4N0BA

Crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
473
structure length
468
Chain Sequence
ITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKETGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription activator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 133
structure length 468
sequence length 473
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n0bA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0bA02
3MEXA 5E8IA 1QZYA 1T3IA 1X0MA 4ITXA 4FHTA 2JG2A 2QMAA 3AAFA 1U08A 4LMYA 1BI0A 4CBSA 2E7JA 1W4MA 3PD6B 4XLNF 4XK1A 3AOVA 4RGRA 2JSCA 2EJRA 2HQRA 1DGDA 1H0CA 2GIVA 5I92A 1M7YA 3KZZA 2PLYA 4A00A 1STZA 1W7PA 2PN6A 1FYKA 4LC3A 5D6FA 2W7JA 4F4EA 3FZ8A 3J80Z 2XAFA 3KP5A 4UHTA 4RGUA 4A5NA 4IHTA 2F8JA 2BHXA 4EU1A 5JR3A 5CLSA 3P7NA 2HYGD 2QB2A 4Y13A 1FYMA 1XSVA 4U2HA 3V4GA 2BI3A 2ZC0A 2A69F 3V7RA 5H20A 1KU7A 1S07A 2DKBA 1J32A 1N2TA 4U7BA 4RAEA 1QZ9A 2EK5A 1BN5A 1FBUA 1AHXA 1AJSB 4F5LA 3NQOA 3A8UX 3KETA 4HVKA 2GWRA 3EUHA 3ZMZA 1GC4A 1TNTA 3VK3A 2DT5A 2P7VB 3ZMDA 1B9MA 2WWYA 1SMYF 3GETA 4XRFA 2VGUA 4BH9A 2ZFWA 4WLJA 2GMSA 2HUUA 2P5VA 2MH2A 2YRRA 3M9AA 4L5IA 1UKJA 2HKOA 3F6OA 1FC4A 3QU3A 1I6XA 1Z1DA 4K2MA 1IJIA 1D3YA 1TQIA 1L3LA 1PP8F 2VOPA 5J8CA 2WKAA 4EJOA 2VT2A 1AJSA 4A0GA 2JJFA 4GO1A 1X2AA 3I16A 1ZG5A 1PUEE 5FT4A 2ISZA 1ZGAA 4WYDA 2RDPA 3KP4A 3WTUC 3JZLA 4ZAHA 3HRMA 4Q5SF 1M6SA 2CANA 1XSXA 2Z5UA 4DQ2A 5HOOA 1JS3A 3FWEA 2L4AA 1J5YA 3HDOA 3EDPA 3BV0A 1YW8A 3VK2A 2DO7A 4A0ZA 1Z3ZA 2P5KA 3HUGA 3AENB 1IN4A 4RKDA 2WC2A 2HGCA 2WK9A 3ZRRA 4ADCA 4KFCA 4RJYA 2DGLA 1AY5A 1FY7A 1G6NA 4OMZA 1P4XA 4LGWA 3TKYA 4OCAA 3VK4A 3JW9A 3GW2A 3UAKA 3BJAA 3GBXA 1TATA 5BOXA 3I4JA 4WYAA 1G3SA 5LHHA 3EYYA 2W7HA 3P9KA 4B8XA 5JI6A 4RLGA 4RKCA 1KL2A 3GFLA 4WXCA 2AY4A 3TOBA 2QQ9A 3E9KA 3F0HA 2QM3A 2AY7A 3BDDA 3DRDA 1BJNA 3K2ZA 1TASA 2PO3A 1MJBA 5D5UB 4IRIA 2QYOA 4P5OA 3EI8A 1B5OA 5BQTA 1V72A 2OD5A 4CYDA 2HP1A 2TPLA 5LRSA 2OKKA 2VODA 1IN8A 4MQPA 2STWA 3NU8A 3I58A 4OU0A 1AMRA 5DV5A 2BI1A 2VYCA 3I53A 4H0EA 2LKPA 2Z9UA 5CVJA 2W8WA 1RVYA 3N75A 5FO5A 2UWMA 5EEHA 1F5TA 3UWCA 2OKJA 1ZGJA 4W1VA 1MDMB 3BS8A 3L7WA 1O7FA 2Y75A 3DEUA 4BA5A 4Q31A 1KQ8A 3E2ZA 1R00A 3BCBA 3PDBB 3FKDA 4Q48A 3PDXA 1R1UA 1ZH5A 4RGSA 1QPMA 5BPDA 1IX8A 4OBUA 3DODA 2V1PA 3B1DA 2AEVA 1SZUA 3AOWA 2XAHA 1A04A 4HV5A 1TW3A 2GA2A 3IRQA 2OZ6A 3QP5A 3LAPA 4GE7A 2MA3A 3E5UA 4AH3A 2Z99A 3IKTA 2VC0A 1LDKB 3HSRA 4TN4A 3E6GA 2V79A 2C44A 4EM0B 1XGOA 3GJUA 2L02A 1MAPA 3DKWA 3R60A 3EUCA 3QOPA 3P6KA 4GE4A 1E5FA 2OQXA 3GSBA 1QO0D 1YO5C 3R0JA 4JF0A 3M8EA 3RKWA 3ELPA 4ZSWA 1KQ9A 1QJ5A 1GD9A 4KICA 2CW0F 3NYUA 1IN7A 3WZFA 1AWCA 4FT8A 4Q4ZF 2K4BA 4OOIA 3E3VA 2NYXA 3F21A 4FFCA 4G6QA 1UU2A 1R5HA 5HS8A 4I2OA 3I5UA 1AIBA 1OYIA 1TOIA 2O1BA 2PMHA 3EZ1A 4BHDA 2FOKA 1YW9A 3G8MA 3GZ5A 3IWFA 4K2IA 1SD5A 5EUEA 1FBSA 2ZUKA 3F9TA 4WWCA 3O6BB 4MKKA 3BZ6A 4YG2F 2E1CA 2PB0A 1N8PA 4LFUA 5DCMB 4AZKA 3MC6A 3QHXA 3W6JB 4CXFA 1XD7A 1X28A 4AIJA 5M49A 2H94A 5HVQC 1CS1A 2D61A 3HVYA 4DQ6A 5TJJA 3ZN0A 1OR7A 4LK0F 1IW7F 3ISPA 1W7MA 2WK7A 2VT3A 2CH2A 3F23A 1LDDA 4HV6A 2G9WA 2D2WA 1WQ2A 1OHVA 1Z7UA 2CTZA 3CUOA 5DJ1A 2XAJA 4Z2YA 4IVNA 1S7OA 2MBFA 1OYWA 1S8NA 1FG7A 2DU9A 2IJLA 1C0WA 3TFTA 1Y4IA 5G4IA 4MQ9F 3VODA 2D7YA 2GSAA 3SFZA 2GB3A 1WKHA 2M1BA 1BIBA 1RV4A 3PQJA 3C3WA 2D65A 3T32A 3KEOA 4LLGF 3ECDA 3GUDA 2VBXA 5D5VB 3H92A 2NS0A 4LG0B 2G7UA 4GE9A 1ASGA 4ATPA 2AY8A 1BI2A 2OAZA 5EIGA 1YS7A 2HFHA 2W7KA 3AEPA 1XCBA 1PG8A 5AX8A 3MCZA 2HP2A 2XAQA 1ZLKA 3ISLA 3LV2A 2FA5A 1G4DA 3G0TA 1WYTA 1TQPA 3QPTA 2VOOA 3QI6A 2M8EA 2KIMA 2FNPA 3ECOA 2FRHA 1I41A 3PGYA 4ADBA 3QAHA 3OKSA 2PQ8A 4EJWA 3LQQA 1JE8A 1ELQA 1MZBA 3WU0A 3I71A 4G7HF 4M73A 2A6HF 4QLCU 4M9SA 3MAJA 2HYFA 3ZQ7A 4R5ZA 1FZPB 3RBFA 3L8AA 3HTSB 1BJ4A 1LB2A 4MEYF 4ZDLA 2EO5A 5EIGB 2IVMA 2BEOA 2KRFA 2X5DA 2FQ3A 4ZASA 2Y0MA 2WV0A 1OPCA 3LY1A 5K5RA 4KIGA 4HX8A 3V8JA 5EUDA 2HOXA 1BM9A 5C6UA 3HRSA 3NNKA 3VOEA 3WTVC 4AZJA 3KKIA 1IAYA 3JTGA 4XJOA 4OIPF 1B6AA 1FNNA 2DK8A 5FD5A 4F5IA 4ZWMA 4A6TA 1GEXA 2W7DA 2WK8A 2CY8A 2FNUA 4BHPA 1IXRC 3NUIA 1ASEA 3WGHA 4ZZLA 6PAXA 1OXPA 2X4HA 3TDZC 2VLFA 3BCXA 1TW2A 1C0NA 3DF8A 1GEYA 3GF2A 1ONVA 2R5CA 1CQ6A 3IKVA 1AHEA 4GYIA 1AMAA 3AEJC 5BS6A 1NHAA 3M1EA 4WYCA 5DUIA 3JSPA 4LNMA 3HQTA 2JZYA 1J9IA 2DGMA 4HLYA 3FMQA 4LLNA 4RB2C 4UUVA 3NRAA 1DKAA 2VMZA 5K1YA 2VGTA 4XLPF 2A5YB 3LQRA 5EQCA 3DPTA 3MWMA 2DFIA 1ZOBA 4JEZA 1GHCA 2ZNZA 3M7GA 2P4WA 4WXBA 2VMYA 3WTTC 2M87A 4Q75A 2VI8A 2XKPA 3ELEA 1B4XA 3K69A 4ENMA 2FMYA 5DYMA 1MJ9A 4YIFA 3H14A 2J5OA 1YS6A 3ML6A 2LNBA 3K9TA 4EJUA 4ZDOA 2QLRA 4MQQA 4WYFA 1LC8A 3TDUC 1QISA 3BB8A 3LWSA 4Q76A 2XV4S 3KFWX 3S2WA 1AJRA 1Z91A 2V1XA 2BIAA 1H9TA 2EH6A 4A72A 1M0QA 5ERIA 4NB5A 2ZCWA 2BKWA 1R1VA 2JGTA 3I59B 3GFMA 2D7ZA 5FFZA 1ZYRF 4DNCA 1BQAA 3WLXA 4PDKA 2K4JA 4UV8A 5DD4A 1CZCA 2Z1ZA 2UXNA 4N9IA 1QBJA 2GZWA 4R5FA 1I1SA 2CB1A 1U8RA 3FQ7A 5HS7A 1LJ9A 1J75A 3FVXA 2W8JA 3AELA 1R22A 1I5ZA 2CQKA 1R23A 5E1ZB 2V9VA 1AMQA 4MHGA 3FVUA 3DXWA 4NQWA 2CH1A 2TDXA 5KVRA 4EQQA 1AKCA 5LGUA 3C1DA 2HORA 4OTLA 3E97A 4HAMA 1GXQA 1O7LA 2IT0A 1ZG1A 1GDEA 3E77A 1WYVA 3HOSA 5E1XA 4ZH4F 2HOYA 3KP7A 2GQNA 2DQRA 3B8XA 4M2JA 3W1HA 1AY8A 2X5FA 4HDUA 3SZPA 3MADA 5HDKA 4IW7A 3N0LA 3EI9A 3WKRA 4E70A 4W5KA 3DV8A 2YHKA 2CJDA 3KCCA 1X3UA 3FMSA 1LS3A 4G8XA 5DEQA 1K7AA 1C7OA 1CL2A 4PFFA 1MJAA 3REOA 1MDZA 1S06A 3BOQA 1CJ0A 2V1DA 3PD6A 2AXLA 4Y0HA 2X0LA 1YNUA 1LKCA 2RVCA 3ECHA 1XI9A 1R7JA 2QZ8A 4O3MA 5L3FA 1AX4A 3AEOA 3RPQA 3WTZA 3LVKA 1ARSA 1IX6A 4ESJA 2O0RA 5KK1A 3RCHA 4LW4A 3GWPA 4LJZF 1XN7A 2FMLA 4WB0B 2L3DA 1V2FA 5J8QA 1YIZA 2R5EA 1SFXA 2MLKA 1QGPA 3T0YA 2RGVA 3LVJA 4W1WA 1M4NA 3MQ0A 4K2BA 1B8GA 1GVJA 4EV0A 1MDOA 5G0AA 4XJMA 4JEVA 3HHHA 2Z61A 5L3CA 3GEZA 1FT9A 2Z9WA 3AENA 3DZZA 3SHFA 2HQNA 1K6OA 2B0LA 1KU9A 2ZXJA 2VIAA 1BJWA 2O6GE 4WYGA 4IYOB 3ZN1A 2AY6A 2ZSMA 1Z6TA 4D0PA 1HKTA 3BN1A 4HX7A 1I29A 1W7LA 4JEXA 3O3KA 5FGMA 2R3SA 1RZ4A 5DX5A 1CQ7A 2ZMEA 2KIFA 1SMTA 5A2QZ 4UVAA 1KQ0A 5D4SA 2P5LC 3ZMTA 4IHSA 5DB5A 1IUGA 2QBTA 5AONA 2A6EF 4XJPA 1Z7DA 4KNYA 4ETSA 3FXRA 4GEBA 1G7WA 3P1TA 2W25A 5L3GA 2EA4A 1FLIA 4XSXF 2VGWA 3AEMA 3ZRQA 4F5MA 3MZYA 3EETA 1WWXA 4ZLVA 1HQCA 3LWFA 2NNNA 5K5QA 2ZSLA 1AHYA 3M8FA 4L0YB 1AHFA 1W7NA 4ESBA 4DBCA 4MGRA 3MAFB 4J8LA 4I09A 2DTRA 2ADUA 3KZYA 2VBYA 5J6XA 1SFUA 1UCRA 2CINA 1XGSA 1DJ9A 3HL2A 2DBBA 4UQVA 2J5PA 3CDHA 5K8BA 2XUBA 2JT1A 2P6TA 2A07F 2PB2A 2IP2A 3L2CA 1JGSA 3DP7A 1GC0A 1BBYA 3T1BA 1VTNC 2VIBA 3I5TA 2C7TA 1IXCA 5DD8A 5LEKA 3E2FA 1ZRCA 4HLXA 3W1JA 2ESNA 1D7SA 3ABUA 4A6DA 2QLZA 2QVOA 2ZO4A 3RQ1A 2X3LA 1XMAA 3EQLF 3BPXA 1BQDA 1V2EA 3PDBA 4ZM3A 3E2ZB 1JS6A 1W7PB 3DQVC 1ZAOA 1DGEA 2DKJA 4RITA 3HMUA 3L00A 4MY5A 3VAXA 3BY6A 1T98A 2R7FA 3ZMVA 4W1XA 2Z1YA 3A9YA 3BC8A 4HQEA 4UNOA 1M0OA 4N0WA 4G94A 4ZYDA 2RFVA 4HZFA 2JPBA 2JTVA 1FSHA 3LVMA 3GWZA 5BJ4A 2FE3A 4A12A 2YPRA 1IX7A 1YJYA 1UU1A 1YJZA 4OIOF 4GXOA 1IRFA 3WGGA 5FLXZ 3IL2A 3KP3A 4P9FA 5LHIA 1LEBA 2XAGA 2JISA 3FQAA 2DGKA 1O57A 1I27A 1WSUA 5ED4A 2PI0A 1D7UA 2ZKZA 1ASFA 3OOPA 4ZM4A 3Q9SA 3FRKA 5TRDA 4FX0A 2WTEA 4ENNA 1D7RA 4ADEA 2NNYA 1U6GA 4HQMA 2AY9A 2VE8A 2HOEA 3WU1B 1IZ1A 1KMJA 1WYUA 4YFNF 1CL1A 1SVVA 1T38A 3GLXA 1KL1A 3KGWA 3A9ZA 4CVQA 5AIPA 2EV6A 4ZSYA 3ULQB 4HF2A 4ZYGA 1AMSA 2E54A 4AO9A 2W7EA 2O0YA 1KMKA 2ZJ2A 5L3BA 1BC7C 4KMFA 2K27A 1ZG3A 1PP7U 1BC8C 3NX3A 2OGEA 1RVUA 2GXGA 4TMRA 1QNTA 2K02A 3CQ6A 1JG8A 2W7IA 3B73A 1U2WA 1SD7A 1XDUA 4G7ZF 2R7DA 3MEBA 3G7QA 1QJ3A 3EI5A 1Y0UA 3GYHX 1HKSA 4WF2A 1ARHA 3R6SA 1O4SA 4ASNA 3RUYA 2FNAA 3V7CA 2VMVA 1XMKA 3DYDA 9AATA 4B09A 4S05A 1MKMA 4MTDA 1IAXA 4F5KA 3CUQA 4L9NA 4M72A 1O62A 4WXGA 2AY1A 4O5VA 2O03A 1DJUA 2FN6A 4P3MA 4A2UA 3ASBA 5E3KA 2YKVA 5ICCA 1TTYA 4F5HA 4WXFA 2XROA 5EAAA 3RCHB 2A3SA 4OBVA 1YIOA 2OQRA 4F5JA 1S08A 1D5VA 4LW2A 3MAUA 1HW5A 3U2RA 2D45A 1UU0A 1DDNA 2DR1A 2VMXA 4OYTA 1SFEA 1S7AA 1M32A 3EYIA 5CVRA 4RIZA 5D95A 3LSTA 4CXQA 5HDMA 3TO7A 1XDSA 2P7CB 4MKJA 3GR9A 2CFBA 1LNWA 1KU2A 3WGCA 2CJHA 4CXRA 3TO9A 2VMUA 3RIRA 1P4WA 2HOZA 2BWNA 2EFWA 1RIOH 3PPLA 1E5EA 2O7CA 1J04A 2PFBA 3BROA 5LHAA 2AATA 1U5TA 1ON2A 1W5TA 2DW4A 3GVAA 2W8TA 4GCVA 4BQAA 1VP4A 4OINF 2MH9A 2NRAC 5M4BA 1YW7A 2OA4A 2BYJA 4EM1A 3K28A 3P9IA 4HBLA 5LBQA 2MC3A 1IVRA 3LG0A 4MQVA 5H6RA 2Y48A 3IWZA 3VB2A 5DJ9A 5F8VA 2HWVA 3RPUA 1S29A 2JJHA 4E77A 2DLLA 2VGSA 1JF9A 1YYVA 5A2QK 1ODDA 5D5SA 3K1PA 3TFUA 2V0YA 1ASLA 1KKPA 1BJOA 3JTXA 1FSEA 4A0FA 2IPQX 1ASMA 2YU3A 2Q0OA 1IAWA 1C9CA 3FZ6A 3IF2A 1VEFA 1S6LA 3CUQB 1ARIA 3MFKA 2HR3A 4EMYA 4KYWA 2L54A 3ACZA 3HTUA 1FG3A 3FD0A 4A6UA 4EM2A 3NYTA 4A6RA 2P8TA 1LDJA 4B9BA 3WY7A 3AV7A 3WE2A 2HS5A 3WGIA 1PDNC 2BI9A 5G09A 3FQ8A 2CFXA 5ICGA 5HLIA 3FFRA 4Y0DA 3P9CA 3C18A 5ILUA 2QBYA 2VMPA 4MSOA 2F5CA 2FQ6A 5BJ3A 5IWQA 2E7WA 1FBQA 3UE8A 5BMZA 2RNJA 2QBYB 4HF0A 2DK5A 1HW1A 1D8JA 4F5GA 1UB9A 4Y0IA 4B98A 1U78A 4RJ0A 3HT4A 1KGSA 1G4VA 1F1ZA 4GDYA 2XIGA 2GMUA 3HHGA 5EEGA 4IPAA 2BI5A 1OHYA 4CZZA 4WP0A 4GGGA 1RUNA 5HHYA 4KIBA 2XHKA 3JW4A 5H6QA 1GC2A 3R0AA 4LNLA 1KA8A 4A0RA 3TATA 3HIFA 4IXAA 2LF8A 5CVVA 1BS0A 2AEUA 2A68F 1Z6RA 5M4DA 5M46A 1FC3A 1LQ1A 4M74A 2YRIA 1I43A 2NMPA 4IXOA 2EA2A 1REPC 4JE5D 3KGXA 1B9HA 4RB0A 3T8RA 5DDGA 4RB3C 5JHUA 3J7AO 3E5QA 4U0VA 1QIRA 3H3UA 4Y15A 1SFFA 2O8XA 3NUBA 4IXZA 2JPCA 3KE2A 1E2XA 1JXSA 3LVLB 3GZDA 4RGXA 5LEJA 5IT9K 4JQFA 5CJ9A 3V7SA 1AKBA 4FL0A 3FCRA 2BI2A 4ESFA 4LB5A 3IHJA 3PIUA 7AATA 3QP6A 3ZMSA 5BPIA 1FX7A 3ELKA 3O2PE 3U1DA 1ELUA 3DR4A 4M6YA 3KP6A 3WTXC 1LVAA 2XRNA 3RTRA 1IN6A 1V4RA 4AWXB 1Z9CA 3QBOA 5FB2A 4WK8F 3KEQA 2QQAA 3HRTA 5DUKA 1O61A 2CSTA 4XBFA 5HDGA 2F5EA 4OIRF 2VMSA 2H6BA 3RI4A 4JF1A 2EFPA 4EJTA 2VMQA 1USSA 3T8TA 5HXXA 4CO8A 1W3UA 1RUOA 4O6JA 2VLHA 3BWNA 2Z33A 4R8DA 3LAJA 3CAIA 2VMRA 1LW5A 3GXOA 1C7NA 4S04A 1BI1A 3NTJA 4UXNA 2BBYA 3OV8A 1ZC9A 3PA9A 4OMAA 2K7LA 4LK1F 3QRFF 2QB3A 3ERED 3I59A 4ADDA 2W24A 3DFGA 4L0OA 3USFA 4P96A 2RN7A 2W8UA 5FT6A 4IJAA 1U5TC 4U88A 5ILVA 1GBNA 2Q7WA 3FM5A 1V3FA 4JEWA 1RNLA 1S09A 3GZCA 4XSZF 4N9HA 4YFXF 3FZVA 2BE5F 1USTA 3B1CA 3F6TA 5K5OA 3ZP5A 3R4KA 2ZMEB 4ITGA 3MBBA 2GQQA 1DFOA 1SD4A 1QGNA 4JEYA 2L4MA 2H6CA 3QU6A 3FSLA 4R2NA 4BNCA 5FT8A 3FXQA 4M2KA 4FX4A 2QWWA 4DGTA 3TOAA 2HUIA 4Y17A 2OQGA 1V2DA 2RQPA 1P92A 3BCAA 4PVFA 3HSFA 4BA4A 3J80K 3HRUA 1TOEA 2HEOA 3QN6A 1O3TA 2YX7A 4M9XA 3JSOA 1WYUB 3CJNA 3CQ5A 2PEXA 5LH9A 1TPLA 2YKYA 4PIWA 5F9SA 2M45A 1H1CA 1DTYA 3VP6A 4E1OA 4ENKA 2JJEA 2DAOA 4J5UA 4EVIA 2RV8A 2V1UA 1N31A 4BMKA 2GAUA 4IRHA 5D5WB 3ZZKA 2BWPA 1CQ8A 3B02A 1I48A 1FP1D 1OHWA 2EGYA 3BPVA 2XVCA 3RKXA 1G4XA 4LLLA 1P2FA 3D6KA 2Q2EA 2VGVA 3FVSA 3E6BA 5F64A 1T0FA 5E18F 2D1VA 4F5FA 2IA1A 1MAQA 1R5GA 4I7HA 2BV6A 2GA1A 2YSRA 3AEMC 3JTHA 2DOUA 2VMWA 1R1TA 2PJPA 5D8KB 3N97A 3K0LA 2KJCA 5E1WA 4QWQA 4MTEA 4MEXF 4BXUA 2ELHA 3L09A 2IW5A 4W8IA 1WYVB 1YFHA 3Q9VA 2DQLA 1BOAA 1ZLJA 1ARGA 3HYIA 2D66A 4WXDA 2F5FA 3J81Z 1SF2A 4R8HA 1AAMA 3K1MA 1DJEA 4EGYA 3I4PA 4IY7A 2G7HA 3RJPA 1CF7A 1EJIA 3H7FA 4CBRA 4OT8A 4ZZDA 2VMTA 4NOGA 5IT9Z 3NEUA 4XAUA 4U1TA 1KU3A 1P6RA 5E4ZA 4BHBA 1BT4A 3N4MA 4HF8A 4A0HA 1AKAA 4KA4A 1MDMA 1OXOA 4I8AA 5TF5A 4RS8A 3PAAA 2HTSA 5E20A 3RYPA 5LLQA 2BIEA 4I0BA 3MAFA 3BJ6A 5LGNA 3VFZA 4EMSA 1SZSA 3TQNA 4LG0A 1B9NA 1AOYA 2E7XA 3D5LA 4F7ZA 1WSTA 3F3XA 5ICEA 1W5SA 1LC7A 5CVIA 4EGZA 3ASAA 3QGUA 1BIAA 4M2MA 1AY4A 2DPUA 3FHZA 3DXJF 2HDCA 2YKUA 1PFFA 4IX8A 3G3ZA 3Q8NA 2HZTA 1YOOA 3WE3A 1XGNA 4UHMA 4AO4A 3A9XA 3CO7C 3F8MA 1OKRA 2EZ2A 3ZRPA 2FYFA 2E7UA 4EB7A 5HLHA 2O3FA 2VN2A 3E5XA 4CDGA 3SXYA 4WX9A 1GXPA 2BWOA 3SQNA 2H27A 2G6WA 1AIAA 3CQ4A 3V8KA 3PJ0A 4L5JA 3DXVA 4EB5A 2PBIA 3I0TA 5D6EA 1IXSB 2OU2A 2W85A 2VI9A 4IYOA 3QPHA 4JBAA 3WCOA 2XBNA 4HYEA 2BGCA 3R61A 3QM2A 2HUFA 2RC4A 1Q1HA 3WG9A 2W7FA 2ZNYA 1O3SA 2QUFA 4G7OF 4PFNA 3EI6A 1XGMA 2HTJA 1TQMA 3SZTA 3WODF 5D5XB 1YAAA 2D1HA 4KT5C 1PMOA 4GRXA 2KJBA 2AY5A 1EG5A 4PCQA 5AIQA 1T6SA 2Z20A 2STTA 5E5IA 1S0AA 5E8GA 5CYVA 3D0SA 5E17F 5L3EA 3K7YA 4OMYA 1J0RA 4ZWVA 4E3RA 1H0MA 4A6EA 4HDVA 2ZP7A 3DR7A 2ISYA 5HLGA 2FNIA 1O3QA 2Q8KA 4K2EA 1KKJA 2VXZA 3COAC 3MZHA 1ASAA 4I02A 2DPDA 3JAMK 3BWOA 1IUYA 2OBPA 3C7JA 1F4KA 1DPRA 2AY2A 1B4AA 2Z3YA 1D7VA 1P3WA 3F6VA 1SPAA 2VONA 4AOAA 4BHCA 2VBZA 2VC1A 3LA3A 2R2NA 1MGVA 2O61A 4PGGA 2YCTA 3CBFA 3DC1A 4UVBA 1TARA 1D2FA 1IRGA 3E6CC 4UV9A 3F22A 1X29A 3MC6C 1YG2A 2H09A 3K40A 3R9AA 3HSEA 3GZDC 1C7GA 4JK1X 1RV3A 4JE5A 1OYYA 3IHUA 3JAMZ 3GO5A 4HF1A 2ZJGA 4CHUA 1TBXA 2NAZA 4UVCA 4Q6RA 5EFSA 2VMOA 1W23A 1LC5A 1BJAA 1ZHFA 2KIUA 5LHGA 2EFOA 1G3WA 2AY3A 5D8LB 1WYTB 2FM1A 3L9FA 4P55A 1Z05A 4AIKA 1UHWA 1C4KA 2EWNA 3EZSA 4ON0A 4GYGA 3WGBA 4WD2A 2LSOA 4L9JA 2QQBA 1M0NA 1MLYA 2L01A 5EAVA 4BAYA 3LA2A 1FYLA 5G2QA 3FZ7A 5G4JA 2BYVE 5F6FA 5FT5A 2ORDA 2YX4A 1ZN2A 3IRRA 3RDIA 2C6YA 5FFXA 2ACJA 4WBTA 5ILSA 3GZ6A 1FOKA 3BJOA 1AICA 2JRTA 1ZREA 3KLOA 1ECXA 4MQRA 1OMIA 4UHNA 2FBHA 1AHGA 4A0YA 1J59A 2FBKA 3AATA 1CF7B 3Q5FA 4LD5A 3ATHA 1BI3A 3E6MA 1B9IA 4KN7X 3TO6A 1G7XA 3VOMA 2XGXA 2M5WA 4HA8A 4IRGA 4KAMA 1B5PA 2F5DA 5LRRA 3E6DA 2IA2A 4R79A 2XH1A 2YKXA 3ZPLA 1TNSA 1AAWA 2CJGA 4XQ2A 2ZYJA 4AVPA 1WKMA 2FXAA 1HSTA 4TV7A 2F2EA 1SD6A 2JJGA 1GC3A 3M5UA 1F9NA 4HX4A 3NYSA 4P7YA 1I1GA 2EFNA 4G6DA 2P6SA 5DCMA 3GX4X 1ASNA 4RAZA 4KYOA 4XJLA 4I0AA 4U0YA 3CLOA 1EH8A 3QPGA 3A2BA 2V6CA 3FM3A 3G73A 1SZKA 2Z9XA 2R5CB 4ZYHA 3GFJA 3F8FA 5JVTA 2GXBA 3B46A 1HW2A 2FEZA 1ORDA 3ABTA 1RI7A 3T5XA 3L44A 4ISYA 1ON1A 1M0PA 3KE3A 4P9UA 1DPUA 2MD5A 3WX9A 1YLFA 4ZYEA 4Q47A 1IBJA 1D8KA 4KUMA 1IF1A 4KN4X 3I54A 2HKXA 1K78A 3DU4A 3NU7A 2VE9A 2OGAA 1J2XA 2E7IA 4H51A 4M71A 1PMMA 3AEJA 2CO5A 2QENA 5LGTA 3FFHA 2CG4A 2OATA 1YTYA 4N0BA 3BWGA 3JWBA 4L18B 1U3EM 1EQBA 1HSJA 3ZMUA 4ATQA 2ESHA 1DP7P 3CTAA 3TQXA 1CGPA 2W7MA 4L9VA 2YR2A 3JWAA 3U9GA 5J8FA 1TOJA 2KKOA 3WTSC 4ENJA 2HZPA 2R0TA 4CICA 1J7KA 1LK9A 2XASA 3B1EA 1H9GA 1FP2A 3JU7A 1XSDA 4WCGA 2MLGA 3FF5A 2VMNA 1GEWA 3EI7A 1EH7A 1FPQA 1BKGA 3CUQC 2UZKA 5FLXK 1QQIA 3HLMA 4IXSA 2E1NA 1K79A 2A61A 3CO6C 2EB7A 3FTBA 4XEWA 4RM1A 4AIHA 1LW4A 3RYRA 4WB0A 1VJOA 2YCPA 1GCKA 1KYZA 2BYLA 4HOBA 5JFRA 4L9TA 5DCFA 4O6ZA 3WKSA 2EFQA 2ZBKA 1ASCA 3WTYC 2Z67A 3NDNA 3PFIA 2M30A 2W8VA 4WXHA 4GSAA 4EJVA 3HOTA 1QZZA 1UFMA 3N5MA 3EIAA 3NRVA 2W57A 1G3YA 1LEAA 1ASBA 1O69A 3BP8A 3LA7A 1B1BA 1HXDA 1WI9A 3RI6A 5F1RA 3FX3A 3I64A 1U5TB 1O3RA 2EZ1A 2D5YA 3TCMA 3ZZJA 4WLHA 3TGNA 3J81K 2W7LA 5ICFA 2X8UA 2CWEA 3GFIA 2Z9VA 4QGRA 2YCNA 4HW0A 3FDBA 4YIIA 1G3TA 2OZUA 2LDUA 3ROUA 3HBXA 2CGPA 1ARTA 5CVUA 1MDXA 2RKHA 4UOYA 2LF7A 1ULYA 1IN5A 2C0RA 8AATA 2CSOA 3RKYA 4KXKA 4CGZA 4KIFA 1KYWA 2CYYA 3MKJA 1JHFA 2DI3A 1R58A 2FBIA 4LNJA 2AS5F 5L3DA 1BW0A 2W7GA 2PG4A 2BIGA 3FMRA 4I01A 1W7PD 3F8CA 1XCVA 5HS9A 1R36A 4BQ0A 2FF4A 4KDPA 4A5MA 1MD0A 4U0WA 1ZARA 3PQKA 1K78B 1UHMA 1YQAA 2IRFG 2COMA 3IC7A 4RB1A 1TOKA 3F8BA 4EFFA 1EV7A 3FXUA 2Z9OA 4YFKF 2EV5A 4LB6B 1JHHA 3W6KB 3W1IA 4PGHA 1MGTA 1T2KA 1EH6A 3R4TA 1HKQA 3OP7A 2VGZA 4M6XA 3F8NA 5JAYA 2XKOA 3II0A 4KMUX 4M9ZA 1TOGA 4AD9A 4U7DA 4BYYA 4E3QA 2FSWA 1L0OC 1P4AA 2K86A 4OC9A 1WKGA 2YOBA 4UHOA 4W91A 1SAXA 3K1NA 3F72A 4G9YA 3WTWC 1CZEA 1ZODA 4PZJA 4I98B 4RAYA 5FD6A 2ETHA 1WRJA 3WCNA 4WYEA 2D64A 3COGA 2C81A 3DPLC 5HDNA 1ASDA 3VEPA 3E2YA 1S3JA 2W84A 3KLNA 4R1HA 1ZRFA 2QA3A 1E17A 4L0ZB 3V8LA 4MNUA 1DUXC 2EV0A 1MLZA 5G2PA 1FWZA 4IF4A 2FU4A 1HBXG 1TLHB 3KP2A 2EPJA 1BJOB 3BWNC 1XB4A 2UXXA 2VBWA 3H3ZA 5D4RA 2D63A 3EIBA 1T39A 4OIQF 2PMUA 1XEYA 3LFKA 4ZDPA 5IT3A 1QITA 2IA0A 1OATA 3RBLA 4A0XA 5EUNA 1B59A 1YIYA 4NHJA 1YJSA 1ZRDA
chains in the Genus database with same CATH superfamily
2LD5A 3MEXA 5E8IA 1QZYA 1T3IA 1X0MA 4ITXA 4FHTA 2JG2A 2QSFX 5CQGA 2QMAA 2W4SA 3AAFA 1U08A 4LMYA 1BI0A 4CBSA 2JUCA 2E7JA 4C2TA 1W4MA 1MH4A 2EH6A 3PD6B 3WHCA 4XLNF 3CMMA 4XK1A 2HOSA 3J7ZI 3ZQCA 2M9HA 2VJ5A 3AOVA 4RGRA 3DLAA 3OYCA 2JSCA 2L7MP 2R7WA 2EJRA 2HI3A 2HQRA 1DGDA 1H0CA 2HNHA 1N75A 2GIVA 3IP4B 4RLFA 2JK3A 5I92A 1M7YA 4BS9A 1JUMA 3KZZA 4RDUA 2PLYA 4A00A 2OV7A 1STZA 1W7PA 2PN6A 1FYKA 1S7EA 4LC3A 5D6FA 2W7JA 4UUSA 2IGKA 4F4EA 1X58A 1DP3A 3FZ8A 3DTKA 1HLVA 3J80Z 1TC3C 2XAFA 3KP5A 2VJIA 4RGUA 4UHTA 4A5NA 4IHTA 4A69C 2BHXA 2F8JA 4EU1A 5JR3A 2BY3A 5CLSA 1FOYA 2PMZN 3P7NA 3VSLA 2HYGD 2QB2A 4Y13A 1FYMA 3DCFA 3ZOBA 1XSVA 1VQOI 3L1PA 3V4GA 4U2HA 2ZSIB 2BI3A 2MYSA 2ZC0A 2A69F 4NQWB 3V7RA 4Y3OA 4NBQA 5H20A 1KU7A 1MMAA 1S07A 2DKBA 1J32A 4G12A 2O9LA 1N2TA 1DQUA 1QU3A 1AKHA 4U7BA 4RAEA 4M3BA 1QZ9A 2EK5A 2X6YA 1BN5A 1FBUA 3LSKA 1AHXA 1AJSB 3FKIJ 4F5LA 2QEXI 3FXKA 3NQOA 3A8UX 3KETA 2LR8A 4HVKA 1XG1A 2B7EA 1ETWA 1CQTA 2GWRA 3EUHA 2COBA 1TWAJ 3CP8A 3ZMZA 4BXFA 3CCLI 1TNTA 1GC4A 4X0GA 3VK3A 2DT5A 2P7VB 3ZMDA 1B9MA 2WWYA 1SMYF 3GETA 2XPVA 5GPAA 4XRFA 5H2FC 2VGUA 4BH9A 2ZFWA 4WLJA 3B6CA 2GMSA 5GTIC 1VI0A 2HUUA 1XPXA 3OYEA 2P5VA 2MH2A 3MKZA 2YRRA 3M9AA 4EEFG 3W2AA 4L5IA 3LL7A 1UKJA 2HKOA 3F6OA 1FC4A 3QU3A 1I6XA 1Z1DA 4K2MA 2VLAA 1AHDP 2RNGA 1D3YA 1IJIA 2E19A 1TQIA 1L3LA 2CV2A 4PK4A 1PP8F 2XDVA 3CF5F 1HDPA 2VOPA 5J8CA 3JRDA 2WKAA 5EZHA 4EJOA 2VT2A 1AJSA 4A0GA 2JJFA 4GO1A 1X2AA 5E79C 3JREA 1N78A 3I16A 1ZG5A 4MLOA 1PUEE 5FT4A 2ISZA 1ZGAA 3CF2A 4WYDA 2RDPA 2L7FP 4XONA 3KP4A 3WTUC 3JZLA 4ZAHA 3HRMA 3SEQA 2DOEA 3GTKJ 4Q5SF 1M6SA 2CANA 1XSXA 2X85A 2VIXA 2Z5UA 4DQ2A 2KDOA 4DJAA 3FWEA 2L4AA 5HOOA 2DODA 1JS3A 1J5YA 3HDOA 3EDPA 3BV0A 2V9KA 1YW8A 3CQZJ 3VK2A 2RAEA 2DO7A 4QPOA 4A0ZA 3CDLA 1UG0A 2X1CA 2P5KA 3HUGA 4FETA 1IN4A 3HPGA 1QA6A 1KONA 2HGCA 2WC2A 2WK9A 4RKDA 3ZRRA 2XRLA 4F55A 4ADCA 3G1MA 4KFCA 1MIJA 4RJYA 2DGLA 1AY5A 1FY7A 2Y30A 1G6NA 5IOYA 4OMZA 1P4XA 4LGWA 4I99C 1LFUP 2R4GA 3TKYA 2DJNA 4OCAA 3VK4A 2Y2ZA 3JW9A 3GW2A 3UAKA 3BJAA 3PNYA 3GBXA 1S5LC 1TATA 5BOXA 3LMMA 2JA6J 3I4JA 4WYAA 1G3SA 5LHHA 3EYYA 3PNVA 4HSTA 2W7HA 2X6WA 3P9KA 4B8XA 4E7SA 5JI6A 3D1NI 4RLGA 4RKCA 3CCJI 1KL2A 3WHBA 3GFLA 4WXCA 2CU7A 4F92B 1MMSA 2AY4A 3TOBA 2QQ9A 3E9KA 4Y4RA 3F0HA 1K4SA 2QM3A 2AY7A 3BDDA 3DRDA 1HOMA 1BJNA 3K2ZA 4M6VA 4A3LJ 3ZGKA 2YUSA 1VQPI 1TASA 1MJBA 2PO3A 5D5UB 2K85A 4IRIA 2QYOA 4P5OA 3EI8A 1B5OA 5BQTA 1V72A 2OD5A 4CYDA 1IG7A 4QPQA 2CQXA 2HP1A 2TPLA 1V5GA 4XR6A 5LRSA 2OKKA 2VODA 1IN8A 2UUZA 3RSNA 2STWA 3NU8A 3I58A 4OU0A 1AMRA 4MQPA 2CUFA 5DV5A 1FIAA 2BI1A 3I53A 3CCRI 4H0EA 4C2UA 2VYCA 3LOCA 2LKPA 2Z9UA 3LSMA 3OR1C 5CVJA 2CQNA 3A02A 3HBLA 5EG0B 2W8WA 1RVYA 3N75A 5FO5A 2UWMA 5EEHA 1LE8B 4N4OB 1F5TA 3UWCA 3VPRA 2OKJA 1ZGJA 4W1VA 1MDMB 3BS8A 3L7WA 2WAQN 1O7FA 2Y75A 3DEUA 4BA5A 4Q31A 1KQ8A 2LY2A 3E2ZA 1R00A 3BCBA 3PDBB 3FKDA 2VXDA 1U9NA 3C2GA 1R1UA 4Q48A 1ZH5A 3PDXA 4RGSA 1QPMA 5BPDA 1IX8A 4BGDA 4OBUA 3DODA 4CCNA 3TP3A 2V1PA 3B1DA 2AEVA 1SZUA 1P7JA 3AOWA 2XAHA 1A04A 4HV5A 1TW3A 2BXZA 4NC7A 2GA2A 4KJZA 3IRQA 3QP5A 1LUJB 3OYFA 1IRZA 3E7LA 3LAPA 4GE7A 2MA3A 3E5UA 4IOCF 4AH3A 2Z99A 3IKTA 2VC0A 1RR8C 1LFBA 1LDKB 3HSRA 5IP9J 3ZQGA 4TN4A 2BW3A 3CC7I 1XMXA 1IUFA 5C4XJ 1MNDA 5B1AH 3S32A 3E6GA 2V79A 5EDNA 2C44A 4EM0B 3OSGA 3BTIA 1XGOA 4XORA 5K7ZA 1MSEC 3SZGA 3GJUA 1P7IA 2L02A 3FISA 1MAPA 2O5RA 3DKWA 3R60A 3EUCA 2JMWA 3QOPA 2YU9J 3P6KA 4GE4A 3KX2A 5GADJ 3UR3C 1E5FA 2OQXA 2Q2EB 3GSBA 1QO0D 1YO5C 1YRNA 3R0JA 2TRTA 4II2A 4JF0A 3M8EA 3RKWA 3ELPA 4ZSWA 1KQ9A 5C44J 1HF0A 3NWTA 1GD9A 1QJ5A 2ZFUA 2JWTA 2HXOA 4KICA 2CW0F 4BKXA 2O8KA 3NYUA 1IN7A 3WZFA 1YIJI 1AWCA 4FT8A 4Q4ZF 2K4BA 2IAIA 3TW6A 5EGOA 4OOIA 3E3VA 2NYXA 3F21A 4FFCA 4G6QA 1UU2A 1R5HA 3H9GA 5HS8A 4I2OA 3I5UA 1AIBA 1OYIA 3G1LA 1TOIA 3H0DA 4II3A 4N4NB 2O1BA 2PMHA 3EZ1A 4BHDA 3RCOA 2FOKA 1A31A 1YW9A 5HNHA 3GZ5A 3A4CA 4FISA 3G8MA 3IWFA 1E0EA 3JRIA 4K2IA 1SD5A 5EUEA 1FBSA 2NVTJ 2ZUKA 5HLTA 3F9TA 2KFDA 4WWCA 2DMNA 3O6BB 2K3PA 3BZ6A 4MKKA 1A6IA 2ELKA 1IV6A 2BXYA 3P5JA 4YG2F 4FCYA 2E1CA 2PB0A 1N8PA 4QSHA 4LFUA 5KHDA 2QSHX 5DCMB 3MKWB 1Y6IA 3LSHA 3MC6A 4AZKA 3QHXA 3W6JB 2LVSA 1XD7A 4CXFA 1OCTC 1D5YA 4AIJA 2XF5A 1X28A 5M49A 1D1AA 2H94A 5HVQC 2MABA 1CS1A 2D61A 3HVYA 4DQ6A 5TJJA 3ZN0A 1OR7A 4LK0F 3DBRB 1IW7F 3ISPA 1W7MA 2WK7A 2VT3A 4CUGA 3DLLF 2CH2A 3F23A 1LDDA 1VQ9I 4QTRA 4HV6A 2G9WA 2D2WA 1T08B 1WQ2A 1OHVA 2I10A 1Z7UA 1OLTA 2EINH 5HODA 2CTZA 1K83J 3DTIA 3CUOA 5DJ1A 2XAJA 1YHQI 1VF9A 1IO2A 4Z2YA 2B63J 3SEZA 3OIQA 4IVNA 1S7OA 2MBFA 3GTQJ 2BY1A 1OYWA 3F0CA 1S8NA 1FG7A 4XRSA 2DU9A 2IJLA 1C0WA 1E3OC 3TFTA 3BR3A 1Y4IA 1Y39A 2DMQA 1MW7A 1QPIA 2CV0A 5G4IA 2K3FA 4MQ9F 3VODA 1JUPA 3OOUA 2D7YA 2GSAA 3SFZA 4DBQA 2GB3A 3K10A 2QCOA 3U21A 1WKHA 2M1BA 1BIBA 2EZLA 3PQJA 3C3WA 1RV4A 2D65A 3T32A 3KEOA 4LLGF 3ECDA 3GUDA 2VBXA 3OMYA 1AA7A 1Z77A 5D5VB 3JRGA 3H92A 1GVDA 1OJLA 2NS0A 2G7UA 2WV1A 4LG0B 1X1CA 3G2BA 1ASGA 3HGYA 2HVRA 4GE9A 3VYUB 2Q1ZB 5GTHC 4ATPA 2AY8A 1BI2A 2OAZA 2E2IJ 4AYBN 1D0XA 4BQNA 5EIGA 1YS7A 2FOWA 2HFHA 2W7KA 3AEPA 1XCBA 9ANTA 1W5CC 1PG8A 5AX8A 3MCZA 4HRIA 2XAQA 1ZLKA 2HP2A 3ISLA 3LV2A 4PFPA 3J7AY 2FD5A 2FA5A 3CCYA 1G4DA 3G0TA 1WYTA 1TQPA 3QPTA 4V2FA 2VOOA 1ZR4A 3QI6A 4A3IJ 4FQGA 2M8EA 3HXLA 2KIMA 2FNPA 2CMPA 3ECOA 2FRHA 1I41A 3PGYA 4ADBA 3QAHA 4IHWA 2ZJPF 3OKSA 2PQ8A 4EJWA 3JCUC 1U9OA 3LQQA 1JE8A 2DXIA 1ELQA 1MZBA 4OWRB 4B48A 3WU0A 3I71A 3JRBA 4G7HF 2HDDA 4M73A 2A6HF 4QLCU 4M9SA 3PUFA 3MAJA 2EQRA 2HYFA 3ZQ7A 4R5ZA 3IAS2 1FZPB 3RBFA 2K5CA 3L8AA 2P81A 3BR1A 3HTSB 1BJ4A 1LB2A 3ABLH 4MEYF 2BZTA 1LE8A 4ZDLA 3PL8A 1ZGWA 2EO5A 5EIGB 2IVMA 2BEOA 2KRFA 1QZEA 2FQ3A 2JA2A 2X5DA 4ZASA 2Y0MA 1NG7A 2WV0A 4RM2A 3G1OA 1OPCA 3LY1A 3V8JA 4KIGA 4HX8A 5K5RA 5FLVA 2TCTA 1BM9A 2HOXA 5EUDA 5C6UA 3HRSA 3NNKA 3VOEA 4BACA 3WTVC 3S3OA 4AZJA 3KKIA 1IAYA 3JTGA 3IH3A 4LIUA 1EF4A 4XJOA 4OIPF 1B6AA 3V42A 2R7OA 4IO9F 5J4YA 2ECCA 1FNNA 4NDLA 2DK8A 5FD5A 3HOWJ 2DMPA 4F5IA 2ZXWH 4ZWMA 4A6TA 1ZKGA 1GEXA 1EA3A 2W7DA 2WK8A 4IOAF 1JT6A 1QHGA 1BR4A 4JX4A 2DA5A 1EKEA 2CY8A 2FNUA 4BHPA 1IXRC 3NUIA 1WJCA 1ASEA 1WJFA 3WGHA 1WHUA 4BL0B 4ZZLA 6PAXA 4H4KC 2X4HA 5J40A 4BJ5C 1OXPA 2JGTA 3TDZC 2VLFA 3BCXA 1TW2A 1C0NA 3DF8A 3QOEA 1GEYA 3GF2A 1H88C 1ONVA 4F91B 2R5CA 1CQ6A 3IKVA 2NVUB 5J47A 4HPQA 1AHEA 4GYIA 3MVPA 1AMAA 2L2OA 4DW6A 3AEJC 5BS6A 1NHAA 2R7RA 3M1EA 4WYCA 3GZNB 3I4MJ 5DUIA 3JSPA 3S2HJ 4IL6C 4LNMA 1WJDA 3HQTA 3S1MJ 2JZYA 1J9IA 2DGMA 3OL4A 2WA0A 4HLYA 3FMQA 3CMEI 4LLNA 4RB2C 2RQQA 4UUVA 3AFHA 4ZYAA 3NRAA 4MIMA 1DKAA 2R7TA 2DCEA 2VMZA 2AQFA 5K1YA 3QWLA 2A5YB 3LQRA 2CRGA 4XLPF 2E2JJ 2VGTA 5EQCA 1ETXA 3DPTA 1YX3A 3MWMA 2DFIA 1ZOBA 4BUPA 1T33A 4JEZA 1GHCA 1NK3P 2ZNZA 3Q3SA 3EUKL 2P4WA 3M7GA 4WXBA 2VMYA 4G6TB 3WTTC 2M87A 3OYLA 4Q75A 4PSWA 1SEUA 2VI8A 2XKPA 3ELEA 1B4XA 4BY7J 3K69A 4ENMA 2FMYA 1DGWY 3O8HA 2ME6A 5DYMA 5FKNA 5K7FA 1MJ9A 1VQ7I 4YIFA 3H14A 2J5OA 1YS6A 3ML6A 2LNBA 3K9TA 2LK2A 4M3EA 4EJUA 3BQZA 2DFHA 4J00A 4ZDOA 3JRAA 2QLRA 1OISA 3HZJA 2H1LA 3FKJA 1WH7A 4ITVA 4MQQA 4WYFA 1LC8A 3TDUC 1X1PA 1QISA 2LG4A 3NWSA 3BB8A 3LWSA 4Q76A 1HA8A 1V5FA 2XV4S 3KFWX 3S2WA 4ABZA 1Z91A 2V1XA 1YRNB 1H9TA 1AJRA 2BIAA 1T0FC 2EZHA 1MMDA 4A72A 3PO3J 1M0QA 4BE2A 5ERIA 2K9SA 3GCMA 4NB5A 2ZCWA 2ZMEC 1R1VA 3JR9A 1XS9A 3HOVJ 4B47A 2BKWA 1QHHD 3I59B 3GFMA 4W1UA 2LREA 3FK6A 2DJIA 5FFZA 4CYCB 2D7ZA 1ZYRF 3K4BA 5KNLA 4DNCA 1BQAA 3WLXA 4PDKA 2K4JA 4UV8A 5B1BH 5DD4A 5F0HA 1CZCA 2Z1ZA 2UXNA 3FXLA 3GMEA 4N9IA 1QBJA 3DKXA 2GZWA 1SVLA 2LYCA 4R5FA 1I1SA 2CB1A 1D1BA 1U8RA 3D5RC 3FQ7A 5HS7A 1LJ9A 1J75A 3FVXA 2W8JA 3AELA 1R22A 1I5ZA 4MFEA 2CQKA 1R23A 2NS7A 2V9VA 5E1ZB 4MHGA 3OYKA 1AMQA 3DXWA 4NQWA 2CH1A 1TWGJ 2TDXA 2OTJI 5KVRA 1BOBA 4EQQA 1AKCA 2VQLA 3C1DA 5LGUA 2HORA 3CCMI 4OTLA 3E97A 4PJMA 4HAMA 1GXQA 1O7LA 2CH0A 2IT0A 4NHJA 1ZG1A 1GDEA 3E77A 1WYVA 3HOSA 2HYJA 5E1XA 4ZH4F 3KP7A 2IXSA 2GQNA 2EIJH 3OSFA 2HOYA 2DQRA 3B8XA 4M2JA 3W1HA 1AY8A 2X5FA 4HDUA 4J01A 4Y52J 3SZPA 3MADA 5HDKA 4IW7A 1W1WE 3N0LA 3EI9A 3WKRA 3ONQA 4E70A 4W5KA 2LLKA 3DV8A 2YHKA 2CJDA 3KCCA 3DTEA 1V55H 1X3UA 3FMSA 1FOXA 4G8XA 1LS3A 5DEQA 1K7AA 3CC4I 1C7OA 1RPWA 5K7HA 1Y8RB 1CL2A 4PFFA 1MJAA 3REOA 1MDZA 2F6CA 2ME0A 1S06A 3BOQA 1CJ0A 4A0HA 3U1KA 2V1DA 3PD6A 2CUZA 2BHYA 2AXLA 2KMUA 3OY9A 2VI6A 2X0LA 2X1DA 4Y0HA 1VQ4I 5F1JA 1ITYA 1YNUA 2ZSHB 3HB9A 5EJCA 1SAUA 1LKCA 2RVCA 3BG6A 3ECHA 1XI9A 1R7JA 5KAIC 1JT0A 2QZ8A 3KEYA 4O3MA 5L3FA 1AX4A 3AEOA 3RPQA 3WTZA 3LVKA 1ARSA 1IX6A 4ESJA 2O0RA 5KK1A 2W82A 4LW4A 3RCHA 3GBGA 3GWPA 4LJZF 1XN7A 2FMLA 3OR2C 2L3DA 4C3IJ 1V2FA 4WB0B 1YIZA 5J8QA 3S8PA 2R5EA 2R7SA 1SFXA 4XKBA 2MLKA 3CESA 1QGPA 3T0YA 4CCJA 4ZJZA 2KQRA 2RGVA 3LVJA 1VQ6I 2AHQA 4W1WA 3HG9A 4GRIA 1M4NA 3MQ0A 4XRMA 2IS1A 4K2BA 3VYSB 2L0KA 1B8GA 4DYCA 1GVJA 4XL9A 1FOWA 1U0JA 4EV0A 1G2HA 1MDOA 5G0AA 4LIVA 4XJMA 4JEVA 2QSGX 1RC9A 2JJ7A 3HHHA 2Z61A 5L3CA 3GEZA 2DN0A 1FT9A 2Z9WA 5EF6A 3MKLA 3HUGB 3AENA 3DZZA 3SHFA 2HQNA 4DZPA 1K6OA 2VUMJ 2E60A 2B0LA 3CMYA 1KU9A 1X19A 2ZXJA 1POGA 2VIAA 1BJWA 2O6GE 1I6HJ 1YI2I 4XLAA 4WYGA 2M0MA 4XN3A 4IYOB 3ZN1A 2AY6A 2ZSMA 3CCEI 1Z6TA 4D0PA 1HKTA 3BN1A 4HX7A 1I29A 2LBFA 3ABMH 3NAUA 2PJRA 3MZ8A 4E7JA 3WG7H 1W7LA 4JEXA 3O3KA 5FGMA 4CH7A 2R3SA 1RZ4A 4V2GA 5C3EJ 1K61A 1CQ7A 4B3XA 2EBIA 2ZMEA 5DX5A 2KIFA 1SMTA 5A2QZ 4UVAA 1LKXA 1KQ0A 5D4SA 3BQYA 2P5LC 4XKCA 1X3ZB 2HQAA 3DEWA 3ZMTA 4IHSA 5DB5A 3ASNH 1IUGA 2QBTA 5AONA 2A6EF 4XJPA 1Z7DA 4KNYA 4ETSA 1NH3A 3FXRA 4GEBA 4YRVA 1G7WA 3P1TA 2W25A 4DBRA 5L3GA 2EA4A 1FLIA 1APLC 4XSXF 2VGWA 4BXXJ 3AEMA 3NARA 3ZRQA 3MZYA 3PIPF 4F5MA 3EETA 1WWXA 2M2EA 4PSXA 1FJLA 1HQCA 1UMQA 3LWFA 4ZLVA 2NNNA 2DDAA 1WJBA 3TMOA 5K5QA 2ZSLA 1AHYA 3H0GJ 3M8FA 4L0YB 3K4KA 4XN0A 1AHFA 1W7NA 4ESBA 4DBCA 4MGRA 3MAFB 4J8LA 4I09A 2DTRA 3I4NJ 1XTAA 3W2WA 2ADUA 3KZYA 2VBYA 5F04A 3BG5A 5J6XA 1SFUA 1UCRA 2CINA 1XGSA 3HL2A 4GDFA 1DJ9A 2DBBA 4UQVA 2R5YB 2J5PA 1AKHB 3CDHA 5K8BA 4M3DA 3S1RJ 2E5ZA 2XUBA 2JT1A 3DPUA 4PJ0C 2P6TA 2A07F 2PB2A 2IP2A 3FBNB 1JGSA 3DP7A 3L2CA 2E1OA 1BBYA 3T1BA 1VTNC 1GC0A 4A3BJ 2VIBA 2ZXHA 3I5TA 4X6AJ 1FEXA 2C7TA 1IXCA 5DD8A 5LEKA 3E2FA 1ZRCA 4HLXA 3K70D 3W1JA 2GOXB 4A3DJ 1MMNA 2ESNA 2DOFA 1D7SA 2ID3A 3ABUA 4A6DA 2QLZA 2LY1A 2QVOA 2ZO4A 3RQ1A 2X3LA 2NOJB 1XMAA 2V9PA 3EQLF 3BPXA 1BQDA 1V2EA 1ZQ3P 2EIMH 3PDBA 4ZM3A 3M8JA 3E2ZB 1JS6A 3OYMA 1W7PB 2E1MB 3DQVC 5TISC 1ZAOA 5KCMA 2DMUA 2N8GA 1DGEA 2DKJA 4RITA 3HMUA 3L00A 4MY5A 3VAXA 1YX5A 3JRCA 3BY6A 1T98A 2R7FA 3ZMVA 3QODA 2Z1YA 3A9YA 4W1XA 3BC8A 2JVHA 2KIQA 4HQEA 4UNOA 1M0OA 4N0WA 4G94A 4ZYDA 1WJAA 4HZFA 2RFVA 2JPBA 2JTVA 1FSHA 3LVMA 1MBFA 1X4OA 3GWZA 5BJ4A 2FE3A 4A12A 2YPRA 1IX7A 2Y69H 3BR6A 1YJYA 3BG9A 1UU1A 1YJZA 3BR2A 4OIOF 3K4NA 1WPKA 4GXOA 1IRFA 3WGGA 5FLXZ 3IL2A 3KP3A 4P9FA 5LHIA 3SFIA 2W7NA 1LEBA 2XAGA 2JISA 3FQAA 1VZ0A 2DGKA 1O57A 2M4GA 2HQ5A 3BR5A 1I27A 3OYJA 5ED4A 1WSUA 2PI0A 1D7UA 2ZKZA 2ICWG 3PSFA 1ASFA 4AM3A 3OOPA 1Z67A 3CP2A 3TEDA 2CJJA 3Q9SA 3CMAI 4ZM4A 3Q0VA 1UJ8A 1VQ8I 3FRKA 5TRDA 2EILH 4FX0A 2WTEA 4IHYA 4ENNA 2OCEA 1D7RA 2L9RA 2O7OA 4ADEA 2NNYA 1U6GA 1UZCA 4HQMA 2AY9A 2VE8A 4LITA 2HOEA 3WU1B 4FE4A 1IZ1A 5CPRB 1KMJA 1WYUA 4YFNF 1CL1A 1SVVA 2V4JC 1T38A 3GLXA 1KL1A 3KGWA 3A9ZA 3AG1H 4CVQA 5EZGA 5AIPA 2XB0X 2EV6A 2IS4A 4ZSYA 1X2NA 3ULQB 4HF2A 4ZYGA 3G6EI 3IAM2 1R9TJ 1AMSA 2E54A 4AO9A 2W7EA 2LY9A 2O0YA 1KMKA 2ZJ2A 5L3BA 1BC7C 4KMFA 2K27A 1ZG3A 1PP7U 1BC8C 3NX3A 2OGEA 1RVUA 2GXGA 4TMRA 2H8RA 3CCVI 1QNTA 2K02A 3CQ6A 1JG8A 2W7IA 3N05A 3B73A 1U2WA 1Z0XA 3H3VK 1SD7A 1XDUA 2UV1A 4BJ6C 4PJLA 2R7DA 4G7ZF 3G7QA 3MEBA 1QJ3A 2GXAA 3EI5A 1Y0UA 3GYHX 1HKSA 4WF2A 3OYHA 1ARHA 5M5WJ 1YJNI 2VJJA 3R6SA 3VYTB 4Y33A 2X6XA 2WBMA 1O4SA 2XPWA 2K40A 4ASNA 3RUYA 2FNAA 2XB5A 3V7CA 2VMVA 2R5ZA 3H5RA 4MO7A 1XMKA 1ZELA 4AYBA 3DYDA 9AATA 4B09A 1PJRA 4S05A 1MKMA 4MTDA 1IAXA 4F5KA 2M7AA 2BVLA 3CUQA 2CW8A 4L9NA 4IQJA 4M72A 1O62A 1WFXA 4WXGA 2AY1A 4O5VA 2O03A 2R7ZJ 1DJUA 2FN6A 4P3MA 3RZOJ 1X1DA 4A2UA 3ASBA 5E3KA 2W48A 2YKVA 4A3FJ 5ICCA 1JKQC 3HC7A 2WB1A 4AVZA 1TTYA 3PNTA 2AQEA 4F5HA 4WXFA 4JP0A 2XROA 4YIRX 5EAAA 2HPIA 3RCHB 2A3SA 4OBVA 1YIOA 2EPFA 2G0EA 2OQRA 1S08A 4F5JA 4NC8A 1D5VA 1EJ9A 4PJNA 4LW2A 3MAUA 1HW5A 3U2RA 1TWHJ 2D45A 1BJZA 1UU0A 3AENB 3ZQHA 2EZIA 5GP9A 4KISA 1DDNA 1FMWA 2DR1A 2VMXA 1Y56A 4OYTA 1RESA 1SFEA 1S7AA 3K4JA 1M32A 3F9KA 2HDWA 1MMGA 3EYIA 4U87A 5CVRA 4RIZA 5D95A 3LSTA 4LG3A 4CXQA 5HDMA 3TO7A 1OCOH 1XDSA 2P7CB 4MKJA 2DDBA 3GR9A 2CFBA 1LNWA 4HNVA 1KU2A 3WGCA 1U8BA 2CJHA 2VKDA 4CXRA 3TO9A 2VMUA 3ZRGA 3RIRA 1P4WA 2HOZA 3PFYA 4ZTFA 2BWNA 2E1MC 2JA5J 2EFWA 3S1QJ 3K4LA 1RIOH 3PPLA 3AG4H 1WJEA 4MFDA 3SDBA 1E5EA 2O7CA 1J04A 2PFBA 3BROA 2Y31A 5LHAA 4CZCA 2AATA 1BW5A 1U5TA 1ON2A 2LP0A 3FXJA 1ETKA 1W5TA 2YS9A 2DW4A 3GVAA 4BQQA 3G71I 2W8TA 5IY5H 4GCVA 4BQAA 1FTTA 4J19A 1VQKI 2WY8Q 1VP4A 4OINF 4YEJA 1GDTA 2M7BA 4I6ZA 2E5NA 2MH9A 2NRAC 5M4BA 1E3PA 1YW7A 2OA4A 2BYJA 4EM1A 5IOZA 3K28A 3P9IA 4HBLA 5LBQA 2MC3A 2OJED 1IVRA 1W36D 3LG0A 2DFFA 1OCCH 1X3WB 2XF7A 4PJJA 1OCRH 4MQVA 5H6RA 3HOYJ 5IYDJ 2X9DA 2Y48A 3IWZA 5FKKA 2LTPA 3VB2A 5DJ9A 2NVYJ 2KP6A 5F8VA 5IYCJ 5LFAA 2HWVA 3MMYB 1S29A 3RPUA 2JJHA 5JVGF 4E77A 4XRSG 2DLLA 2VGSA 1JF9A 1YYVA 5A2QK 1ODDA 2GLOA 5D5SA 3K1PA 4IQ4A 3TFUA 5E3MA 2V0YA 1ASLA 1KKPA 1BJOA 3JTXA 1FSEA 4A0FA 2IPQX 1ASMA 4CCKA 2YU3A 2Q0OA 1IAWA 1C9CA 3FZ6A 3IF2A 1GV2A 3E0JB 5FKLA 1S6LA 1VEFA 3CUQB 1ARIA 3MFKA 2HR3A 4UY8I 4EMYA 2CW7A 4KYWA 2L54A 3ACZA 4IZZA 3CCQI 3HTUA 1FG3A 3FD0A 4A6UA 4EM2A 3NYTA 4A6RA 2P8TA 1LDJA 4B9BA 3WY7A 3AV7A 3WE2A 2HS5A 2M0CA 4XIDA 3WGIA 1GLNA 1PDNC 3HOUJ 2BI9A 5G09A 3FQ8A 2CFXA 3GTMJ 3FIWA 3HEFA 5HLIA 5ICGA 3FFRA 4Y0DA 3W2VA 3P9CA 4DGWB 3C18A 2H8WA 5ILUA 1RR7A 2QBYA 2VMPA 4MSOA 3VSKA 2F5CA 2XGEA 2FQ6A 5BJ3A 5IWQA 1NK2P 4AC0A 2BVMA 2E7WA 2MSYA 1FBQA 1XC5A 3UE8A 4P1WA 3IUOA 5BMZA 2RNJA 3LSIA 4HEA2 2QBYB 4HF0A 2DK5A 1HW1A 2FJ1A 5DTDA 1D8JA 3LSRA 3I55I 1JKPC 2Z1DA 4ZC3A 4F5GA 1UB9A 4Y0IA 4B98A 1U78A 5F0CA 1DU6A 4RA2A 2DA1A 2WB1N 4RJ0A 3O8GA 3HT4A 1KGSA 4PUSA 1G4VA 1BW6A 1I3QJ 1F1ZA 2XF6A 5FKMA 4BY1J 1SVOA 5JLXA 4GDYA 4E7IA 2XIGA 2E34A 4D7MA 2GMUA 3OWTA 3HHGA 5EEGA 4IPAA 2BI5A 3HKZN 1OHYA 4CZZA 4WP0A 2IBDA 4GGGA 1RUNA 5HHYA 4KIBA 2MGQA 2XHKA 3JW4A 5B5EC 5H6QA 1N77A 1GC2A 2K9MA 3R0AA 4LNLA 1KA8A 4A0RA 3TATA 2Y0SN 3HIFA 4IXAA 2LF8A 5CVVA 3QYEA 1BS0A 2AEUA 2A68F 1Z6RA 5M4DA 5M46A 1LFPA 3L2VA 1FC3A 3L2QA 1LQ1A 2VQGA 4M74A 1I43A 2YRIA 3OYDA 2NMPA 4IXOA 4YELA 1A36A 1SFKA 3M3YJ 3H9QA 3HPHA 2EA2A 1REPC 2R92J 4JE5D 3KGXA 1B9HA 2FX0A 3A03A 4RB0A 3T8RA 1FIPA 1ETYA 5DDGA 3H1CA 3M1CA 4XK4A 4RB3C 5JHUA 2DT7B 1PYVA 3E5QA 4DOZA 3J7AO 1OCPA 1UG2A 1K4TA 1MNMC 2MG4A 4JX5A 3K70C 4U0VA 1QIRA 3BZKA 3H3UA 4Y15A 2O8XA 1SFFA 3NUBA 4IXZA 2JPCA 3KE2A 1E2XA 4BE1A 1JXSA 2IGOA 3LVLB 3GZDA 4RGXA 1HCRA 2Y0SA 5LEJA 2ECBA 5IT9K 4JQFA 5CJ9A 4CCOA 2VQHA 3V7SA 3SYTA 1AKBA 4FL0A 3FCRA 2BI2A 4ESFA 4LB5A 1SFOJ 3IHJA 3PIUA 4B1RA 5DM6F 3RZDJ 7AATA 3QP6A 3ZMSA 5BPIA 1FX7A 2M34A 3ELKA 3O2PE 3U1DA 1ELUA 3DR4A 2OCCH 4M6YA 3KP6A 3SJMA 3WTXC 1LVAA 4OAYA 2M8GX 2XRNA 3RTRA 1IN6A 4XMYA 1V4RA 4AWXB 2MFZA 1Z9CA 3QBOA 3BG3A 1AU7A 5FB2A 4WK8F 2MW8A 3KEQA 2QQAA 3HRTA 5DUKA 1O61A 2CSTA 4XBFA 5HDGA 3DKYA 2F5EA 4OIRF 2VMSA 2H6BA 3RI4A 1UHSA 4JF1A 2EFPA 5IP7J 4EJTA 2VMQA 5B3SH 1USSA 3T8TA 5HXXA 2A6TA 4CO8A 1W3UA 1VQNI 3BT9A 1RUOA 4O6JA 1BR2A 2VLHA 3BWNA 5IYBJ 2Z33A 1DU0A 3LAJA 3CAIA 4R8DA 2VMRA 2OTLI 1LW5A 3X2QH 3GXOA 1C7NA 3QYFA 4S04A 1BI1A 2F4OB 2FQ4A 4UXNA 3NTJA 3PO2J 2BBYA 3DWLE 4F52A 3OV8A 1ZC9A 5DS9A 3PA9A 4OMAA 2K7LA 3K7AJ 4LK1F 3AL0B 3QRFF 2QB3A 4CYCA 5J4VA 3ERED 3G4SI 1BL0A 1QVUA 2L9NA 3I59A 1IV8A 2W24A 4ADDA 3DFGA 4L0OA 4E7LA 3USFA 3H9JA 4FE7A 4M3GA 5FKOA 4P96A 3ESWB 2RN7A 3FVUA 3OS1A 2W8UA 5FT6A 4IJAA 1U5TC 4U88A 5ILVA 1GBNA 2Q7WA 2VPLA 2VKEA 3FM5A 4CCMA 1V3FA 4JEWA 1RNLA 1I39A 4A3MJ 1ACIA 1HC8A 4XM3A 4KITB 2VL8A 1DGRM 1S09A 3I3LA 3M07A 3GZCA 2ZJRF 2Z16A 4XSZF 1MBJA 2I8DA 4N9HA 4YFXF 3FZVA 2BE5F 1USTA 3B1CA 3F6TA 4E7ZA 5K5OA 3ZP5A 3R4KA 2ZMEB 4ITGA 3MBBA 3CLQA 5FRMA 2PJRB 2GQQA 1DFOA 2ELJA 4C3HJ 1SD4A 1QGNA 4JEYA 2L4MA 2W1OA 1T95A 2DTZA 1GV5A 2H6CA 3QU6A 3FSLA 4R2NA 4BNCA 5FT8A 5GAGJ 2DYSH 3ASOH 3FXQA 1T56A 4M2KA 2KZGA 4FX4A 2QWWA 3CC2I 5M3FJ 3RPUD 4DGTA 3TOAA 2BY2A 1W0TA 3HJEA 2ZB9A 2OQGA 4Y17A 1V2DA 2HUIA 2RQPA 1P92A 3CCUI 3BCAA 4PVFA 3HSFA 2XPUA 4A3KJ 4BA4A 2ZXIA 3FDYA 5IP6A 2JUGA 3HDDA 2EH3A 3J80K 4I76A 3UKGA 3HRUA 4HSRA 1TOEA 2HEOA 5DM7F 2B9SA 3QN6A 1O3TA 3I9V2 1E3HA 2YX7A 4M9XA 2EIKH 3JSOA 3BLYA 1WYUB 2IEKA 3CJNA 3CQ5A 2PEXA 5LH9A 1TPLA 1MBHA 2YKYA 4PIWA 3FK7A 3ZXSA 2XSJC 3BTCA 3EUHC 5F9SA 2M45A 1H1CA 1DTYA 1X1BA 4HNTA 3VP6A 4E1OA 4ENKA 2JJEA 5E3LA 2AXTC 2DAOA 3FHNA 5FROA 4J5UA 3Q0UA 5J1RA 3K6GA 4EVIA 2RV8A 2V1UA 1N31A 4F93B 1B8IA 2JQ7A 2X6OA 2A05A 2LOOA 2DT6A 3JRHA 4BMKA 2GAUA 2XC7A 4IRHA 3EPZA 5D5WB 3ZZKA 2BWPA 1CQ8A 3B02A 5GPCA 1I48A 1FP1D 3L2UA 1OHWA 2EGYA 3BPVA 2XVCA 3FXMA 3RKXA 5J3LA 5LD2C 1G4XA 3KYLA 4LLLA 1P2FA 1RKWA 3D6KA 2Q2EA 2WAFA 2VGVA 3FVSA 3E6BA 4E4HA 2HZDA 1ETQA 1T0FA 5F64A 5EYRA 3ZQQA 5E18F 2D1VA 2CFOA 4F5FA 2IA1A 1P9QC 1MAQA 1R5GA 1YOVB 4I7HA 2BV6A 4NUBA 2HVQA 2GA1A 2YSRA 4CSWA 3AEMC 3JTHA 2DOUA 2VMWA 1WZ2A 1R1TA 1R6RA 2PJPA 5D8KB 3N97A 2BW3B 5M5XJ 3K0LA 2KJCA 5E1WA 4QWQA 1IRXA 4MTEA 4MEXF 2F4IA 4BXUA 3OYIA 2ELHA 2OPTA 3L09A 3S3NA 2IW5A 4W8IA 2DA7A 2JN6A 1YFHA 1WYVB 3Q9VA 2DQLA 1BOAA 2DA3A 1ZLJA 1ARGA 1Y1VJ 3I56I 1OQYA 2CQQA 3HYIA 4EATA 2D66A 2JSPA 2WAEA 4WXDA 2F5FA 2XSDC 1VQMI 3J81Z 1SF2A 2DA6A 4R8HA 2MD0A 1AAMA 3K1MA 1DJEA 4EGYA 3I4PA 2R7UA 2G7HA 3RJPA 4CCLA 4IY7A 5E4ZA 3GLLA 1CF7A 1EJIA 2QGUA 3H7FA 4CBRA 2VKHA 4OT8A 4ZZDA 2VMTA 4NOGA 4ANJA 3NEUA 5IT9Z 4XAUA 4U1TA 1KU3A 1MNEA 1P6RA 2L9SA 3SDGA 4BHBA 1WH5A 3N4MA 2JA8J 1AKAA 1X2MA 1BT4A 4HF8A 3A0HC 4KA4A 1MDMA 1OXOA 4I8AA 5TF5A 1OFCX 2LFBA 4RS8A 3PAAA 2HTSA 5E20A 3RYPA 5LLQA 3S15J 2BIEA 1X1AA 4I0BA 3S16J 5J1UA 3MAFA 3BJ6A 5LGNA 3VFZA 4RBOA 4EMSA 1SZSA 3TQNA 4JX6A 3H35A 4KT6A 2VQCA 5C4JJ 4LG0A 1B9NA 3CJRB 2A5WA 1AOYA 2E7XA 3RKQA 3D5LA 1I3AA 4F7ZA 1WSTA 3F3XA 2Z2SB 5ICEA 1W5SA 1B72A 1LC7A 5CVIA 4EGZA 3ASAA 4JOMA 3QGUA 1RETA 2I5UA 1OCZH 1JJ8C 1BIAA 4M2MA 1AY4A 2NOGA 1PVEA 3MD2A 3FHZA 3DXJF 2DPUA 3S1NJ 2HDCA 2YKUA 1PFFA 5HNFA 4IX8A 3G3ZA 2RREA 2R7QA 4BQOA 2HZTA 1O4XA 1YOOA 3Q8NA 1MSFC 3WE3A 1XGNA 1XX5A 1JGGA 3A9XA 4UHMA 4AO4A 3CO7C 3F8MA 1OKRA 3ZQFA 2EZ2A 4NC6A 2FYFA 3ZRPA 2ID6A 3PUBA 2E7UA 4EB7A 2DA4A 4BU2A 5HLHA 4B4CA 1JKRC 2O3FA 2VN2A 3E5XA 4CDGA 1NG6A 3SXYA 4WX9A 1GXPA 2BWOA 3PJRA 3SQNA 2LBFB 3OYGA 2H27A 2G6WA 1AIAA 5E3OA 3CQ4A 3V8KA 3PJ0A 4L5JA 3DXVA 4EB5A 2PBIA 3I0TA 5D6EA 1IXSB 2OU2A 2W85A 4CA0A 2VI9A 4IYOA 3QPHA 4BDYA 4JBAA 4BEHB 3WCOA 3KYDB 2XBNA 4HYEA 2BGCA 2VB6A 3R61A 3K2AA 1JI8A 3QM2A 2HUFA 2RC4A 1Q1HA 3WG9A 5GAEJ 2W7FA 2ZNYA 1O3SA 4RAGA 2QA4I 1WI3A 2QUFA 4G7OF 4PFNA 3BZCA 4W97A 3EI6A 4QIWN 1XGMA 2HTJA 4JYKA 1TQMA 3SZTA 3WODF 5D5XB 1YAAA 2D1HA 4KT5C 1OR7C 3TP0A 4V19K 1PMOA 4GRXA 4AU7A 2KJBA 4UB6C 4UUTA 3A2KA 2AY5A 1EG5A 4PCQA 5AIQA 1T6SA 3DU6A 4RLQA 2Z20A 2STTA 2DFEA 2XAUA 3OYAA 1YJWI 1UAAA 5E5IA 4C30A 4X1EA 1S0AA 2F4MB 5CYVA 5E8GA 3D0SA 4XNFA 3L2RA 2X1EA 5E17F 4LOCA 3VWBA 5L3EA 3K7YA 2E35A 1M1EB 2ZJQF 3S93A 1J0RA 4OMYA 2OUMA 2V6EA 1B8IB 5B66C 4ZWVA 4E3RA 3S3MA 1H0MA 1FMVA 4XLHA 4A6EA 4HDVA 2ZP7A 3DR7A 2ISYA 5HLGA 4Y7NJ 2FNIA 1O3QA 2Q8KA 4K2EA 1J09A 1S72I 4BBRJ 5IPAA 1KKJA 2VXZA 4E6KG 3COAC 3MZHA 1ASAA 4I02A 2DPDA 3JAMK 3BWOA 1ORKA 1IUYA 2BOLA 2M3AA 2OBPA 3C7JA 1DPRA 1F4KA 3QQAA 2AY2A 1B4AA 2Z3YA 3GTGJ 2R0QC 3F6VA 1GT0C 2VONA 1D7VA 1P3WA 1SPAA 4AOAA 4BHCA 2VBZA 1Y0NA 3CZ6A 2VC1A 3LA3A 2R2NA 2E71A 1MGVA 2O61A 4PGGA 2YCTA 3CBFA 3DC1A 4UVBA 1S9HA 1TARA 1A6QA 1D2FA 1IRGA 3E6CC 4UV9A 4XKVA 1TT5B 1IGNA 3F22A 1X29A 1Z3XA 3MC6C 1YG2A 2H09A 2L7KA 3K40A 4BEHA 1X4PA 3H5AA 1MBEA 3R9AA 3HSEA 3GZDC 1C7GA 4JK1X 2LH9A 1T8IA 1OYYA 1RV3A 4JE5A 3OIPA 2HOAA 4C3JJ 5JLWA 3IHUA 2K9NA 5CQEA 3VDXA 3LSPA 1H8AC 2QF7A 2NVXJ 3JAMZ 1Q1VA 2VKVA 3GO5A 4HF1A 2ZJGA 1KZHA 4DYRA 4CHUA 1YITI 1TBXA 2NAZA 4UVCA 4Q6RA 2QKLB 5EFSA 2VMOA 1W23A 1LC5A 1BJAA 1ZHFA 2KIUA 5LHGA 4E7KA 2EFOA 1G3WA 1R4MB 5F27A 2AY3A 3AL0C 5D8LB 3J7YJ 1R71A 1WYTB 3BG7A 2FM1A 4L5EA 3L9FA 1I50J 1Z05A 4P55A 5CKTA 4AIKA 2KZVA 2E2HJ 1UHWA 3RQ4A 2EWNA 1C4KA 3Q0WA 3EZSA 4ON0A 1FTZA 2KPMA 1SVMA 3LSJA 1B72B 2Y9ZA 3KIOA 2DMTA 4GYGA 2Y9YA 1D0YA 3IH2A 3WGBA 2KDZA 4WD2A 3S2DJ 2LSOA 4L9JA 2QQBA 1M0NA 1MLYA 2L01A 4XOPA 5EAVA 2CQ7A 4HG2A 4BAYA 3LA2A 1FYLA 1TWFJ 5KAFC 3FBIB 3IV5A 5G2QA 3FZ7A 5G4JA 1JTYA 2BYVE 1JJ6C 5F6FA 5FT5A 2ORDA 3RQIA 2YX4A 1ZN2A 3IRRA 3RDIA 2C6YA 5FFXA 3PM1A 2ACJA 4WBTA 5ILSA 4HNUA 3IH4A 3GZ6A 3BJOA 1FOKA 2JRTA 2PMZA 2F48A 4A3CJ 4XQFA 1ZREA 1AICA 2K9QA 3KLOA 1ECXA 4MQRA 1IDYA 1OMIA 4UHNA 2FBHA 4M3FA 1AHGA 4A0YA 3ZR8X 1J59A 2FBKA 4E7HA 3AATA 1CF7B 2D5VA 3DBHB 3Q5FA 3H36A 1Z21A 4LD5A 3TBIA 2R93J 3ATHA 1BI3A 3E6MA 4C2MJ 1B9IA 4KN7X 3ZQIA 4XICA 4IX7A 3TO6A 1G7XA 2MC4A 1G59A 3VOMA 1ETOA 2M5WA 2XGXA 2NXNB 4HA8A 4IRGA 2XGDA 1B5PA 4KAMA 2F5DA 5LRRA 3E6DA 2IA2A 4R79A 2XH1A 2YKXA 4AUXA 2CV1A 2ZC2A 3E1SA 4RMNA 3ZPLA 1TP4A 1A5JA 1TNSA 4XLCA 5GAHJ 1AAWA 2M4KA 2CJGA 4XQ2A 2ZYJA 4AVPA 1WKMA 2FXAA 2IS2A 1HSTA 1Y8QB 2F2EA 4TV7A 1WVRA 3L2WA 1SD6A 1Y1WJ 2JJGA 1YJ9I 1GC3A 2VPRA 3M5UA 3KPHA 1JUSA 5J1YA 1F9NA 4HX4A 3NYSA 2WADA 1I1GA 2EFNA 4G6DA 4P7YA 2P6SA 5DCMA 3MKYB 3GX4X 1ASNA 4RAZA 3M4OJ 4KYOA 2X51A 4XJLA 2WAQA 4S0HB 4I0AA 4U0YA 3CLOA 1EH8A 2X48A 3HOZJ 3QPGA 3A2BA 2V6CA 3FM3A 3G73A 1SZKA 1RKTA 2Z9XA 3OYNA 2R5CB 1YE9A 5M3MJ 2R5YA 2CS3A 4ZYHA 3GFJA 1TWCJ 3F8FA 5JVTA 1R49A 2GXBA 2CUJA 4D9JA 2FUG2 3B46A 1MBGA 1HW2A 2FEZA 1ORDA 2HOTA 3ABTA 1RI7A 3T5XA 1BA5A 3L44A 3A01B 4ISYA 1ON1A 3DU5A 5M5YJ 1M0PA 3KE3A 4P9UA 5EGOB 2OC6A 1DPUA 2MD5A 3W3CA 3WX9A 1YLFA 4ZYEA 1V5EA 4Q47A 1IBJA 1D8KA 4KUMA 1IF1A 4KN4X 3I54A 2HKXA 3C2HA 3AG2H 1K78A 3DU4A 3NU7A 2VE9A 1SANA 2L5QA 2OGAA 1J2XA 2E7IA 4H51A 4M71A 4PFOA 1PMMA 3AEJA 2CO5A 2QENA 1JTXA 2L9VA 5LGTA 1VQLI 3DEEA 3FFHA 2CG4A 2OATA 1ETVA 3ZCOA 1YTYA 1R5ID 4N0BA 3BWGA 4NNJA 4D7NA 3EUAA 3S17J 5F08A 3JWBA 4L18B 1U3EM 1EQBA 1HSJA 3ZMUA 4D1QA 1TL8A 4ATQA 2ESHA 3LSGA 2K9LA 4IKFA 2XGCA 3OL3A 1WJ5A 1DP7P 3CTAA 4UB8C 4AIDA 3AG3H 3TQXA 1CGPA 5TGTA 2KHMA 2W7MA 4Z6YA 4L9VA 3JRFA 2YR2A 3JWAA 3U9GA 5J8FA 1TOJA 3TW7A 2KRCA 1F36A 1ZTRA 2KKOA 3ERMA 5FLMJ 3WTSC 4ENJA 2HZPA 1LVKA 2HVSA 2R0TA 4B3AA 4CICA 1RRJA 1J7KA 1LK9A 2XASA 3B1EA 4F3QA 1H9GA 4DIQA 4A93J 3ABKH 1FP2A 1W0UA 1XSDA 3JU7A 4WCGA 2MLGA 3FF5A 2VMNA 2LKSA 1GEWA 3EI7A 1EH7A 1FPQA 1K6YA 2GOMA 3K4CA 1BKGA 3A0BC 3CUQC 2UZKA 5FLXK 1QQIA 3HLMA 4IXSA 2E1NA 1K79A 2A61A 1TZLA 3CO6C 2EB7A 1F43A 3FTBA 4XKWA 3CJTB 4XEWA 2KT0A 3GTLJ 3BR0A 4RM1A 4AIHA 5JHFA 1LW4A 3ZQLA 1ERDA 3RYRA 4WB0A 2GBYA 1VJOA 1Z7LA 2YCPA 1GCKA 1KYZA 2BYLA 3BTJA 4HOBA 4XLFA 5JFRA 4L9TA 2EZKA 5DCFA 2LKXA 4O6ZA 3WKSA 2EFQA 2JRMA 3K4MA 2ZBKA 1ASCA 3WTYC 2Z67A 3NDNA 3PFIA 2M30A 2W8VA 4WXHA 1QRYA 4GSAA 4EJVA 4IEJA 2IS6A 3CD6I 3C2BA 3HOTA 1QZZA 3KZIC 1UFMA 3N5MA 3EIAA 3NRVA 2LC2A 2W57A 3OYBA 1G3YA 3HKZA 2E36A 1LEAA 3TL4X 5E3NA 1ASBA 1D1CA 1O69A 3BP8A 3B6AA 3CJQB 2HU9A 3LA7A 4A3EJ 1B1BA 2AO9A 1HXDA 3MN2A 1WI9A 3RI6A 5F1RA 4B44A 1Z3ZA 3BTLA 5EEAA 1IDZA 2IGNA 3FX3A 3I64A 1U5TB 2F5VA 3A1YA 1O3RA 2EZ1A 2D5YA 2NVQJ 3TCMA 4FTHA 3D5SC 3DBLB 3QYBA 4WLHA 3ZZJA 2DYRH 2DOAA 3TGNA 2WY7Q 2HPMA 3J81K 2W7LA 5ICFA 4D5FA 1PUFA 2X8UA 2CWEA 3GFIA 2Z9VA 3VYRB 3GTJJ 4QGRA 2YCNA 1JKOC 4HW0A 1HDDC 3FDBA 4YIIA 3KYCB 4BBSJ 1G3TA 2KRHA 2OZUA 2LDUA 3ROUA 3HBXA 2KISA 2CGPA 1IC8A 4IHXA 1ARTA 1IJWC 5CVUA 3LNQA 2RKHA 1MDXA 4UOYA 2LF7A 5FJ8J 1ULYA 1IN5A 3PSIA 2C0RA 8AATA 1G8XA 2CSOA 3HM5A 1BR1A 3AKZA 3RKYA 4KXKA 4CGZA 4KIFA 2DA2A 1GUUA 1KYWA 2CYYA 2JA7J 3MKJA 1UELB 1JHFA 2KLOA 3OS2A 2DI3A 3W6VA 1R4NB 1R58A 2BY0A 2FBIA 4LNJA 3CCSI 2AS5F 1ZK8A 5L3DA 2P0WA 3FXOA 3OIOA 4RAFA 4BJTA 1BW0A 2W7GA 2V26A 2PG4A 2BIGA 3FMRA 4I01A 1W36C 4BE0A 1W7PD 3F8CA 1XCVA 5HS9A 1R36A 4BQ0A 2FF4A 4KDPA 2GIZA 4A5MA 3PIOF 2VJ4A 3CDIA 1MD0A 3H5NA 4U0WA 1ZARA 3PQKA 1K78B 1UHMA 1YQAA 2IRFG 2R7VA 2COMA 3IC7A 2LMDA 4RB1A 1TOKA 3F8BA 4EFFA 2OF7A 1EV7A 3FXUA 2Z9OA 3QPLA 4RM3A 2EV5A 4YFKF 4LB6B 2R5ZB 1JHHA 3W6KB 3W1IA 3QPSA 4GFBA 1WGXA 4PGHA 1MGTA 3A01A 1T2KA 4D5CA 4FASD 1EH6A 3R4TA 2JVGA 1HKQA 3OP7A 2VGZA 4M6XA 1LPQA 4C9YA 2LRDA 3F8NA 1VQ5I 5JAYA 2XKOA 1ZR2A 3II0A 4KMUX 1A35A 4M9ZA 1NTCA 1TOGA 4IHVA 4AD9A 4U7DA 4B43A 4BYYA 4E3QA 2FSWA 2NS8A 2HXIA 2H1KA 2QKMB 1L0OC 1P4AA 2K86A 4XLEA 4OC9A 1WKGA 1V54H 2BHZA 1SC7A 2YOBA 4UHOA 4W91A 1SAXA 3K1NA 4A3GJ 3F72A 4G9YA 3WTWC 1CZEA 2PX9A 5F0FA 1ZODA 4PZJA 3HOXJ 4I98B 4RAYA 5FD6A 4ZTJA 2ETHA 1WRJA 3WCNA 4WYEA 2D64A 3COGA 2C81A 3DPLC 3UNGC 5HDNA 1PUFB 1MBKA 2R7XA 1ASDA 3VEPA 3E2YA 1S3JA 5FRNA 2IGMA 2W84A 3KLNA 4R1HA 1ZRFA 2QA3A 4DYQA 4UUSB 1E17A 1VNDA 1MH3A 1WCMJ 4L0ZB 3V8LA 3WU2C 3OS0A 4MNUA 1DUXC 2EV0A 1MLZA 5G2PA 2VASA 2W00A 2GM4A 1FWZA 4IF4A 2FU4A 2L7ZA 1VFCA 3GTOJ 1HBXG 4BDZA 1TLHB 1Z3YA 3KP2A 2EPJA 5BNGA 1BJOB 3BWNC 1XB4A 2UXXA 3GTPJ 2V1NA 2VBWA 2QQ8A 1TT0A 3H3ZA 5D4RA 1ENHA 5EG0A 2D63A 3EIBA 1T39A 1D0ZA 2PMUA 4OIQF 3LFUA 3LFKA 1XEYA 1H89C 1QVTA 3S14J 4ZDPA 3HGGA 4DZJA 2KL4A 5IT3A 2IA0A 4XOTA 1OATA 1QITA 3RBLA 4OAZA 1N25A 4A0XA 2CUEA 5EUNA 2V7FA 1B59A 1YIYA 2OZ6A 4A3JJ 1YJSA 1ZRDA
chains in the Genus database with same CATH