2LF3A

Solution nmr structure of hoppmal_281_385 from pseudomonas syringae pv. maculicola str. es4326, midwest center for structural genomics target apc40104.5 and northeast structural genomics consortium target pst2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
SQRPVDRNPPRINLMPTGANRVAMRNRGNNEADAALQALAQNGINMEDLRAALEAYIVWLRPIPLDIANALEGVGITPRFDNPEEAKVDNPLMNLSSALKRRLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
molecule keywords Effector protein hopAB3
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16847 AvrPtoB_bdg Avirulence AvrPtoB, BAK1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf3A00
2LF3A 3TL8B 2LF6A
chains in the Genus database with same CATH superfamily
3MKSB 2OVPB 1XMHE 3C95A 5IREA 4JRQA 3UO3A 4M3WA 3RMAA 2MZWB 3QNNA 3RMBA 3SPZA 2MW2A 1XU3E 3SQ4A 3TAFA 4M3UA 3RMDA 4DU1A 4J2DA 3BVOA 4HCCA 2P1NB 4M3ZA 1FZ0E 3SQ2A 1JW2A 3SCXA 1FZ3E 4RG8A 3KD5E 2VJ4A 1FZ8E 2FW3A 3LDBA 3SPYA 1XVDE 4FK0A 1NEXB 4KHSA 1XU5E 2B8IA 2E32A 4QNDA 3CFPA 4FJJA 3QEVA 2OVQB 3TAEA 2P5GA 3L2OB 4DTUA 3C94A 3E4YA 4DTRA 4DTOA 3QEPA 4M3YA 3J2PA 3CFOA 4FJXA 4AKHA 4I9LA 2FYOA 2P1OB 2P1PB 1FZ4E 1LDKE 1MMOG 2MMBA 4FJLA 3S9HA 3K2OA 4EYWA 4DTPA 3N1EA 3SUOA 3C6NB 4DTNA 4FJ5A 4RL5A 3UO2A 4GAMC 4E4BA 1N1CA 4X5NA 4E3SA 3SUPA 1FZ7E 2OZSA 2LF3A 3L1NA 3J27A 3L0MA 2HD0A 1CLQA 4KHUA 3OGLB 2JQTA 4FJ8A 2DTUA 3SNNA 5H37A 4FK4A 2B7MA 2JHCA 2VIXA 3LDSA 2ATQA 3RMCA 3QNOA 3SQ1A 2LF6A 2K5SA 3N1BA 4FVMA 4DTSA 4ICGC 3NAEA 3QEXA 3E4WA 2OYQA 2DEBA 4I9QA 3SJJA 1IG9A 3HGLA 1FZ9E 2OZMA 3CFRA 4FJHA 4KHWA 4M45A 1P22A 3UIQA 3SUQA 1XVBE 3RWUA 4B08A 3SUNA 3L8BA 4DTMA 4RNGA 1FZ2E 4J2AA 3HL8A 3NHGA 4M3TA 4AI6A 3QEWA 4FJKA 3QEIA 3NE6A 2RKHA 1XVCE 4JRPA 1XVGE 1XMFE 1FPOA 2PFTA 3SVIA 4JS4A 4DTXA 3HP9A 4FJIA 1XVEE 3TL8B 4FK2A 1WAJA 3KD1E 4EP9A 3LZIA 4IT5A 4FJ7A 2JPNA 4QNCA 4M41A 2E31A 1WAFA 3TAGA 3V7DB 4AKGA 3C6OB 3SI6A 2RCUA 1MHZG 3TJYA 2JHPA 4DU4A 4KI4A 1Q9XA 2YB5A 3C6PB 4J2EA 1FZ6E 2JHAA 4DTJA 1MHYG 4EPHA 5IZ7A 1FZ1E 4FJ9A 1Q9YA 4J2BA 4FJMA 1FXXA 4KI6A 4ADOA 2H4TA 4KHNA 1MTYG 1XL3C 4ADNA 3NDKA 4JS5A 2P1QB 4M3RA 3TABA 4I6JB 4AKIA 1FS1A 1FZHE 1FZ5E 3WSOA 3LZJA 1XVFE 2QXFA 3OGMB 2JH9A 3QERA 3LD8A 2P5OA 2DY4A 2VJ5A 4FJGA 3HGKE 3QETA 2B1EA 3NCIA 3QESA 4FJNA 4M3XA 1IH7A 2OVRB 3CQ8A 4X5MA 2JH8A 3SQ0A 4KHQA 1FYZE 2P1MB 4HCBA 4KHYA 1XMGE 3OGKB 4DU3A 4M42A 3NGIA 2PFVA 1FZIE 5IBKB
chains in the Genus database with same CATH topology
3MKSB 2OVPB 1XMHE 3C95A 5IREA 4JRQA 4M3WA 3RMAA 2MZWB 3QNNA 3RMBA 3SPZA 1XU3E 3SQ4A 3TAFA 4M3UA 3RMDA 4DU1A 4J2DA 4HCCA 4M3ZA 2P1NB 1FZ0E 3SQ2A 3SCXA 1FZ3E 4RG8A 3KD5E 2VJ4A 1FZ8E 2FW3A 3LDBA 3SPYA 1XVDE 4FK0A 1NEXB 4KHSA 1XU5E 2B8IA 2E32A 4QNDA 3CFPA 4FJJA 3QEVA 2OVQB 3TAEA 2P5GA 3L2OB 4DTUA 3C94A 3E4YA 4DTRA 4DTOA 3QEPA 4M3YA 3J2PA 3CFOA 4FJXA 4AKHA 4I9LA 2FYOA 2P1OB 2P1PB 1FZ4E 1LDKE 1MMOG 2MMBA 4FJLA 3S9HA 3K2OA 4EYWA 4DTPA 3N1EA 3SUOA 3C6NB 4DTNA 4FJ5A 4RL5A 4GAMC 4E4BA 4E3SA 4X5NA 3SUPA 1FZ7E 2OZSA 2LF3A 3L1NA 3J27A 3L0MA 2HD0A 1CLQA 4KHUA 3OGLB 4FJ8A 2DTUA 3SNNA 5H37A 4FK4A 2B7MA 2JHCA 2VIXA 3LDSA 2ATQA 3RMCA 3QNOA 3SQ1A 2LF6A 3N1BA 4FVMA 4DTSA 3QEXA 3NAEA 2OYQA 3E4WA 2DEBA 4I9QA 3SJJA 1IG9A 3HGLA 1FZ9E 2OZMA 3CFRA 4FJHA 4KHWA 4M45A 1P22A 3UIQA 3SUQA 1XVBE 3RWUA 4B08A 3SUNA 3L8BA 4DTMA 4RNGA 1FZ2E 4J2AA 3HL8A 3NHGA 4M3TA 4AI6A 3QEWA 4FJKA 3QEIA 3NE6A 1XVCE 4JRPA 1XVGE 1XMFE 2PFTA 3SVIA 4JS4A 4DTXA 3HP9A 4FJIA 1XVEE 3TL8B 4FK2A 1WAJA 3KD1E 4EP9A 3LZIA 4FJ7A 2JPNA 4QNCA 4M41A 2E31A 1WAFA 3TAGA 3V7DB 4AKGA 3C6OB 3SI6A 2RCUA 1MHZG 3TJYA 2JHPA 4DU4A 4KI4A 1Q9XA 2YB5A 3C6PB 4J2EA 1FZ6E 2JHAA 4DTJA 1MHYG 4EPHA 5IZ7A 1FZ1E 4FJ9A 1Q9YA 4J2BA 4FJMA 1FXXA 4KI6A 4ADOA 2H4TA 4KHNA 1MTYG 1XL3C 4ADNA 3NDKA 4JS5A 2P1QB 4M3RA 3TABA 4I6JB 4AKIA 1FS1A 1FZHE 1FZ5E 3WSOA 3LZJA 1XVFE 2QXFA 3OGMB 2JH9A 3QERA 3LD8A 2P5OA 2DY4A 2VJ5A 4FJGA 3HGKE 3QETA 2B1EA 3NCIA 3QESA 4FJNA 4M3XA 1IH7A 2OVRB 3CQ8A 4X5MA 2JH8A 3SQ0A 4KHQA 1FYZE 2P1MB 4HCBA 4KHYA 1XMGE 3OGKB 4DU3A 4M42A 3NGIA 2PFVA 1FZIE 5IBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF3 A;  3TL8 B;  2LF6 A; 
#chains in the Genus database with same CATH topology
 3MKS B;  2OVP B;  1XMH E;  3C95 A;  5IRE A;  4JRQ A;  3UO3 A;  4M3W A;  3RMA A;  2MZW B;  3QNN A;  3RMB A;  3SPZ A;  2MW2 A;  1XU3 E;  3SQ4 A;  3TAF A;  4M3U A;  3RMD A;  4DU1 A;  4J2D A;  3BVO A;  4HCC A;  2P1N B;  4M3Z A;  1FZ0 E;  3SQ2 A;  1JW2 A;  3SCX A;  1FZ3 E;  4RG8 A;  3KD5 E;  2VJ4 A;  1FZ8 E;  2FW3 A;  3LDB A;  3SPY A;  1XVD E;  4FK0 A;  1NEX B;  4KHS A;  1XU5 E;  2B8I A;  2E32 A;  4QND A;  3CFP A;  4FJJ A;  3QEV A;  2OVQ B;  3TAE A;  2P5G A;  3L2O B;  4DTU A;  3C94 A;  3E4Y A;  4DTR A;  4DTO A;  3QEP A;  4M3Y A;  3J2P A;  3CFO A;  4FJX A;  4AKH A;  4I9L A;  2FYO A;  2P1O B;  2P1P B;  1FZ4 E;  1LDK E;  1MMO G;  2MMB A;  4FJL A;  3S9H A;  3K2O A;  4EYW A;  4DTP A;  3N1E A;  3SUO A;  3C6N B;  4DTN A;  4FJ5 A;  4RL5 A;  3UO2 A;  4GAM C;  4E4B A;  1N1C A;  4X5N A;  4E3S A;  3SUP A;  1FZ7 E;  2OZS A;  2LF3 A;  3L1N A;  3J27 A;  3L0M A;  2HD0 A;  1CLQ A;  4KHU A;  3OGL B;  2JQT A;  4FJ8 A;  2DTU A;  3SNN A;  5H37 A;  4FK4 A;  2B7M A;  2JHC A;  2VIX A;  3LDS A;  2ATQ A;  3RMC A;  3QNO A;  3SQ1 A;  2LF6 A;  2K5S A;  3N1B A;  4FVM A;  4DTS A;  4ICG C;  3NAE A;  3QEX A;  3E4W A;  2OYQ A;  2DEB A;  4I9Q A;  3SJJ A;  1IG9 A;  3HGL A;  1FZ9 E;  2OZM A;  3CFR A;  4FJH A;  4KHW A;  4M45 A;  1P22 A;  3UIQ A;  3SUQ A;  1XVB E;  3RWU A;  4B08 A;  3SUN A;  3L8B A;  4DTM A;  4RNG A;  1FZ2 E;  4J2A A;  3HL8 A;  3NHG A;  4M3T A;  4AI6 A;  3QEW A;  4FJK A;  3QEI A;  3NE6 A;  2RKH A;  1XVC E;  4JRP A;  1XVG E;  1XMF E;  1FPO A;  2PFT A;  3SVI A;  4JS4 A;  4DTX A;  3HP9 A;  4FJI A;  1XVE E;  3TL8 B;  4FK2 A;  1WAJ A;  3KD1 E;  4EP9 A;  3LZI A;  4IT5 A;  4FJ7 A;  2JPN A;  4QNC A;  4M41 A;  2E31 A;  1WAF A;  3TAG A;  3V7D B;  4AKG A;  3C6O B;  3SI6 A;  2RCU A;  1MHZ G;  3TJY A;  2JHP A;  4DU4 A;  4KI4 A;  1Q9X A;  2YB5 A;  3C6P B;  4J2E A;  1FZ6 E;  2JHA A;  4DTJ A;  1MHY G;  4EPH A;  5IZ7 A;  1FZ1 E;  4FJ9 A;  1Q9Y A;  4J2B A;  4FJM A;  1FXX A;  4KI6 A;  4ADO A;  2H4T A;  4KHN A;  1MTY G;  1XL3 C;  4ADN A;  3NDK A;  4JS5 A;  2P1Q B;  4M3R A;  3TAB A;  4I6J B;  4AKI A;  1FS1 A;  1FZH E;  1FZ5 E;  3WSO A;  3LZJ A;  1XVF E;  2QXF A;  3OGM B;  2JH9 A;  3QER A;  3LD8 A;  2P5O A;  2DY4 A;  2VJ5 A;  4FJG A;  3HGK E;  3QET A;  2B1E A;  3NCI A;  3QES A;  4FJN A;  4M3X A;  1IH7 A;  2OVR B;  3CQ8 A;  4X5M A;  2JH8 A;  3SQ0 A;  4KHQ A;  1FYZ E;  2P1M B;  4HCB A;  4KHY A;  1XMG E;  3OGK B;  4DU3 A;  4M42 A;  3NGI A;  2PFV A;  1FZI E;  5IBK B; 
#chains in the Genus database with same CATH homology
 3MKS B;  2OVP B;  1XMH E;  3C95 A;  5IRE A;  4JRQ A;  4M3W A;  3RMA A;  2MZW B;  3QNN A;  3RMB A;  3SPZ A;  1XU3 E;  3SQ4 A;  3TAF A;  4M3U A;  3RMD A;  4DU1 A;  4J2D A;  4HCC A;  4M3Z A;  2P1N B;  1FZ0 E;  3SQ2 A;  3SCX A;  1FZ3 E;  4RG8 A;  3KD5 E;  2VJ4 A;  1FZ8 E;  2FW3 A;  3LDB A;  3SPY A;  1XVD E;  4FK0 A;  1NEX B;  4KHS A;  1XU5 E;  2B8I A;  2E32 A;  4QND A;  3CFP A;  4FJJ A;  3QEV A;  2OVQ B;  3TAE A;  2P5G A;  3L2O B;  4DTU A;  3C94 A;  3E4Y A;  4DTR A;  4DTO A;  3QEP A;  4M3Y A;  3J2P A;  3CFO A;  4FJX A;  4AKH A;  4I9L A;  2FYO A;  2P1O B;  2P1P B;  1FZ4 E;  1LDK E;  1MMO G;  2MMB A;  4FJL A;  3S9H A;  3K2O A;  4EYW A;  4DTP A;  3N1E A;  3SUO A;  3C6N B;  4DTN A;  4FJ5 A;  4RL5 A;  4GAM C;  4E4B A;  4E3S A;  4X5N A;  3SUP A;  1FZ7 E;  2OZS A;  2LF3 A;  3L1N A;  3J27 A;  3L0M A;  2HD0 A;  1CLQ A;  4KHU A;  3OGL B;  4FJ8 A;  2DTU A;  3SNN A;  5H37 A;  4FK4 A;  2B7M A;  2JHC A;  2VIX A;  3LDS A;  2ATQ A;  3RMC A;  3QNO A;  3SQ1 A;  2LF6 A;  3N1B A;  4FVM A;  4DTS A;  3QEX A;  3NAE A;  2OYQ A;  3E4W A;  2DEB A;  4I9Q A;  3SJJ A;  1IG9 A;  3HGL A;  1FZ9 E;  2OZM A;  3CFR A;  4FJH A;  4KHW A;  4M45 A;  1P22 A;  3UIQ A;  3SUQ A;  1XVB E;  3RWU A;  4B08 A;  3SUN A;  3L8B A;  4DTM A;  4RNG A;  1FZ2 E;  4J2A A;  3HL8 A;  3NHG A;  4M3T A;  4AI6 A;  3QEW A;  4FJK A;  3QEI A;  3NE6 A;  1XVC E;  4JRP A;  1XVG E;  1XMF E;  2PFT A;  3SVI A;  4JS4 A;  4DTX A;  3HP9 A;  4FJI A;  1XVE E;  3TL8 B;  4FK2 A;  1WAJ A;  3KD1 E;  4EP9 A;  3LZI A;  4FJ7 A;  2JPN A;  4QNC A;  4M41 A;  2E31 A;  1WAF A;  3TAG A;  3V7D B;  4AKG A;  3C6O B;  3SI6 A;  2RCU A;  1MHZ G;  3TJY A;  2JHP A;  4DU4 A;  4KI4 A;  1Q9X A;  2YB5 A;  3C6P B;  4J2E A;  1FZ6 E;  2JHA A;  4DTJ A;  1MHY G;  4EPH A;  5IZ7 A;  1FZ1 E;  4FJ9 A;  1Q9Y A;  4J2B A;  4FJM A;  1FXX A;  4KI6 A;  4ADO A;  2H4T A;  4KHN A;  1MTY G;  1XL3 C;  4ADN A;  3NDK A;  4JS5 A;  2P1Q B;  4M3R A;  3TAB A;  4I6J B;  4AKI A;  1FS1 A;  1FZH E;  1FZ5 E;  3WSO A;  3LZJ A;  1XVF E;  2QXF A;  3OGM B;  2JH9 A;  3QER A;  3LD8 A;  2P5O A;  2DY4 A;  2VJ5 A;  4FJG A;  3HGK E;  3QET A;  2B1E A;  3NCI A;  3QES A;  4FJN A;  4M3X A;  1IH7 A;  2OVR B;  3CQ8 A;  4X5M A;  2JH8 A;  3SQ0 A;  4KHQ A;  1FYZ E;  2P1M B;  4HCB A;  4KHY A;  1XMG E;  3OGK B;  4DU3 A;  4M42 A;  3NGI A;  2PFV A;  1FZI E;  5IBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...