 3V7DB 4DU3A 3QESA 3SUPA 3HGLA 4KHUA 4FJ5A 1XU3E 4FJ9A 2JHPA 3MKSB 4KI4A 3C95A 3CFPA 4HCBA 2OVRB 4J2AA 2ATQA 2B8IA 3CFOA 3QEPA 2P1OB 2B7MA 3J27A 4FJGA 4DU4A 1P22A 3SNNA 3LDBA 2LF6A 4FJJA 4DTPA 1XMGE 2JHAA 1XVDE 4DTXA 4ICGC 3TAGA 4M42A 4FJKA 4DTNA 2MW2A 4I9LA 4E4BA 2HD0A 4DTOA 1FZ4E 4FJIA 1FPOA 4FK4A 4ADNA 2P5GA 1XMFE 1FYZE 3QEWA 1N1CA 2JH8A 4KHNA 2VJ5A 4EYWA
chains in the Genus database with same CATH topology
3RMDA 3SQ1A 4KHSA 1FZ5E 4I9QA 4FJNA 1XVGE 3TAFA 5H37A 1MMOG 4EPHA 4M3ZA 3LDSA 4X5MA 2JPNA 3RMBA 3NDKA 4DTSA 4AI6A 1IG9A 4E3SA 4AKIA 2DY4A 2LF3A 3SQ2A 2E31A 4M3XA 4JS5A 4AKGA 2JHCA 3C6PB 3OGLB 3NGIA 3SUOA 4FJ8A 1IH7A 4QNDA 3QEIA 3LD8A 3NHGA 3QEXA 3UIQA 3SVIA 4EP9A 3TJYA 2P1NB 1XVCE 2OVQB 4ADOA 4DU1A 3LZJA 2PFTA 2P1QB 3WSOA 1NEXB 4RL5A 4JS4A 3KD1E 3L8BA 4KHQA 3RWUA 4FK2A 3NCIA 5IBKB 4FVMA 1XU5E 2FW3A 3L0MA 4QNCA 4FJXA 3OGMB 4DTRA 3TAEA 3QEVA 3C94A 3K2OA 3QERA 3KD5E 4DTMA 3L2OB 3TABA 1FZ2E 1XVFE 1FZ3E 3SUQA 4HCCA 1FZ0E 3OGKB 4M3TA 2QXFA 3SPYA 2DEBA 1LDKE 2P1MB 2YB5A 3QNOA 1FS1A 2MZWB 4J2EA 2VJ4A 1FZ1E 3RMAA 3NE6A 2JH9A 3C6NB 5IREA 2H4TA 3E4WA 4JRPA 1FZ8E 3SPZA 2VIXA 4X5NA 2OYQA 3N1EA 4M41A 4M45A 1MHYG 2P1PB 3TL8B 3C6OB 4KI6A 3QNNA 4M3UA 4AKHA 3L1NA 4JRQA 1WAFA 1FZ9E 4FJHA 2DTUA 2OVPB 2PFVA 2FYOA 4J2DA 1XVBE 4B08A 3CFRA 4KHWA 4J2BA 2OZSA 1XVEE 2B1EA 3RMCA 1CLQA 3HL8A 4FJ7A 4M3RA 3SCXA 1FZ6E 2E32A 3CQ8A 4DTUA 4GAMC 1Q9XA 1MTYG 3SI6A 1FZHE 3E4YA 3SQ4A 1Q9YA 3LZIA 1FZIE 1XL3C 2MMBA 2RCUA 3J2PA 3SQ0A 4FJMA 3S9HA 1FXXA 4I6JB 4M3WA 1MHZG 4DTJA 3QETA 1XMHE 3N1BA 4FJLA 3HGKE 4FK0A 3SUNA 1WAJA 3SJJA 3HP9A 1FZ7E 4RNGA 3NAEA 4M3YA 4KHYA 5IZ7A 2P5OA 2OZMA 4RG8A 3V7DB 4DU3A 3QESA 3SUPA 3HGLA 4KHUA 4FJ5A 1XU3E 4FJ9A 2JHPA 3MKSB 4KI4A 3C95A 3CFPA 4HCBA 2OVRB 4J2AA 2ATQA 2B8IA 3CFOA 3QEPA 2P1OB 2B7MA 3J27A 4FJGA 4DU4A 1P22A 3SNNA 3LDBA 2LF6A 4FJJA 4DTPA 1XMGE 2JHAA 1XVDE 4DTXA 3TAGA 4M42A 4FJKA 4DTNA 4I9LA 4E4BA 2HD0A 4DTOA 1FZ4E 4FJIA 4FK4A 4ADNA 2P5GA 1XMFE 1FYZE 3QEWA 2JH8A 4KHNA 2VJ5A 4EYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF6 A;  2LF3 A;  3TL8 B; 
#chains in the Genus database with same CATH topology
 3RMD A;  3SQ1 A;  4KHS A;  1FZ5 E;  4I9Q A;  2JQT A;  4FJN A;  1XVG E;  3TAF A;  5H37 A;  1MMO G;  4EPH A;  4M3Z A;  3LDS A;  4X5M A;  2JPN A;  3RMB A;  3NDK A;  4DTS A;  4AI6 A;  1IG9 A;  4E3S A;  4AKI A;  2DY4 A;  4IT5 A;  2LF3 A;  3SQ2 A;  2E31 A;  4M3X A;  4JS5 A;  4AKG A;  2JHC A;  3BVO A;  3C6P B;  3OGL B;  3NGI A;  3SUO A;  4FJ8 A;  1IH7 A;  4QND A;  3QEI A;  3LD8 A;  3NHG A;  3QEX A;  3UIQ A;  3SVI A;  4EP9 A;  3TJY A;  2P1N B;  1XVC E;  2OVQ B;  4ADO A;  4DU1 A;  3LZJ A;  2PFT A;  2P1Q B;  3WSO A;  1NEX B;  4RL5 A;  4JS4 A;  3KD1 E;  3L8B A;  4KHQ A;  3RWU A;  4FK2 A;  3NCI A;  5IBK B;  4FVM A;  1XU5 E;  2FW3 A;  3L0M A;  4QNC A;  4FJX A;  3OGM B;  2RKH A;  4DTR A;  3TAE A;  3QEV A;  3C94 A;  3K2O A;  3QER A;  3KD5 E;  4DTM A;  3L2O B;  3TAB A;  1FZ2 E;  1XVF E;  1FZ3 E;  3SUQ A;  4HCC A;  1FZ0 E;  3OGK B;  4M3T A;  2QXF A;  3SPY A;  2DEB A;  1LDK E;  2P1M B;  2YB5 A;  3QNO A;  1FS1 A;  2K5S A;  2MZW B;  4J2E A;  2VJ4 A;  1FZ1 E;  3UO2 A;  3RMA A;  3NE6 A;  2JH9 A;  3C6N B;  5IRE A;  2H4T A;  3E4W A;  4JRP A;  1FZ8 E;  3SPZ A;  2VIX A;  4X5N A;  2OYQ A;  3N1E A;  4M41 A;  4M45 A;  1MHY G;  2P1P B;  3TL8 B;  3C6O B;  4KI6 A;  3QNN A;  4M3U A;  1JW2 A;  4AKH A;  3L1N A;  4JRQ A;  1WAF A;  1FZ9 E;  4FJH A;  2DTU A;  2OVP B;  2PFV A;  2FYO A;  4J2D A;  1XVB E;  4B08 A;  3CFR A;  4KHW A;  4J2B A;  2OZS A;  1XVE E;  2B1E A;  3RMC A;  1CLQ A;  3HL8 A;  4FJ7 A;  4M3R A;  3SCX A;  1FZ6 E;  2E32 A;  3CQ8 A;  4DTU A;  4GAM C;  1Q9X A;  1MTY G;  3SI6 A;  1FZH E;  3E4Y A;  3SQ4 A;  1Q9Y A;  3LZI A;  1FZI E;  1XL3 C;  2MMB A;  2RCU A;  3J2P A;  3SQ0 A;  4FJM A;  3S9H A;  1FXX A;  4I6J B;  4M3W A;  1MHZ G;  3UO3 A;  4DTJ A;  1XMH E;  3QET A;  3N1B A;  4FJL A;  3HGK E;  4FK0 A;  3SUN A;  1WAJ A;  3SJJ A;  3HP9 A;  1FZ7 E;  4RNG A;  3NAE A;  4M3Y A;  4KHY A;  5IZ7 A;  2P5O A;  2OZM A;  4RG8 A;  3V7D B;  4DU3 A;  3QES A;  3SUP A;  3HGL A;  4KHU A;  4FJ5 A;  1XU3 E;  4FJ9 A;  2JHP A;  3MKS B;  4KI4 A;  3C95 A;  3CFP A;  4HCB A;  2OVR B;  4J2A A;  2ATQ A;  2B8I A;  3CFO A;  3QEP A;  2P1O B;  2B7M A;  3J27 A;  4FJG A;  4DU4 A;  1P22 A;  3SNN A;  3LDB A;  2LF6 A;  4FJJ A;  4DTP A;  1XMG E;  2JHA A;  1XVD E;  4DTX A;  4ICG C;  3TAG A;  4M42 A;  4FJK A;  4DTN A;  2MW2 A;  4I9L A;  4E4B A;  2HD0 A;  4DTO A;  1FZ4 E;  4FJI A;  1FPO A;  4FK4 A;  4ADN A;  2P5G A;  1XMF E;  1FYZ E;  3QEW A;  1N1C A;  2JH8 A;  4KHN A;  2VJ5 A;  4EYW A; 
#chains in the Genus database with same CATH homology
 3RMD A;  3SQ1 A;  4KHS A;  1FZ5 E;  4I9Q A;  4FJN A;  1XVG E;  3TAF A;  5H37 A;  1MMO G;  4EPH A;  4M3Z A;  3LDS A;  4X5M A;  2JPN A;  3RMB A;  3NDK A;  4DTS A;  4AI6 A;  1IG9 A;  4E3S A;  4AKI A;  2DY4 A;  2LF3 A;  3SQ2 A;  2E31 A;  4M3X A;  4JS5 A;  4AKG A;  2JHC A;  3C6P B;  3OGL B;  3NGI A;  3SUO A;  4FJ8 A;  1IH7 A;  4QND A;  3QEI A;  3LD8 A;  3NHG A;  3QEX A;  3UIQ A;  3SVI A;  4EP9 A;  3TJY A;  2P1N B;  1XVC E;  2OVQ B;  4ADO A;  4DU1 A;  3LZJ A;  2PFT A;  2P1Q B;  3WSO A;  1NEX B;  4RL5 A;  4JS4 A;  3KD1 E;  3L8B A;  4KHQ A;  3RWU A;  4FK2 A;  3NCI A;  5IBK B;  4FVM A;  1XU5 E;  2FW3 A;  3L0M A;  4QNC A;  4FJX A;  3OGM B;  4DTR A;  3TAE A;  3QEV A;  3C94 A;  3K2O A;  3QER A;  3KD5 E;  4DTM A;  3L2O B;  3TAB A;  1FZ2 E;  1XVF E;  1FZ3 E;  3SUQ A;  4HCC A;  1FZ0 E;  3OGK B;  4M3T A;  2QXF A;  3SPY A;  2DEB A;  1LDK E;  2P1M B;  2YB5 A;  3QNO A;  1FS1 A;  2MZW B;  4J2E A;  2VJ4 A;  1FZ1 E;  3RMA A;  3NE6 A;  2JH9 A;  3C6N B;  5IRE A;  2H4T A;  3E4W A;  4JRP A;  1FZ8 E;  3SPZ A;  2VIX A;  4X5N A;  2OYQ A;  3N1E A;  4M41 A;  4M45 A;  1MHY G;  2P1P B;  3TL8 B;  3C6O B;  4KI6 A;  3QNN A;  4M3U A;  4AKH A;  3L1N A;  4JRQ A;  1WAF A;  1FZ9 E;  4FJH A;  2DTU A;  2OVP B;  2PFV A;  2FYO A;  4J2D A;  1XVB E;  4B08 A;  3CFR A;  4KHW A;  4J2B A;  2OZS A;  1XVE E;  2B1E A;  3RMC A;  1CLQ A;  3HL8 A;  4FJ7 A;  4M3R A;  3SCX A;  1FZ6 E;  2E32 A;  3CQ8 A;  4DTU A;  4GAM C;  1Q9X A;  1MTY G;  3SI6 A;  1FZH E;  3E4Y A;  3SQ4 A;  1Q9Y A;  3LZI A;  1FZI E;  1XL3 C;  2MMB A;  2RCU A;  3J2P A;  3SQ0 A;  4FJM A;  3S9H A;  1FXX A;  4I6J B;  4M3W A;  1MHZ G;  4DTJ A;  3QET A;  1XMH E;  3N1B A;  4FJL A;  3HGK E;  4FK0 A;  3SUN A;  1WAJ A;  3SJJ A;  3HP9 A;  1FZ7 E;  4RNG A;  3NAE A;  4M3Y A;  4KHY A;  5IZ7 A;  2P5O A;  2OZM A;  4RG8 A;  3V7D B;  4DU3 A;  3QES A;  3SUP A;  3HGL A;  4KHU A;  4FJ5 A;  1XU3 E;  4FJ9 A;  2JHP A;  3MKS B;  4KI4 A;  3C95 A;  3CFP A;  4HCB A;  2OVR B;  4J2A A;  2ATQ A;  2B8I A;  3CFO A;  3QEP A;  2P1O B;  2B7M A;  3J27 A;  4FJG A;  4DU4 A;  1P22 A;  3SNN A;  3LDB A;  2LF6 A;  4FJJ A;  4DTP A;  1XMG E;  2JHA A;  1XVD E;  4DTX A;  3TAG A;  4M42 A;  4FJK A;  4DTN A;  4I9L A;  4E4B A;  2HD0 A;  4DTO A;  1FZ4 E;  4FJI A;  4FK4 A;  4ADN A;  2P5G A;  1XMF E;  1FYZ E;  3QEW A;  2JH8 A;  4KHN A;  2VJ5 A;  4EYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...