1JW2A

Solution structure of hemolysin expression modulating protein hha from escherichia coli. ontario centre for structural proteomics target ec0308_1_72; northeast structural genomics target et88
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HEMOLYSIN EXPRESSION MODULATING PROTEIN Hha
publication title An NMR approach to structural proteomics
pubmed doi rcsb
source organism Escherichia coli
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05321 HHA Haemolysin expression modulating protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.40 Mainly Alpha Up-down Bundle Monooxygenase HHA 1jw2A00
2MW2A 1JW2A 4ICGC 2JQTA 2K5SA
chains in the Genus database with same CATH superfamily
2B7MA 3HL8A 4KI6A 4FJ7A 1Q9YA 1JW2A 2JHAA 4RG8A 4FJNA 4EYWA 4FJMA 4JRPA 5H37A 3NCIA 1FZ9E 1XL3C 4FJLA 4FJXA 1XVDE 3LDBA 4AKIA 4ADOA 2RKHA 3QEWA 1FZHE 3C95A 5IBKB 1FZIE 1XU3E 3SUQA 4M3YA 2MMBA 3L8BA 2VJ4A 4AKHA 5IREA 4JS4A 4DU4A 3HGLA 3RMAA 1CLQA 2MW2A 3N1BA 4X5NA 3RMBA 4ICGC 4M41A 3QEXA 3LDSA 2OVPB 3RMDA 4FJ8A 3K2OA 4M3ZA 4FK2A 3TJYA 3CFOA 3BVOA 3SUOA 4JS5A 2P1MB 3E4WA 3TL8B 4QNDA 4M3UA 4DTXA 3HGKE 3NHGA 2P5GA 3NGIA 2JH8A 3SQ2A 1FZ4E 3CFPA 2ATQA 3WSOA 4FJHA 3QEVA 4EP9A 1XVEE 2B1EA 2LF6A 4QNCA 2JH9A 4HCCA 4IT5A 4FJ5A 4DTSA 2QXFA 4DTOA 3SI6A 1MMOG 3OGKB 2B8IA 2YB5A 4FJIA 3QNNA 3SVIA 2DTUA 3SQ1A 2OYQA 2P1QB 3QERA 3SUPA 4AKGA 4KHQA 1XVBE 2HD0A 4J2AA 4B08A 4FJKA 4J2BA 4FJ9A 2JQTA 4X5MA 4DU3A 1WAJA 2VJ5A 3QEIA 4DU1A 1FZ2E 4DTPA 3OGMB 3C94A 1FPOA 3UIQA 2OVRB 3V7DB 4M3XA 3SPZA 4DTRA 1XU5E 4KHNA 1FZ6E 4DTMA 3L1NA 4GAMC 3NE6A 1FXXA 3MKSB 3LZJA 3L0MA 2H4TA 1IG9A 4J2DA 4M3TA 4AI6A 3CFRA 1FZ0E 3C6PB 3OGLB 4RL5A 3QETA 2P5OA 1MHZG 4KHUA 4FK0A 1XVCE 4M3WA 2RCUA 4J2EA 4I9QA 1FZ7E 3SQ0A 4FJJA 3SPYA 3KD1E 4FK4A 4HCBA 3SJJA 1WAFA 3NAEA 1XMGE 4KHSA 3TAEA 3SCXA 3SNNA 2OZSA 3RMCA 3C6NB 3QEPA 3NDKA 4RNGA 1MTYG 2P1PB 3SQ4A 2OZMA 3RWUA 3KD5E 1FZ8E 3CQ8A 3TABA 1Q9XA 3UO3A 1XMFE 1FZ3E 3N1EA 4I6JB 3S9HA 1NEXB 4FJGA 3HP9A 1XVFE 3J2PA 3TAFA 4EPHA 1FZ1E 2E31A 2PFTA 1XMHE 3UO2A 4M45A 4KI4A 1MHYG 2FYOA 2K5SA 4KHWA 1FZ5E 4DTUA 3QNOA 2VIXA 2JHCA 2DY4A 1XVGE 4I9LA 4KHYA 4DTNA 1FS1A 4JRQA 2P1OB 2E32A 3C6OB 2JHPA 2FW3A 4ADNA 4E3SA 2DEBA 4FVMA 3J27A 2OVQB 2P1NB 1IH7A 3E4YA 2MZWB 1P22A 3QESA 2LF3A 4M3RA 1FYZE 3LZIA 1LDKE 2JPNA 2PFVA 3LD8A 3L2OB 3SUNA 4E4BA 1N1CA 3TAGA 5IZ7A 4M42A 4DTJA
chains in the Genus database with same CATH topology
2MW2A 1JW2A 4ICGC 2JQTA 2K5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MW2 A;  1JW2 A;  4ICG C;  2JQT A;  2K5S A; 
#chains in the Genus database with same CATH topology
 2B7M A;  3HL8 A;  4KI6 A;  4FJ7 A;  1Q9Y A;  1JW2 A;  2JHA A;  4RG8 A;  4FJN A;  4EYW A;  4FJM A;  4JRP A;  5H37 A;  3NCI A;  1FZ9 E;  1XL3 C;  4FJL A;  4FJX A;  1XVD E;  3LDB A;  4AKI A;  4ADO A;  2RKH A;  3QEW A;  1FZH E;  3C95 A;  5IBK B;  1FZI E;  1XU3 E;  3SUQ A;  4M3Y A;  2MMB A;  3L8B A;  2VJ4 A;  4AKH A;  5IRE A;  4JS4 A;  4DU4 A;  3HGL A;  3RMA A;  1CLQ A;  2MW2 A;  3N1B A;  4X5N A;  3RMB A;  4ICG C;  4M41 A;  3QEX A;  3LDS A;  2OVP B;  3RMD A;  4FJ8 A;  3K2O A;  4M3Z A;  4FK2 A;  3TJY A;  3CFO A;  3BVO A;  3SUO A;  4JS5 A;  2P1M B;  3E4W A;  3TL8 B;  4QND A;  4M3U A;  4DTX A;  3HGK E;  3NHG A;  2P5G A;  3NGI A;  2JH8 A;  3SQ2 A;  1FZ4 E;  3CFP A;  2ATQ A;  3WSO A;  4FJH A;  3QEV A;  4EP9 A;  1XVE E;  2B1E A;  2LF6 A;  4QNC A;  2JH9 A;  4HCC A;  4IT5 A;  4FJ5 A;  4DTS A;  2QXF A;  4DTO A;  3SI6 A;  1MMO G;  3OGK B;  2B8I A;  2YB5 A;  4FJI A;  3QNN A;  3SVI A;  2DTU A;  3SQ1 A;  2OYQ A;  2P1Q B;  3QER A;  3SUP A;  4AKG A;  4KHQ A;  1XVB E;  2HD0 A;  4J2A A;  4B08 A;  4FJK A;  4J2B A;  4FJ9 A;  2JQT A;  4X5M A;  4DU3 A;  1WAJ A;  2VJ5 A;  3QEI A;  4DU1 A;  1FZ2 E;  4DTP A;  3OGM B;  3C94 A;  1FPO A;  3UIQ A;  2OVR B;  3V7D B;  4M3X A;  3SPZ A;  4DTR A;  1XU5 E;  4KHN A;  1FZ6 E;  4DTM A;  3L1N A;  4GAM C;  3NE6 A;  1FXX A;  3MKS B;  3LZJ A;  3L0M A;  2H4T A;  1IG9 A;  4J2D A;  4M3T A;  4AI6 A;  3CFR A;  1FZ0 E;  3C6P B;  3OGL B;  4RL5 A;  3QET A;  2P5O A;  1MHZ G;  4KHU A;  4FK0 A;  1XVC E;  4M3W A;  2RCU A;  4J2E A;  4I9Q A;  1FZ7 E;  3SQ0 A;  4FJJ A;  3SPY A;  3KD1 E;  4FK4 A;  4HCB A;  3SJJ A;  1WAF A;  3NAE A;  1XMG E;  4KHS A;  3TAE A;  3SCX A;  3SNN A;  2OZS A;  3RMC A;  3C6N B;  3QEP A;  3NDK A;  4RNG A;  1MTY G;  2P1P B;  3SQ4 A;  2OZM A;  3RWU A;  3KD5 E;  1FZ8 E;  3CQ8 A;  3TAB A;  1Q9X A;  3UO3 A;  1XMF E;  1FZ3 E;  3N1E A;  4I6J B;  3S9H A;  1NEX B;  4FJG A;  3HP9 A;  1XVF E;  3J2P A;  3TAF A;  4EPH A;  1FZ1 E;  2E31 A;  2PFT A;  1XMH E;  3UO2 A;  4M45 A;  4KI4 A;  1MHY G;  2FYO A;  2K5S A;  4KHW A;  1FZ5 E;  4DTU A;  3QNO A;  2VIX A;  2JHC A;  2DY4 A;  1XVG E;  4I9L A;  4KHY A;  4DTN A;  1FS1 A;  4JRQ A;  2P1O B;  2E32 A;  3C6O B;  2JHP A;  2FW3 A;  4ADN A;  4E3S A;  2DEB A;  4FVM A;  3J27 A;  2OVQ B;  2P1N B;  1IH7 A;  3E4Y A;  2MZW B;  1P22 A;  3QES A;  2LF3 A;  4M3R A;  1FYZ E;  3LZI A;  1LDK E;  2JPN A;  2PFV A;  3LD8 A;  3L2O B;  3SUN A;  4E4B A;  1N1C A;  3TAG A;  5IZ7 A;  4M42 A;  4DTJ A; 
#chains in the Genus database with same CATH homology
 2MW2 A;  1JW2 A;  4ICG C;  2JQT A;  2K5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...