2LF3A

Solution nmr structure of hoppmal_281_385 from pseudomonas syringae pv. maculicola str. es4326, midwest center for structural genomics target apc40104.5 and northeast structural genomics consortium target pst2a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
105
structure length
105
Chain Sequence
SQRPVDRNPPRINLMPTGANRVAMRNRGNNEADAALQALAQNGINMEDLRAALEAYIVWLRPIPLDIANALEGVGITPRFDNPEEAKVDNPLMNLSSALKRRLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of HopPmaL Reveals the Presence of a Second Adaptor Domain Common to the HopAB Family of Pseudomonas syringae Type III Effectors.
pubmed doi rcsb
source organism Pseudomonas syringae pv. maculicola
molecule tags Signaling protein
molecule keywords Effector protein hopAB3
total genus 25
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16847 AvrPtoB_bdg Avirulence AvrPtoB, BAK1-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.220 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 2lf3A00
3TL8B 2LF6A 2LF3A
chains in the Genus database with same CATH superfamily
2JHAA 1MMOG 4M3TA 3OGKB 3RMBA 3UO2A 3RMAA 4HCCA 1CLQA 2RKHA 3HGLA 3KD5E 4M3YA 1XMHE 5IBKB 3CFOA 3SQ0A 4DTSA 3QESA 3C6NB 3TABA 1Q9XA 1FZ4E 3LZIA 4M3WA 2PFTA 4KHNA 1XU3E 1LDKE 3QNOA 3RWUA 4ADOA 4X5NA 4M3RA 3N1BA 4FVMA 2LF6A 3TAGA 3HGKE 3TAEA 2MMBA 3QEPA 4FJHA 4EPHA 3QNNA 3K2OA 2JH9A 4JS4A 4FJNA 3E4WA 1FZ9E 1FZHE 3OGLB 2DY4A 3N1EA 3NHGA 1XMFE 5H37A 4FJMA 3E4YA 3SUOA 1FZ5E 2DEBA 3SPZA 4DTUA 2QXFA 3QEVA 4QNCA 3SQ2A 1FPOA 4E3SA 4DU1A 2VJ4A 4DU3A 4DTMA 2MW2A 2JHPA 3LD8A 1IH7A 1XU5E 3QERA 3QEWA 4FJ9A 2FW3A 4JRQA 4FJ8A 4X5MA 3UO3A 3SQ4A 4DTRA 3NAEA 4RL5A 2P5OA 4KI6A 4KI4A 3CFRA 3L1NA 3OGMB 2OYQA 4I9LA 2JHCA 1XVBE 3TAFA 4DTXA 4KHYA 1MTYG 2K5SA 2OZSA 4B08A 3HP9A 3QEIA 2LF3A 2OVQB 3SUNA 2DTUA 1FS1A 2JPNA 3QEXA 3RMDA 2E31A 1XVDE 4RNGA 3J2PA 4I9QA 3L0MA 2FYOA 4GAMC 3RMCA 3SNNA 3CQ8A 3UIQA 4FJGA 4AKGA 4DTOA 4FJIA 2JQTA 4I6JB 3L8BA 3LDBA 1XL3C 4M3XA 1FZ7E 3S9HA 1IG9A 3BVOA 3SUQA 1XVEE 4RG8A 5IREA 2VJ5A 4ICGC 1Q9YA 4E4BA 4HCBA 2OZMA 3C6OB 3HL8A 2JH8A 3LZJA 3TJYA 2YB5A 2P5GA 3MKSB 3NDKA 4FJXA 4KHQA 4FK0A 5IZ7A 1N1CA 4FJKA 3SUPA 4DTJA 3NCIA 4M45A 4M3UA 4KHSA 3CFPA 4ADNA 3SCXA 3KD1E 1FZ0E 4M3ZA 3TL8B 3SVIA 3SQ1A 3C94A 1XVFE 2HD0A 4J2DA 1WAFA 1XVGE 4EYWA 1FZ3E 4JS5A 3NGIA 3NE6A 4DU4A 1FZ6E 1P22A 2VIXA 1FZ2E 4IT5A 3QETA 4KHUA 2B1EA 2H4TA 4M42A 3J27A 3SI6A 1FYZE 4FJJA 2B7MA 1WAJA 4M41A 1FZIE 1MHZG 2P1NB 2ATQA 4DTPA 3V7DB 3WSOA 3SPYA 2PFVA 4AKIA 3C6PB 4AI6A 4FJ5A 1FXXA 4FK4A 2P1OB 1XMGE 4FJLA 4AKHA 2B8IA 4QNDA 4KHWA 1NEXB 1JW2A 4EP9A 1FZ8E 3SJJA 1XVCE 3C95A 4DTNA 4J2AA 1FZ1E 4FJ7A 4FK2A 2RCUA 3LDSA 4J2EA 2MZWB 2OVPB 4JRPA 1MHYG 2P1PB 2P1MB 3L2OB 2E32A 2OVRB 4J2BA 2P1QB
chains in the Genus database with same CATH topology
2JHAA 1MMOG 4M3TA 3OGKB 3RMBA 4HCCA 3RMAA 1CLQA 3HGLA 3KD5E 4M3YA 1XMHE 5IBKB 3CFOA 3SQ0A 4DTSA 3QESA 3C6NB 3TABA 1Q9XA 1FZ4E 3LZIA 4M3WA 2PFTA 4KHNA 1XU3E 1LDKE 3QNOA 3RWUA 4ADOA 4X5NA 4M3RA 3N1BA 4FVMA 2LF6A 3TAGA 3HGKE 3TAEA 2MMBA 3QEPA 4FJHA 4EPHA 3QNNA 3K2OA 2JH9A 4JS4A 4FJNA 3E4WA 1FZ9E 1FZHE 3OGLB 2DY4A 3N1EA 3NHGA 1XMFE 5H37A 4FJMA 3E4YA 3SUOA 1FZ5E 2DEBA 3SPZA 4DTUA 2QXFA 3QEVA 4QNCA 3SQ2A 4E3SA 4DTMA 4DU1A 2VJ4A 4DU3A 2JHPA 3LD8A 1IH7A 1XU5E 3QERA 3QEWA 4FJ9A 2FW3A 4JRQA 4FJ8A 4X5MA 3SQ4A 4DTRA 3NAEA 4RL5A 2P5OA 4KI6A 4KI4A 3CFRA 3L1NA 3OGMB 2OYQA 4I9LA 2JHCA 1XVBE 3TAFA 4DTXA 4KHYA 1MTYG 2OZSA 4B08A 3HP9A 3QEIA 2LF3A 2OVQB 3SUNA 2DTUA 1FS1A 2JPNA 3QEXA 3RMDA 2E31A 1XVDE 4RNGA 3J2PA 4I9QA 3L0MA 2FYOA 4GAMC 3RMCA 3SNNA 3CQ8A 3UIQA 4FJGA 4AKGA 4DTOA 4FJIA 4I6JB 3L8BA 3LDBA 1XL3C 4M3XA 1FZ7E 3S9HA 1IG9A 3SUQA 1XVEE 4RG8A 5IREA 2VJ5A 1Q9YA 4E4BA 4HCBA 2OZMA 3C6OB 3HL8A 2JH8A 3LZJA 3TJYA 2YB5A 2P5GA 3MKSB 3NDKA 4FJXA 4KHQA 4FK0A 5IZ7A 4FJKA 3SUPA 4DTJA 3NCIA 4M45A 4M3UA 4KHSA 3CFPA 4ADNA 3SCXA 3KD1E 1FZ0E 4M3ZA 3TL8B 3SVIA 3SQ1A 3C94A 1XVFE 2HD0A 4J2DA 1WAFA 1XVGE 4EYWA 1FZ3E 4JS5A 3NGIA 3NE6A 4DU4A 1FZ6E 1P22A 2VIXA 1FZ2E 3QETA 4KHUA 2B1EA 2H4TA 4M42A 3J27A 3SI6A 1FYZE 4FJJA 2B7MA 1WAJA 4M41A 1FZIE 1MHZG 2P1NB 2ATQA 4DTPA 3V7DB 3WSOA 3SPYA 2PFVA 4AKIA 3C6PB 4AI6A 4FJ5A 1FXXA 4FK4A 2P1OB 1XMGE 4FJLA 4AKHA 2B8IA 4QNDA 4KHWA 1NEXB 4EP9A 1FZ8E 3SJJA 1XVCE 3C95A 4DTNA 4J2AA 1FZ1E 4FJ7A 4FK2A 2RCUA 3LDSA 4J2EA 2MZWB 2OVPB 4JRPA 1MHYG 2P1PB 2P1MB 3L2OB 2E32A 2OVRB 4J2BA 2P1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TL8 B;  2LF6 A;  2LF3 A; 
#chains in the Genus database with same CATH topology
 2JHA A;  1MMO G;  4M3T A;  3OGK B;  3RMB A;  3UO2 A;  3RMA A;  4HCC A;  1CLQ A;  2RKH A;  3HGL A;  3KD5 E;  4M3Y A;  1XMH E;  5IBK B;  3CFO A;  3SQ0 A;  4DTS A;  3QES A;  3C6N B;  3TAB A;  1Q9X A;  1FZ4 E;  3LZI A;  4M3W A;  2PFT A;  4KHN A;  1XU3 E;  1LDK E;  3QNO A;  3RWU A;  4ADO A;  4X5N A;  4M3R A;  3N1B A;  4FVM A;  2LF6 A;  3TAG A;  3HGK E;  3TAE A;  2MMB A;  3QEP A;  4FJH A;  4EPH A;  3QNN A;  3K2O A;  2JH9 A;  4JS4 A;  4FJN A;  3E4W A;  1FZ9 E;  1FZH E;  3OGL B;  2DY4 A;  3N1E A;  3NHG A;  1XMF E;  5H37 A;  4FJM A;  3E4Y A;  3SUO A;  1FZ5 E;  2DEB A;  3SPZ A;  4DTU A;  2QXF A;  3QEV A;  4QNC A;  3SQ2 A;  1FPO A;  4E3S A;  4DU1 A;  2VJ4 A;  4DU3 A;  4DTM A;  2MW2 A;  2JHP A;  3LD8 A;  1IH7 A;  1XU5 E;  3QER A;  3QEW A;  4FJ9 A;  2FW3 A;  4JRQ A;  4FJ8 A;  4X5M A;  3UO3 A;  3SQ4 A;  4DTR A;  3NAE A;  4RL5 A;  2P5O A;  4KI6 A;  4KI4 A;  3CFR A;  3L1N A;  3OGM B;  2OYQ A;  4I9L A;  2JHC A;  1XVB E;  3TAF A;  4DTX A;  4KHY A;  1MTY G;  2K5S A;  2OZS A;  4B08 A;  3HP9 A;  3QEI A;  2LF3 A;  2OVQ B;  3SUN A;  2DTU A;  1FS1 A;  2JPN A;  3QEX A;  3RMD A;  2E31 A;  1XVD E;  4RNG A;  3J2P A;  4I9Q A;  3L0M A;  2FYO A;  4GAM C;  3RMC A;  3SNN A;  3CQ8 A;  3UIQ A;  4FJG A;  4AKG A;  4DTO A;  4FJI A;  2JQT A;  4I6J B;  3L8B A;  3LDB A;  1XL3 C;  4M3X A;  1FZ7 E;  3S9H A;  1IG9 A;  3BVO A;  3SUQ A;  1XVE E;  4RG8 A;  5IRE A;  2VJ5 A;  4ICG C;  1Q9Y A;  4E4B A;  4HCB A;  2OZM A;  3C6O B;  3HL8 A;  2JH8 A;  3LZJ A;  3TJY A;  2YB5 A;  2P5G A;  3MKS B;  3NDK A;  4FJX A;  4KHQ A;  4FK0 A;  5IZ7 A;  1N1C A;  4FJK A;  3SUP A;  4DTJ A;  3NCI A;  4M45 A;  4M3U A;  4KHS A;  3CFP A;  4ADN A;  3SCX A;  3KD1 E;  1FZ0 E;  4M3Z A;  3TL8 B;  3SVI A;  3SQ1 A;  3C94 A;  1XVF E;  2HD0 A;  4J2D A;  1WAF A;  1XVG E;  4EYW A;  1FZ3 E;  4JS5 A;  3NGI A;  3NE6 A;  4DU4 A;  1FZ6 E;  1P22 A;  2VIX A;  1FZ2 E;  4IT5 A;  3QET A;  4KHU A;  2B1E A;  2H4T A;  4M42 A;  3J27 A;  3SI6 A;  1FYZ E;  4FJJ A;  2B7M A;  1WAJ A;  4M41 A;  1FZI E;  1MHZ G;  2P1N B;  2ATQ A;  4DTP A;  3V7D B;  3WSO A;  3SPY A;  2PFV A;  4AKI A;  3C6P B;  4AI6 A;  4FJ5 A;  1FXX A;  4FK4 A;  2P1O B;  1XMG E;  4FJL A;  4AKH A;  2B8I A;  4QND A;  4KHW A;  1NEX B;  1JW2 A;  4EP9 A;  1FZ8 E;  3SJJ A;  1XVC E;  3C95 A;  4DTN A;  4J2A A;  1FZ1 E;  4FJ7 A;  4FK2 A;  2RCU A;  3LDS A;  4J2E A;  2MZW B;  2OVP B;  4JRP A;  1MHY G;  2P1P B;  2P1M B;  3L2O B;  2E32 A;  2OVR B;  4J2B A;  2P1Q B; 
#chains in the Genus database with same CATH homology
 2JHA A;  1MMO G;  4M3T A;  3OGK B;  3RMB A;  4HCC A;  3RMA A;  1CLQ A;  3HGL A;  3KD5 E;  4M3Y A;  1XMH E;  5IBK B;  3CFO A;  3SQ0 A;  4DTS A;  3QES A;  3C6N B;  3TAB A;  1Q9X A;  1FZ4 E;  3LZI A;  4M3W A;  2PFT A;  4KHN A;  1XU3 E;  1LDK E;  3QNO A;  3RWU A;  4ADO A;  4X5N A;  4M3R A;  3N1B A;  4FVM A;  2LF6 A;  3TAG A;  3HGK E;  3TAE A;  2MMB A;  3QEP A;  4FJH A;  4EPH A;  3QNN A;  3K2O A;  2JH9 A;  4JS4 A;  4FJN A;  3E4W A;  1FZ9 E;  1FZH E;  3OGL B;  2DY4 A;  3N1E A;  3NHG A;  1XMF E;  5H37 A;  4FJM A;  3E4Y A;  3SUO A;  1FZ5 E;  2DEB A;  3SPZ A;  4DTU A;  2QXF A;  3QEV A;  4QNC A;  3SQ2 A;  4E3S A;  4DTM A;  4DU1 A;  2VJ4 A;  4DU3 A;  2JHP A;  3LD8 A;  1IH7 A;  1XU5 E;  3QER A;  3QEW A;  4FJ9 A;  2FW3 A;  4JRQ A;  4FJ8 A;  4X5M A;  3SQ4 A;  4DTR A;  3NAE A;  4RL5 A;  2P5O A;  4KI6 A;  4KI4 A;  3CFR A;  3L1N A;  3OGM B;  2OYQ A;  4I9L A;  2JHC A;  1XVB E;  3TAF A;  4DTX A;  4KHY A;  1MTY G;  2OZS A;  4B08 A;  3HP9 A;  3QEI A;  2LF3 A;  2OVQ B;  3SUN A;  2DTU A;  1FS1 A;  2JPN A;  3QEX A;  3RMD A;  2E31 A;  1XVD E;  4RNG A;  3J2P A;  4I9Q A;  3L0M A;  2FYO A;  4GAM C;  3RMC A;  3SNN A;  3CQ8 A;  3UIQ A;  4FJG A;  4AKG A;  4DTO A;  4FJI A;  4I6J B;  3L8B A;  3LDB A;  1XL3 C;  4M3X A;  1FZ7 E;  3S9H A;  1IG9 A;  3SUQ A;  1XVE E;  4RG8 A;  5IRE A;  2VJ5 A;  1Q9Y A;  4E4B A;  4HCB A;  2OZM A;  3C6O B;  3HL8 A;  2JH8 A;  3LZJ A;  3TJY A;  2YB5 A;  2P5G A;  3MKS B;  3NDK A;  4FJX A;  4KHQ A;  4FK0 A;  5IZ7 A;  4FJK A;  3SUP A;  4DTJ A;  3NCI A;  4M45 A;  4M3U A;  4KHS A;  3CFP A;  4ADN A;  3SCX A;  3KD1 E;  1FZ0 E;  4M3Z A;  3TL8 B;  3SVI A;  3SQ1 A;  3C94 A;  1XVF E;  2HD0 A;  4J2D A;  1WAF A;  1XVG E;  4EYW A;  1FZ3 E;  4JS5 A;  3NGI A;  3NE6 A;  4DU4 A;  1FZ6 E;  1P22 A;  2VIX A;  1FZ2 E;  3QET A;  4KHU A;  2B1E A;  2H4T A;  4M42 A;  3J27 A;  3SI6 A;  1FYZ E;  4FJJ A;  2B7M A;  1WAJ A;  4M41 A;  1FZI E;  1MHZ G;  2P1N B;  2ATQ A;  4DTP A;  3V7D B;  3WSO A;  3SPY A;  2PFV A;  4AKI A;  3C6P B;  4AI6 A;  4FJ5 A;  1FXX A;  4FK4 A;  2P1O B;  1XMG E;  4FJL A;  4AKH A;  2B8I A;  4QND A;  4KHW A;  1NEX B;  4EP9 A;  1FZ8 E;  3SJJ A;  1XVC E;  3C95 A;  4DTN A;  4J2A A;  1FZ1 E;  4FJ7 A;  4FK2 A;  2RCU A;  3LDS A;  4J2E A;  2MZW B;  2OVP B;  4JRP A;  1MHY G;  2P1P B;  2P1M B;  3L2O B;  2E32 A;  2OVR B;  4J2B A;  2P1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...