2LF3A

Solution nmr structure of hoppmal_281_385 from pseudomonas syringae pv. maculicola str. es4326, midwest center for structural genomics target apc40104.5 and northeast structural genomics consortium target pst2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
SQRPVDRNPPRINLMPTGANRVAMRNRGNNEADAALQALAQNGINMEDLRAALEAYIVWLRPIPLDIANALEGVGITPRFDNPEEAKVDNPLMNLSSALKRRLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Effector protein hopAB3
publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16847 AvrPtoB_bdg Avirulence AvrPtoB, BAK1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf3A00
2LF3A 2LF6A 3TL8B
chains in the Genus database with same CATH superfamily
3OGKB 4FJ8A 2JH8A 1XVDE 4ADOA 3SJJA 2QXFA 4RNGA 3TAEA 1Q9XA 2VIXA 4QNCA 2DEBA 4KI4A 3QEXA 3J2PA 3QEWA 4DU1A 2FYOA 5IZ7A 3SI6A 2OZMA 4KHSA 2OZSA 5IBKB 3NE6A 2P1PB 5IREA 3L0MA 4JRPA 4JS5A 2P5GA 3E4WA 3SUQA 4DTNA 3QERA 4J2EA 1CLQA 1Q9YA 4DTRA 4FK4A 2RKHA 3NAEA 3CFRA 3CFPA 4QNDA 3QEVA 3SQ0A 4FJ7A 4FJXA 4RG8A 3SUPA 2MW2A 4KI6A 3LDBA 3S9HA 2P1OB 3K2OA 4E4BA 4DTUA 3SUOA 4HCBA 4DTOA 3QEIA 3TAGA 1XVFE 1FS1A 2ATQA 2FW3A 2P5OA 2E31A 1XU5E 3HL8A 3L8BA 3RMCA 3HP9A 4FJGA 4FJLA 4EP9A 2P1QB 3UIQA 4M3TA 3SNNA 1FZ2E 3QESA 4DTSA 4I9QA 2MMBA 4KHYA 2E32A 1WAFA 3SUNA 1FZ0E 3QETA 4J2DA 1N1CA 2LF6A 3C6OB 3L1NA 3LDSA 4DU4A 1FZIE 4J2AA 4KHQA 4FJKA 3TL8B 4J2BA 3SVIA 3C95A 4M41A 3MKSB 4I6JB 4FJ9A 1FZ4E 2JQTA 2PFVA 4M3YA 3L2OB 1XVCE 4EYWA 3UO3A 2OVQB 2P1MB 1WAJA 3C6NB 4FVMA 3NGIA 1FZ5E 1XVGE 1FZ3E 2B7MA 3LZIA 2YB5A 4FJJA 2JH9A 4AI6A 1MMOG 4FJHA 2JHPA 4B08A 5H37A 2H4TA 4DTPA 3CFOA 3QEPA 1XVBE 4HCCA 4FK2A 3SQ2A 2B8IA 4M3WA 2VJ4A 3SQ1A 1MHYG 1MTYG 3OGLB 3HGKE 4I9LA 4FK0A 3LZJA 1XMFE 3C94A 2VJ5A 2JHCA 2LF3A 4JRQA 3BVOA 3E4YA 4KHWA 4KHNA 3C6PB 2RCUA 4M42A 3LD8A 1FXXA 1XMGE 2B1EA 1NEXB 2K5SA 3SPZA 2DY4A 1FPOA 3UO2A 3SQ4A 2DTUA 4M3RA 1FZ8E 3QNNA 3KD1E 1FZ6E 4AKHA 4AKGA 3TAFA 4ADNA 4JS4A 4EPHA 4RL5A 2OVRB 1FZ7E 4E3SA 4AKIA 3RWUA 3TJYA 2PFTA 4FJ5A 2JPNA 3SCXA 3RMAA 3SPYA 4M3XA 4FJIA 4FJMA 1FZ1E 3J27A 3OGMB 3TABA 3NHGA 3V7DB 4DTJA 2OYQA 4KHUA 3QNOA 1FZ9E 1JW2A 3HGLA 4X5NA 1XMHE 4DU3A 3RMBA 4FJNA 3KD5E 3N1BA 3RMDA 3WSOA 1P22A 1LDKE 3NDKA 3CQ8A 2P1NB 4M3ZA 4X5MA 1XU3E 4GAMC 1IG9A 2MZWB 1XVEE 2JHAA 3NCIA 4DTMA 4M3UA 1XL3C 4ICGC 1FYZE 4DTXA 2OVPB 4M45A 1FZHE 1IH7A 1MHZG 3N1EA 4IT5A 2HD0A
chains in the Genus database with same CATH topology
3OGKB 4FJ8A 2JH8A 1XVDE 4ADOA 3SJJA 2QXFA 4RNGA 3TAEA 1Q9XA 2VIXA 4QNCA 2DEBA 4KI4A 3QEXA 3J2PA 3QEWA 4DU1A 2FYOA 5IZ7A 3SI6A 2OZMA 4KHSA 2OZSA 5IBKB 3NE6A 2P1PB 5IREA 3L0MA 4JRPA 4JS5A 2P5GA 3E4WA 3SUQA 4DTNA 3QERA 4J2EA 1CLQA 1Q9YA 4DTRA 4FK4A 3NAEA 3CFRA 3CFPA 3QEVA 4QNDA 3SQ0A 4FJ7A 4FJXA 4RG8A 3SUPA 4KI6A 3LDBA 3S9HA 2P1OB 3K2OA 4E4BA 4DTUA 3SUOA 4HCBA 4DTOA 3QEIA 3TAGA 1XVFE 1FS1A 2ATQA 2FW3A 2P5OA 2E31A 1XU5E 3HL8A 3L8BA 3RMCA 3HP9A 4FJGA 4FJLA 4EP9A 2P1QB 3UIQA 4M3TA 3SNNA 1FZ2E 3QESA 4DTSA 4I9QA 2MMBA 4KHYA 2E32A 1WAFA 3SUNA 1FZ0E 3QETA 4J2DA 2LF6A 3C6OB 3L1NA 3LDSA 4DU4A 1FZIE 4J2AA 4KHQA 4FJKA 3TL8B 4J2BA 3SVIA 3C95A 4M41A 3MKSB 4I6JB 4FJ9A 1FZ4E 4M3YA 2PFVA 3L2OB 1XVCE 4EYWA 2OVQB 2P1MB 1WAJA 3C6NB 4FVMA 3NGIA 1FZ5E 1XVGE 1FZ3E 2B7MA 3LZIA 2YB5A 4FJJA 2JH9A 4AI6A 1MMOG 4FJHA 2JHPA 4B08A 5H37A 2H4TA 4DTPA 3CFOA 3QEPA 1XVBE 4HCCA 4FK2A 3SQ2A 2B8IA 4M3WA 2VJ4A 3SQ1A 1MHYG 1MTYG 3OGLB 3HGKE 4I9LA 4FK0A 3LZJA 1XMFE 3C94A 2VJ5A 2JHCA 2LF3A 4JRQA 4M42A 3E4YA 4KHWA 4KHNA 3C6PB 2RCUA 3LD8A 1FXXA 1XMGE 2B1EA 1NEXB 3SPZA 2DY4A 3SQ4A 2DTUA 4M3RA 1FZ8E 3QNNA 3KD1E 1FZ6E 4AKHA 4AKGA 3TAFA 4ADNA 4JS4A 4EPHA 4RL5A 2OVRB 1FZ7E 4E3SA 4AKIA 3RWUA 3TJYA 2PFTA 4FJ5A 2JPNA 3SCXA 3RMAA 3SPYA 4M3XA 4FJIA 4FJMA 1FZ1E 3J27A 3OGMB 3TABA 3NHGA 3V7DB 4DTJA 2OYQA 4KHUA 3QNOA 1FZ9E 3HGLA 4X5NA 1XMHE 4DU3A 3RMBA 4FJNA 3KD5E 3N1BA 3RMDA 3WSOA 1P22A 1LDKE 3NDKA 3CQ8A 2P1NB 4M3ZA 4X5MA 1XU3E 4GAMC 1IG9A 2MZWB 1XVEE 2JHAA 3NCIA 4DTMA 4M3UA 1XL3C 1FYZE 4DTXA 2OVPB 4M45A 1FZHE 1IH7A 1MHZG 3N1EA 2HD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF3 A;  2LF6 A;  3TL8 B; 
#chains in the Genus database with same CATH topology
 3OGK B;  4FJ8 A;  2JH8 A;  1XVD E;  4ADO A;  3SJJ A;  2QXF A;  4RNG A;  3TAE A;  1Q9X A;  2VIX A;  4QNC A;  2DEB A;  4KI4 A;  3QEX A;  3J2P A;  3QEW A;  4DU1 A;  2FYO A;  5IZ7 A;  3SI6 A;  2OZM A;  4KHS A;  2OZS A;  5IBK B;  3NE6 A;  2P1P B;  5IRE A;  3L0M A;  4JRP A;  4JS5 A;  2P5G A;  3E4W A;  3SUQ A;  4DTN A;  3QER A;  4J2E A;  1CLQ A;  1Q9Y A;  4DTR A;  4FK4 A;  2RKH A;  3NAE A;  3CFR A;  3CFP A;  4QND A;  3QEV A;  3SQ0 A;  4FJ7 A;  4FJX A;  4RG8 A;  3SUP A;  2MW2 A;  4KI6 A;  3LDB A;  3S9H A;  2P1O B;  3K2O A;  4E4B A;  4DTU A;  3SUO A;  4HCB A;  4DTO A;  3QEI A;  3TAG A;  1XVF E;  1FS1 A;  2ATQ A;  2FW3 A;  2P5O A;  2E31 A;  1XU5 E;  3HL8 A;  3L8B A;  3RMC A;  3HP9 A;  4FJG A;  4FJL A;  4EP9 A;  2P1Q B;  3UIQ A;  4M3T A;  3SNN A;  1FZ2 E;  3QES A;  4DTS A;  4I9Q A;  2MMB A;  4KHY A;  2E32 A;  1WAF A;  3SUN A;  1FZ0 E;  3QET A;  4J2D A;  1N1C A;  2LF6 A;  3C6O B;  3L1N A;  3LDS A;  4DU4 A;  1FZI E;  4J2A A;  4KHQ A;  4FJK A;  3TL8 B;  4J2B A;  3SVI A;  3C95 A;  4M41 A;  3MKS B;  4I6J B;  4FJ9 A;  1FZ4 E;  2JQT A;  2PFV A;  4M3Y A;  3L2O B;  1XVC E;  4EYW A;  3UO3 A;  2OVQ B;  2P1M B;  1WAJ A;  3C6N B;  4FVM A;  3NGI A;  1FZ5 E;  1XVG E;  1FZ3 E;  2B7M A;  3LZI A;  2YB5 A;  4FJJ A;  2JH9 A;  4AI6 A;  1MMO G;  4FJH A;  2JHP A;  4B08 A;  5H37 A;  2H4T A;  4DTP A;  3CFO A;  3QEP A;  1XVB E;  4HCC A;  4FK2 A;  3SQ2 A;  2B8I A;  4M3W A;  2VJ4 A;  3SQ1 A;  1MHY G;  1MTY G;  3OGL B;  3HGK E;  4I9L A;  4FK0 A;  3LZJ A;  1XMF E;  3C94 A;  2VJ5 A;  2JHC A;  2LF3 A;  4JRQ A;  3BVO A;  3E4Y A;  4KHW A;  4KHN A;  3C6P B;  2RCU A;  4M42 A;  3LD8 A;  1FXX A;  1XMG E;  2B1E A;  1NEX B;  2K5S A;  3SPZ A;  2DY4 A;  1FPO A;  3UO2 A;  3SQ4 A;  2DTU A;  4M3R A;  1FZ8 E;  3QNN A;  3KD1 E;  1FZ6 E;  4AKH A;  4AKG A;  3TAF A;  4ADN A;  4JS4 A;  4EPH A;  4RL5 A;  2OVR B;  1FZ7 E;  4E3S A;  4AKI A;  3RWU A;  3TJY A;  2PFT A;  4FJ5 A;  2JPN A;  3SCX A;  3RMA A;  3SPY A;  4M3X A;  4FJI A;  4FJM A;  1FZ1 E;  3J27 A;  3OGM B;  3TAB A;  3NHG A;  3V7D B;  4DTJ A;  2OYQ A;  4KHU A;  3QNO A;  1FZ9 E;  1JW2 A;  3HGL A;  4X5N A;  1XMH E;  4DU3 A;  3RMB A;  4FJN A;  3KD5 E;  3N1B A;  3RMD A;  3WSO A;  1P22 A;  1LDK E;  3NDK A;  3CQ8 A;  2P1N B;  4M3Z A;  4X5M A;  1XU3 E;  4GAM C;  1IG9 A;  2MZW B;  1XVE E;  2JHA A;  3NCI A;  4DTM A;  4M3U A;  1XL3 C;  4ICG C;  1FYZ E;  4DTX A;  2OVP B;  4M45 A;  1FZH E;  1IH7 A;  1MHZ G;  3N1E A;  4IT5 A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 3OGK B;  4FJ8 A;  2JH8 A;  1XVD E;  4ADO A;  3SJJ A;  2QXF A;  4RNG A;  3TAE A;  1Q9X A;  2VIX A;  4QNC A;  2DEB A;  4KI4 A;  3QEX A;  3J2P A;  3QEW A;  4DU1 A;  2FYO A;  5IZ7 A;  3SI6 A;  2OZM A;  4KHS A;  2OZS A;  5IBK B;  3NE6 A;  2P1P B;  5IRE A;  3L0M A;  4JRP A;  4JS5 A;  2P5G A;  3E4W A;  3SUQ A;  4DTN A;  3QER A;  4J2E A;  1CLQ A;  1Q9Y A;  4DTR A;  4FK4 A;  3NAE A;  3CFR A;  3CFP A;  3QEV A;  4QND A;  3SQ0 A;  4FJ7 A;  4FJX A;  4RG8 A;  3SUP A;  4KI6 A;  3LDB A;  3S9H A;  2P1O B;  3K2O A;  4E4B A;  4DTU A;  3SUO A;  4HCB A;  4DTO A;  3QEI A;  3TAG A;  1XVF E;  1FS1 A;  2ATQ A;  2FW3 A;  2P5O A;  2E31 A;  1XU5 E;  3HL8 A;  3L8B A;  3RMC A;  3HP9 A;  4FJG A;  4FJL A;  4EP9 A;  2P1Q B;  3UIQ A;  4M3T A;  3SNN A;  1FZ2 E;  3QES A;  4DTS A;  4I9Q A;  2MMB A;  4KHY A;  2E32 A;  1WAF A;  3SUN A;  1FZ0 E;  3QET A;  4J2D A;  2LF6 A;  3C6O B;  3L1N A;  3LDS A;  4DU4 A;  1FZI E;  4J2A A;  4KHQ A;  4FJK A;  3TL8 B;  4J2B A;  3SVI A;  3C95 A;  4M41 A;  3MKS B;  4I6J B;  4FJ9 A;  1FZ4 E;  4M3Y A;  2PFV A;  3L2O B;  1XVC E;  4EYW A;  2OVQ B;  2P1M B;  1WAJ A;  3C6N B;  4FVM A;  3NGI A;  1FZ5 E;  1XVG E;  1FZ3 E;  2B7M A;  3LZI A;  2YB5 A;  4FJJ A;  2JH9 A;  4AI6 A;  1MMO G;  4FJH A;  2JHP A;  4B08 A;  5H37 A;  2H4T A;  4DTP A;  3CFO A;  3QEP A;  1XVB E;  4HCC A;  4FK2 A;  3SQ2 A;  2B8I A;  4M3W A;  2VJ4 A;  3SQ1 A;  1MHY G;  1MTY G;  3OGL B;  3HGK E;  4I9L A;  4FK0 A;  3LZJ A;  1XMF E;  3C94 A;  2VJ5 A;  2JHC A;  2LF3 A;  4JRQ A;  4M42 A;  3E4Y A;  4KHW A;  4KHN A;  3C6P B;  2RCU A;  3LD8 A;  1FXX A;  1XMG E;  2B1E A;  1NEX B;  3SPZ A;  2DY4 A;  3SQ4 A;  2DTU A;  4M3R A;  1FZ8 E;  3QNN A;  3KD1 E;  1FZ6 E;  4AKH A;  4AKG A;  3TAF A;  4ADN A;  4JS4 A;  4EPH A;  4RL5 A;  2OVR B;  1FZ7 E;  4E3S A;  4AKI A;  3RWU A;  3TJY A;  2PFT A;  4FJ5 A;  2JPN A;  3SCX A;  3RMA A;  3SPY A;  4M3X A;  4FJI A;  4FJM A;  1FZ1 E;  3J27 A;  3OGM B;  3TAB A;  3NHG A;  3V7D B;  4DTJ A;  2OYQ A;  4KHU A;  3QNO A;  1FZ9 E;  3HGL A;  4X5N A;  1XMH E;  4DU3 A;  3RMB A;  4FJN A;  3KD5 E;  3N1B A;  3RMD A;  3WSO A;  1P22 A;  1LDK E;  3NDK A;  3CQ8 A;  2P1N B;  4M3Z A;  4X5M A;  1XU3 E;  4GAM C;  1IG9 A;  2MZW B;  1XVE E;  2JHA A;  3NCI A;  4DTM A;  4M3U A;  1XL3 C;  1FYZ E;  4DTX A;  2OVP B;  4M45 A;  1FZH E;  1IH7 A;  1MHZ G;  3N1E A;  2HD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...