4N0BA

Crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
473
structure length
468
Chain Sequence
ITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKETGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription activator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 133
structure length 468
sequence length 473
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n0bA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0bA02
4ATQA 5L3EA 1OPCA 1KGSA 5EUEA 4U0YA 1B8GA 4LG0A 5D6FA 2O3FA 2CB1A 3UAKA 1ZLJA 2WTEA 1TASA 2XHKA 2LSOA 4RITA 1YW8A 2PB0A 3B46A 1C0WA 4U7DA 3JTHA 2TPLA 1T3IA 3T0YA 4I0AA 2OZ6A 1WKGA 1YW7A 4O3MA 1A04A 4W1WA 2D64A 4KN4X 2TDXA 1AKAA 3Q8NA 4IXAA 1OKRA 3ZP5A 4AZJA 2FEZA 5H6QA 1ZARA 2X3LA 3JW9A 1ECXA 3WGGA 5IWQA 3D6KA 1J7KA 3T1BA 2AXLA 2FXAA 4I09A 5TJJA 1O3SA 2QBYB 4L9TA 3OV8A 1CF7A 4OT8A 2ZMEA 2HKOA 3DR7A 4LW4A 4Q75A 4EQQA 2D2WA 4B9BA 2W24A 3EETA 3BS8A 2ELHA 1E2XA 2EZ1A 4XK1A 2AEUA 2M30A 2QUFA 2Z9WA 1MDZA 4ITGA 4MQ9F 3KFWX 4RS8A 4EFFA 1BIBA 4N0BA 5HVQC 3EYYA 3UE8A 3ISLA 4KDPA 2PMUA 2ZKZA 2XAGA 3GZ5A 1GHCA 1SZSA 3JSPA 4W1XA 4XBFA 2WC2A 4YFKF 2OZUA 4UNOA 4RB3C 2E7IA 2NMPA 2VMUA 1S07A 2PLYA 4UHMA 3MC6A 4ESBA 1R00A 3FRKA 3JW4A 3KLOA 4ZSWA 1U5TA 3K1NA 4OTLA 1CQ6A 4ZM3A 1JGSA 4UVBA 1BKGA 2WV0A 3WGBA 5G09A 3WTVC 2XASA 2HYFA 4I8AA 3TQNA 1UHWA 4CXFA 2MLGA 2XV4S 3L00A 1IX6A 2ZNYA 3L44A 1JXSA 2W84A 5AX8A 2CYYA 3IRQA 4TMRA 3P9KA 4LD5A 3F21A 1SD5A 1WWXA 3FQ7A 1D7SA 2VMOA 5FGMA 5CJ9A 4HF1A 4A0RA 4A0GA 3COGA 1FBUA 2VIBA 3FHZA 4M74A 4R5FA 3O6BB 1UU2A 1USTA 1OYIA 2ZP7A 2WK7A 3CO7C 2UZKA 1FYKA 4ZAHA 2DKBA 4XAUA 3KP3A 3Q9VA 4P3MA 1BQAA 4RGUA 4HDUA 2VN2A 1MDMB 3ECDA 3D0SA 1UCRA 1AMSA 4GXOA 2YKYA 1LVAA 4UHTA 5DEQA 2H27A 3FD0A 5HLHA 2O7CA 1LB2A 4WYGA 3F72A 1IVRA 3HSFA 4OMAA 3J80Z 9AATA 2EK5A 5J6XA 1WYTB 2BKWA 1Z05A 2VGUA 2HOYA 4ZSYA 2XUBA 4M72A 4ZZDA 2ZSLA 1M6SA 2Q2EA 3JWAA 2KKOA 4AIHA 4BHDA 2JTVA 4Q5SF 5F1RA 2P7VB 3CUQA 2FQ6A 4GE9A 1ZG5A 3MCZA 4KN7X 5CVVA 3LVMA 2IA1A 4A0HA 3EZSA 3PFIA 2R0TA 2HKXA 4JBAA 4E3QA 2PJPA 1O69A 4P7YA 4FT8A 1W23A 3O2PE 3E6DA 3T32A 5HXXA 3BV0A 1G4DA 4KUMA 3DEUA 4L9JA 3KP6A 2MH9A 3B02A 2O1BA 5LEJA 4A0ZA 4WYEA 3EDPA 4ITXA 1Y4IA 4CXQA 1B9MA 2KRFA 3IWZA 2K27A 1M7YA 2GMUA 1SZKA 4G7OF 1FG3A 3I4JA 3ZRRA 1S3JA 3BJOA 2RFVA 4BAYA 5BPIA 2L01A 1R7JA 3RQ1A 3I59A 3RBFA 1E17A 2QBTA 2F2EA 1B4AA 2ZUKA 1D3YA 1UB9A 3JSOA 3DR4A 2EV5A 3DFGA 2VGSA 4OBVA 1OHVA 2W7GA 3HOTA 2ISYA 2GXGA 4BA4A 2HWVA 3FWEA 1ELUA 2GWRA 1TQPA 1GEWA 1LW5A 1ZC9A 3MAFA 1J5YA 4S05A 4WYDA 1ASFA 3MZYA 4A72A 2ESHA 3LWSA 3R60A 2HZTA 4IYOA 4K2BA 1PG8A 2A3SA 2QQBA 3GSBA 3PQKA 5M46A 5D4RA 1IAYA 4BHPA 1AY4A 2L4MA 1I27A 3ASAA 1L0OC 4LB6B 4IHSA 1V2FA 3TKYA 3FZ7A 4R2NA 4PIWA 2OKKA 1FZPB 1QZ9A 4ZWMA 3DF8A 3K40A 3Q5FA 3KCCA 1MJAA 2WWYA 1OHYA 3WTYC 1YTYA 1DDNA 1C9CA 3FCRA 2P7CB 1ZG3A 3CQ5A 1GCKA 1O3RA 4IXSA 1W7PB 6PAXA 1C0NA 4IPAA 4MEXF 3J80K 4ZDOA 2QENA 2FNIA 1X0MA 5G4JA 2ACJA 4UV9A 3HOSA 4HX4A 1BIAA 1FSEA 3EI9A 3KP2A 3JWBA 2EJRA 3EI8A 3N4MA 1D7VA 1LKCA 1BJOB 4G6DA 2ISZA 1J04A 2W7LA 3IF2A 2XKPA 2W7JA 3REOA 2V1XA 1O62A 4WLHA 3K28A 2BWOA 2QQ9A 4ZH4F 4LK1F 3ABTA 3FF5A 1W7NA 4EMYA 4LK0F 3DPTA 3ATHA 2W8WA 3DKWA 2V1DA 3SFZA 2W7DA 5EUNA 1OYWA 5FT6A 1SZUA 3CUOA 4ZDLA 2HQRA 4AVPA 3ELPA 3WTTC 3QU3A 3MWMA 2A69F 2DPUA 1LW4A 3PPLA 2OQRA 4EM1A 2HQNA 4M6XA 2YOBA 3TOAA 1M4NA 1YO5C 4L0OA 2CWEA 3NUBA 4ENNA 1V2EA 1RVYA 3H14A 1VP4A 3RCHA 3EI7A 5AONA 3F23A 2C0RA 2UXNA 5D5SA 2CJHA 2XBNA 1HQCA 3RKXA 1EV7A 3TFTA 1ZGAA 2M8EA 3SZPA 1G3WA 2MC3A 2VMSA 4NOGA 3LFKA 1IN6A 4YIIA 3TATA 5LHIA 4L5IA 2VI8A 1SFXA 1J2XA 3I4PA 4MY5A 1W7LA 2AY3A 1KU9A 1QPMA 1R36A 2A68F 1ASNA 4L18B 2P5VA 2R5CA 2CG4A 1G3SA 5K5OA 1HBXG 1DGEA 2CY8A 3LV2A 2LF8A 4LLGF 3LAJA 4F5KA 4HX8A 4LMYA 4LNLA 3I5TA 3V8LA 4RGRA 4HLYA 3B8XA 3NU8A 4XJPA 1LQ1A 2FM1A 3I0TA 4IRHA 1I41A 1ONVA 1F1ZA 2D5YA 3NYTA 1W4MA 5JFRA 1RUNA 3U2RA 3NYSA 3HRMA 2CFXA 1TQIA 4B09A 5IT3A 3HYIA 2BEOA 5AIPA 4UHNA 4U2HA 1S0AA 3U9GA 3ELKA 4GGGA 2BE5F 4CGZA 5E1WA 4A6DA 4F5GA 1P2FA 1HKSA 2P8TA 1O61A 3GBXA 5D95A 3QM2A 3WGCA 1WYVB 2CSTA 4G7ZF 2FU4A 1FP2A 5E1ZB 3NTJA 3IHJA 2DGMA 1S09A 3TDUC 3KZYA 4ENMA 3AEMA 2W7IA 5J8QA 2GQQA 1U08A 2CJGA 4ENJA 1MJBA 3PD6A 5E17F 4BXUA 4J8LA 2H09A 4A5MA 2C44A 3FVSA 4Y13A 2FQ3A 4LLLA 1YNUA 5E5IA 3V7SA 3G3ZA 1BJ4A 2FA5A 4ZLVA 3TDZC 1U5TB 1TW3A 1R23A 5LGUA 1D7RA 1OXOA 4LNJA 3WKRA 2KJBA 3GFMA 2L02A 3C7JA 3GWPA 2GA1A 3E6GA 4WLJA 1YQAA 4W91A 3ELEA 1R5HA 5DV5A 1PMMA 1BBYA 1N2TA 1ASCA 5EIGB 3JTXA 4NHJA 2HTJA 2XKOA 4DNCA 5BJ3A 4Q6RA 3Q9SA 2O6GE 5LHAA 2DQRA 3RYPA 4CBSA 4JQFA 1J59A 5LRSA 5DB5A 3EIBA 4PGGA 1E5FA 4LW2A 2W8JA 5LHGA 3DXJF 1YAAA 4LLNA 3J81Z 4ADEA 1Z7UA 2LDUA 1LJ9A 4CDGA 3DQVC 1H9TA 3V7CA 1XCVA 1ARSA 1AMRA 4UHOA 1FX7A 2EFQA 2EFPA 3BJ6A 5JVTA 1KQ9A 3MAUA 2IVMA 2CFBA 2BI9A 4AIJA 2EB7A 4MEYF 2XH1A 1IUGA 5DCFA 1OXPA 3ZMDA 1HW2A 2YCNA 1IN5A 3HDOA 3KKIA 5BPDA 2XRNA 4G9YA 4OMZA 3BCXA 5EQCA 3QPGA 3AENA 4OU0A 3ROUA 3J81K 1Q1HA 3KETA 1GEYA 5DUKA 1GC3A 4LG0B 3HHGA 4A0FA 3RCHB 3WU1B 4O6ZA 4EVIA 1KA8A 3FVXA 3WTXC 1AWCA 1N8PA 2DTRA 2XAJA 1V2DA 3QPHA 3E77A 3N75A 3PA9A 2ZO4A 3VP6A 3C3WA 4RM1A 4H0EA 2M1BA 5LLQA 2VONA 2VE9A 5KVRA 2DK8A 1GBNA 4EB5A 4FX4A 4AH3A 3AELA 2JPBA 5DD4A 4R8HA 3L2CA 3DC1A 2KIFA 4E1OA 1K78B 5CVJA 7AATA 3P1TA 1XCBA 1KU7A 4IRGA 2Z1ZA 2ETHA 4O6JA 4GSAA 1WQ2A 5ICCA 2Z5UA 1WSUA 1ASMA 3DPLC 2HS5A 4LC3A 2VLFA 4CHUA 1BT4A 1GXPA 3EYIA 2HUFA 2K7LA 3L8AA 1E5EA 2R7DA 2GQNA 1ORDA 2JGTA 4EMSA 4OBUA 3QOPA 4UXNA 1ZRDA 2NRAC 1MDXA 1XGMA 1MLZA 4ZYEA 5HHYA 3T8TA 4KICA 3QBOA 3GX4X 4A6TA 3E2FA 3M8FA 3ERED 4OCAA 3JTGA 1AAWA 3P9CA 4G7HF 3J7AO 3F8MA 3ZPLA 2ZFWA 5FD5A 3C18A 1F4KA 3N0LA 1ZREA 3BZ6A 4PFNA 3RJPA 1D5VA 4A2UA 3K7YA 3QN6A 3GUDA 5F8VA 1IF1A 1LDJA 1T0FA 4EJVA 4MHGA 1DJUA 1TNSA 1IAXA 1P4WA 2DGKA 4A6EA 3N5MA 2EH6A 1XGNA 2CJDA 2Z33A 1B9HA 1S8NA 5TRDA 4AOAA 4BQ0A 4MQPA 4FX0A 5HS8A 2O8XA 1ZN2A 2M87A 5ILVA 2YRIA 4HQEA 1P4AA 3K1MA 2BIGA 3P6KA 3HQTA 4PZJA 5DCMB 1J9IA 1ZLKA 3A2BA 1G7XA 2JG2A 4ZDPA 3AOVA 5LEKA 4U88A 4ISYA 3E6BA 3ZMUA 1GC0A 2EFWA 3F8FA 4F5IA 4JEYA 3NNKA 2FMLA 4ON0A 3HTSB 1WYUB 3BWNA 4JE5D 3GW2A 5A2QK 4OOIA 2VOOA 2BI5A 2M45A 4HV6A 3WTWC 2C81A 1AKBA 2Z67A 2CW0F 3HBXA 4YIFA 5CYVA 2CSOA 1EH8A 5EFSA 1XD7A 5K5QA 2VGZA 4W5KA 2IRFG 3U1DA 5DUIA 4GYIA 3H7FA 3KP4A 1B9NA 4KMUX 2P6TA 1M32A 2VMPA 4A6RA 1C7NA 2BYJA 1Z6RA 2J5PA 1CL2A 2OGEA 3LY1A 3QP5A 3NRVA 3GFIA 4M9ZA 4BNCA 1J32A 1FC3A 4HAMA 4AZKA 4XJLA 4A12A 3EUCA 3VK3A 1FPQA 2YU3A 1H0MA 3IHUA 5JHUA 3B1DA 3QP6A 1G4XA 3I53A 4WXDA 5J8CA 1AHYA 4Z2YA 4AIKA 4GE4A 1XEYA 3ACZA 3HSRA 4WXHA 4DGTA 2NNNA 1PP8F 3JAMZ 1HXDA 1ZRCA 2CTZA 4BYYA 1T6SA 2Y75A 3NUIA 1ON2A 5H20A 1TBXA 2JJFA 3WG9A 1SAXA 3WY7A 2PEXA 2QWWA 2FMYA 4MKJA 4TV7A 2IT0A 2XAHA 3M5UA 1MZBA 1B5OA 2L4AA 2FBHA 2L3DA 2O61A 1T98A 3UWCA 5M4DA 2ZYJA 1OYYA 5C6UA 1ARGA 1IN4A 4BMKA 1Z1DA 4KIBA 1W7PD 4E77A 3VAXA 2BI3A 2RGVA 4JE5A 4MGRA 3FXRA 3MZHA 2R2NA 4Y0HA 3QPTA 2VMQA 3SHFA 4F5JA 2VMTA 3EIAA 1FT9A 3T8RA 4W8IA 1SMYF 2FF4A 2W7HA 3W6KB 2CO5A 1O4SA 4YFXF 3E2ZB 3OKSA 1TQMA 2OD5A 3A9XA 4HF2A 4UVAA 1R1VA 1KYZA 1DP7P 3HRTA 4Y15A 4DQ6A 1PDNC 2YKVA 1KQ0A 3PGYA 3TFUA 1V72A 3F0HA 3F8NA 3LVJA 3N97A 1IX8A 1KKJA 4RJ0A 4HF8A 5ICGA 4ETSA 4I98B 2HDCA 2OQXA 1WSTA 5AIQA 3TO7A 5A2QZ 3NX3A 3FKDA 5BOXA 2CINA 4D0PA 2AEVA 3BN1A 5LGNA 1T2KA 1RNLA 2K4BA 4JK1X 2VBYA 4PCQA 5E8IA 2VC0A 1MD0A 1GEXA 1AAMA 3ZZJA 2ZXJA 2G6WA 3MAFB 4L9NA 4UQVA 3KEQA 2EFNA 3IKTA 3TGNA 1TOGA 3PAAA 1DKAA 4EV0A 4RB0A 2Z3YA 2BIAA 3GR9A 1YFHA 1FY7A 1ASEA 2O0RA 2DFIA 1XDSA 3DODA 1LEBA 1FWZA 5M4BA 3D5LA 5HLGA 1XMKA 3DZZA 1Z7DA 1KL2A 4RGXA 2RNJA 3GF2A 2IW5A 2STTA 2VC1A 1BOAA 1T38A 2IA0A 2VBWA 1TOEA 2RVCA 4G6QA 4IRIA 5I92A 5E8GA 3KLNA 2ESNA 4N0WA 3E9KA 3HSEA 4EGZA 1M0QA 2OKJA 2VT2A 2EV6A 5FT4A 2V79A 3P9IA 5FB2A 3BPXA 5HOOA 4IVNA 2H94A 1ASBA 4F4EA 4Q47A 5D5XB 5HLIA 3NDNA 1AICA 3MADA 5FD6A 4QGRA 1GXQA 1J75A 1TOJA 1D8KA 4I7HA 4ADDA 5D6EA 1WYUA 2DKJA 4WWCA 2VIAA 2PN6A 4HBLA 1Z3ZA 3EQLF 4HA8A 5EIGA 3FX3A 2JT1A 2PQ8A 3PIUA 2IJLA 2YKXA 5DCMA 1F5TA 1UU0A 3H3ZA 1ULYA 4P9FA 4XLNF 2FYFA 2A07F 1JG8A 2JJEA 2FOKA 2FNAA 3WGIA 2D7YA 1TW2A 1W5SA 3LVKA 1FLIA 4B8XA 3ML6A 3KP7A 1CQ7A 4WBTA 1YIZA 4WXBA 5D5WB 1R58A 4W1VA 3PD6B 1R1TA 2DT5A 2W7FA 4KYWA 1UFMA 2FSWA 3BC8A 3BPVA 3FSLA 4ATPA 3WX9A 4IXOA 2CANA 1MDMA 2VBZA 2HFHA 5D5VB 2FBKA 4P5OA 2F5EA 2GA2A 4WF2A 1BM9A 2CH2A 2YX4A 1PMOA 3BCBA 2HORA 1DGDA 3AEMC 2JSCA 3CJNA 3W1HA 2PFBA 3AEOA 3F6VA 3BOQA 4MSOA 5BQTA 3ECHA 1AMAA 4FL0A 4JEZA 1IBJA 2Z9VA 3W1JA 1U6GA 3FFRA 4RAZA 3ABUA 4OIPF 3DRDA 2JJGA 4L9VA 4B98A 3HIFA 5EAVA 1YIOA 4M9SA 1MAQA 3BCAA 4S04A 1XSXA 3FMSA 4JF0A 1IUYA 3RTRA 3GZCA 3I58A 4R5ZA 1D2FA 4JF1A 1QGPA 4Q4ZF 5DJ1A 2NS0A 1P6RA 1CZEA 4Y0IA 1D8JA 4CXRA 3A9YA 4PFFA 1JHHA 1O7FA 4XSXF 4LGWA 2X5DA 2G7HA 5G0AA 2NNYA 4U0VA 3OP7A 5KK1A 2AY4A 1S7OA 4EJWA 3ULQB 4CYDA 2CH1A 3S2WA 1TARA 2XIGA 2W57A 1MDOA 3K1PA 2NYXA 3T5XA 1YOOA 4H51A 2OQGA 1IX7A 4G8XA 3AENB 3IL2A 3VOMA 4YG2F 5FFXA 3W6JB 3FVUA 4QLCU 2BBYA 3K0LA 3WTUC 1MKMA 2AY1A 1R1UA 3QGUA 2X4HA 1O7LA 3KE2A 2MLKA 2HUIA 5LH9A 2VOPA 1U8RA 2PI0A 4IXZA 3E6CC 2W7EA 5L3FA 2BI1A 1TATA 3I71A 3L7WA 3E2YA 2ZMEB 4F7ZA 4GRXA 1ZOBA 4OIRF 1DFOA 3GVAA 4ADCA 2HEOA 1LEAA 2JJHA 4P55A 3MFKA 4PDKA 3ZMZA 2QLZA 1DTYA 2OU2A 4M2JA 3V7RA 2QVOA 3EI6A 3O3KA 1CQ8A 4L5JA 1XB4A 3AATA 2X0LA 1FSHA 1FC4A 3MAJA 3CQ6A 1BJOA 3ZMVA 2VMNA 4Q31A 2IA2A 4WXCA 2YX7A 4F5HA 4R79A 3DYDA 4HLXA 2Z99A 3F6TA 2K02A 1YYVA 4RGSA 3RBLA 2PG4A 2QM3A 4EM0B 4BA5A 3F6OA 3MEXA 4IJAA 4RIZA 5D8KB 2HGCA 4M6YA 1KL1A 2K86A 1CS1A 4MQQA 2KIUA 2HP1A 2QLRA 1OATA 1AY5A 1QIRA 2VMZA 4WB0B 2RDPA 5DJ9A 4ESFA 2BGCA 3BDDA 1EH6A 5BS6A 3RI4A 5LBQA 1U5TC 2FNPA 5CVIA 1BI2A 1B59A 2HTSA 1ZODA 2VMWA 1TOKA 1HW1A 3WE2A 3B73A 2D65A 3KGWA 1KMJA 2MH2A 4XRFA 3ECOA 1SFEA 2YKUA 2OBPA 4YFNF 3K9TA 4L0YB 3VEPA 1DJEA 2D1VA 2VODA 3BB8A 3FZVA 2HR3A 4WP0A 3CUQC 2Q7WA 4ESJA 1ARHA 2E1CA 1F9NA 2ZBKA 1XGOA 3MBBA 4WYFA 5K8BA 1REPC 3TO6A 3RPQA 2IPQX 4WCGA 1H1CA 4K2MA 4HVKA 4WXFA 2F5DA 4FFCA 3TOBA 2MA3A 4FHTA 5LHHA 3WTZA 3LWFA 4GDYA 2G7UA 1AJRA 2UXXA 3R9AA 4RKCA 4J5UA 1H0CA 1IN7A 2DAOA 2DR1A 3M7GA 2F5CA 3GLXA 2VBXA 1SPAA 3HHHA 5ILSA 2WK8A 3P7NA 2LNBA 1IJIA 1LS3A 1B5PA 1QNTA 2W25A 1BQDA 1RVUA 2DBBA 2R5CB 2OA4A 2VXZA 1JHFA 2AY9A 4HV5A 1U3EM 3PDXA 3LQRA 2R3SA 1ZYRF 1HKQA 3RIRA 4IW7A 1BJWA 3LA3A 5BMZA 4HW0A 4IF4A 3WKSA 4OINF 1LC7A 2Z61A 2CQKA 1I48A 5EUDA 1M0PA 1QQIA 1I1GA 1S6LA 4WK8F 3ISPA 4KNYA 3I64A 3F22A 4MQVA 3HRSA 4A5NA 4EB7A 4ZM4A 1P92A 1XSVA 1CZCA 1HSJA 2AY2A 4DBCA 3KZZA 2X5FA 5G2QA 1YIYA 4HOBA 4MQRA 4Q48A 3IRRA 2AS5F 2AY5A 1I1SA 1FG7A 4F5MA 2IP2A 1RV4A 5DD8A 1DPRA 4Y0DA 4CICA 3FM3A 2EGYA 2LKPA 4XEWA 5F64A 3BP8A 4A0XA 1WYTA 3LVLB 5IT9K 3I54A 1B4XA 1SMTA 1CJ0A 1JS6A 4IY7A 2YPRA 3LSTA 4BQAA 1YS7A 1IRFA 1AHXA 1ZGJA 1IN8A 2A5YB 5L3CA 3NRAA 3GZ6A 5D4SA 5G4IA 2ORDA 5JAYA 1RUOA 4GEBA 4G94A 1HKTA 3C1DA 1G3YA 2P5KA 3MEBA 4EM2A 2A6HF 2DQLA 1AJSB 2EZ2A 3BJAA 3EI5A 1GC4A 1U78A 4ADBA 1W7PA 1XI9A 8AATA 3FQAA 2EO5A 5EEGA 2B0LA 5HDGA 1IW7F 3LA7A 2VT3A 1HW5A 1FNNA 1GC2A 5EAAA 3QRFF 2BV6A 1B1BA 3H3UA 1WRJA 2E7UA 2Z9OA 2YRRA 5LRRA 3GO5A 4EJUA 2YHKA 5ED4A 5DYMA 5E20A 2AY6A 2F5FA 3RUYA 1GD9A 3WU0A 3CO6C 2VMVA 3QHXA 3WODF 4L0ZB 4WB0A 2PMHA 3RKYA 1KKPA 3PDBB 5J8FA 3E2ZA 4I0BA 3ZMSA 1VEFA 4OMYA 2W7MA 3BWNC 1KU2A 4CZZA 1AHFA 4NQWA 4LFUA 1V4RA 2VLHA 3ZZKA 3GWZA 1QO0D 1MLYA 2RQPA 4A0YA 3M8EA 1BJAA 2OAZA 1WKMA 4EGYA 1YG2A 1ZH5A 5HS7A 2D7ZA 3I59B 2R5EA 4P9UA 5E3KA 2JZYA 5IT9Z 3SZTA 2Y0MA 1D7UA 4U1TA 3E5QA 1ASLA 4JEXA 1K79A 4XJMA 1BC8C 2QZ8A 4RKDA 3I16A 4HDVA 2V1UA 4WD2A 4K2EA 3W1IA 1FYMA 1UU1A 3G7QA 1FOKA 2QBYA 2EA4A 3DV8A 1AY8A 2VE8A 1O57A 2V9VA 3EZ1A 1TNTA 3WTSC 3KE3A 2LF7A 5M49A 4JEVA 1QJ5A 2ZJ2A 2J5OA 1QISA 2E7JA 1KMKA 1OMIA 4R8DA 1IZ1A 1BI3A 1STZA 1IAWA 1B9IA 3COAC 1OR7A 3HMUA 3DXWA 1TOIA 3R61A 3AOWA 2QB2A 5ICFA 5ILUA 2VYCA 1BW0A 3WZFA 2YR2A 2EFOA 3A8UX 5D5UB 2AATA 2BHXA 2Z20A 2W8VA 4Q76A 3CLOA 1LC5A 2V1PA 2RC4A 1DJ9A 3II0A 2BWPA 2ZJGA 1SFFA 3IC7A 2D61A 3F8BA 3SQNA 1PUEE 2OATA 3RKWA 2PB2A 1AOYA 1LK9A 3ZN0A 2RV8A 1ASAA 3FFHA 3R4KA 4IHTA 4ZYGA 1RV3A 3G0TA 3R0JA 1S7AA 3QAHA 3HVYA 1ARIA 1LDKB 2ZNZA 1IRGA 4RB1A 4E70A 2A6EF 2BI2A 2QQAA 3AEJC 2H6CA 1S29A 3V8KA 2XGXA 2QYOA 1LC8A 2Q8KA 2DW4A 2E7WA 2BYLA 4WYAA 3RI6A 1TLHB 2WKAA 2KIMA 2JPCA 4RB2C 3KP5A 1H9GA 2KJCA 1AMQA 4CBRA 4Y17A 2COMA 5EEHA 5ICEA 4U7BA 1X3UA 4OIQF 3M9AA 2O0YA 1EG5A 3M1EA 3CAIA 3DP7A 1PP7U 2E1NA 2DOUA 3HLMA 5FLXZ 2GSAA 2FBIA 2P4WA 5LGTA 1UKJA 3H92A 3GFLA 2HYGD 2D63A 3GZDA 1AX4A 2BYVE 5FFZA 4E3RA 2GZWA 2DI3A 4DQ2A 1NHAA 1ODDA 1PFFA 4QWQA 1FP1D 1YW9A 4AWXB 1ARTA 4GO1A 4HZFA 5FO5A 5L3BA 3BWOA 4N9HA 2GIVA 3V4GA 4MKKA 3TQXA 1GDEA 4KAMA 1RI7A 4LJZF 4ZWVA 4GCVA 3FQ8A 3NEUA 1O3TA 3QU6A 1EH7A 2Z9XA 1ELQA 5L3DA 2QMAA 3FDBA 1Y0UA 3R4TA 1G4VA 2VGVA 2XAFA 1AJSA 4HX7A 1QZYA 3I5UA 2W8UA 4TN4A 1LDDA 1XMAA 1X28A 3FM5A 2HOZA 1YJZA 1FYLA 1AIAA 3CBFA 2DPDA 1W7MA 4R1HA 1KQ8A 3E5XA 2HZPA 1SD6A 4I2OA 4WX9A 4U0WA 3RPUA 5D8LB 4F5LA 1KYWA 1K78A 2DU9A 2E7XA 3ZN1A 1SD4A 5JR3A 1CF7B 3CQ4A 3HT4A 2GB3A 5DDGA 3E6MA 2VMXA 3GJUA 1XGSA 2VGWA 3K69A 5H6RA 1MJ9A 2DK5A 1J0RA 2DGLA 1G6NA 1AHGA 5HDNA 3WE3A 1P3WA 3AAFA 3F3XA 2EV0A 2UWMA 5FLXK 1EQBA 3V8JA 3E5UA 4ZASA 2GAUA 3MC6C 4UUVA 2X8UA 3AEJA 5E1XA 5FT5A 3GXOA 3VK4A 1MAPA 2ZCWA 1C7GA 2H6BA 3GZDC 2V6CA 2ZC0A 3ZQ7A 1OHWA 3GYHX 3VODA 1M0NA 3LA2A 3A9ZA 4LB5A 2MBFA 2ADUA 1SF2A 2OGAA 1DUXC 3E97A 2QA3A 1HSTA 1BJNA 4BHBA 4KMFA 3BWGA 2K4JA 3R0AA 4RAEA 2G9WA 1QBJA 2P6SA 2P5LC 1QJ3A 3WCNA 1FBQA 4WYCA 3RDIA 3IKVA 1VTNC 4EU1A 4UVCA 1G3TA 4NB5A 1FBSA 1Z91A 3FXUA 5K1YA 5G2PA 1SD7A 4CVQA 3HL2A 4K2IA 1IXCA 3DXVA 2DO7A 4OC9A 1ON1A 1ASDA 2Z1YA 2O03A 1DPUA 4ZYDA 1WKHA 1CL1A 4AD9A 5L3GA 3CTAA 4KFCA 5HS9A 3PDBA 3ZRQA 2BIEA 2DLLA 2Q0OA 1AHEA 3WLXA 2EWNA 1XDUA 2AY7A 2BWNA 4GYGA 1N31A 4F5FA 1GVJA 1G7WA 2AY8A 2F8JA 3JZLA 1YLFA 1WYVA 4AO4A 2VGTA 2XROA 1IXRC 4EJTA 1USSA 1O3QA 3PJ0A 1TTYA 5E18F 2L54A 1U2WA 4RLGA 5F9SA 4JEWA 1BI0A 2D1HA 1TPLA 1R22A 4M73A 5CVUA 3WCOA 3FZ8A 5FT8A 1P4XA 3G8MA 3ZRPA 2MD5A 1X2AA 1I6XA 4M9XA 2GMSA 2CGPA 4M71A 3L9FA 2D66A 2VI9A 3MKJA 4UOYA 1JF9A 1S06A 1JS3A 5CVRA 1I29A 2STWA 2HP2A 5ERIA 3VOEA 4LNMA 2W85A 3EUHA 2FRHA 4XLPF 1X29A 1SFUA 3CDHA 3RYRA 3LAPA 1XSDA 4RJYA 1JE8A 3AV7A 4KXKA 2JRTA 3OOPA 3USFA 1MGTA 1K6OA 4KT5C 1ZHFA 5JI6A 3G73A 2M5WA 2XAQA 4AO9A 3HUGA 1W5TA 5CLSA 2FNUA 1ZG1A 3B1EA 1EJIA 3VFZA 1CGPA 4OYTA 4MNUA 1R5GA 1BC7C 4O5VA 2Y48A 1BN5A 3PQJA 4P96A 1BS0A 4PGHA 3JAMK 4UV8A 3IWFA 4M2MA 2HUUA 2EPJA 1YJSA 3KEOA 2EA2A 3E3VA 4XQ2A 3AEPA 3FTBA 3BROA 1UHMA 1RZ4A 3ZMTA 4EJOA 4I01A 3LG0A 2E54A 4XSZF 3CUQB 3JU7A 2YSRA 2W7KA 1YJYA 4ENKA 2HOXA 1IXSB 2FN6A 4M2KA 4HQMA 4OIOF 2A61A 3DU4A 4MTDA 2D45A 4BHCA 2C6YA 3VK2A 3WGHA 3GETA 1I43A 4ASNA 1SVVA 3R6SA 1AIBA 3FMQA 1ZAOA 2FE3A 1M0OA 4RAYA 3SXYA 3VB2A 3NYUA 2RN7A 1MGVA 1K7AA 1WI9A 2HOEA 2RKHA 1T39A 1I5ZA 1QZZA 4XJOA 5HDKA 1Z9CA 1QITA 4KYOA 4KIFA 1XN7A 2PO3A 2C7TA 2QB3A 2VMYA 4A6UA 3L09A 4GE7A 3K2ZA 5DX5A 1BI1A 1V3FA 2GXBA 1KU3A 1ASGA 1L3LA 4WXGA 1C4KA 3ASBA 5K5RA 1S08A 2WK9A 4MTEA 2W8TA 3GFJA 3NU7A 3B1CA 1RIOH 4PVFA 5BJ4A 1LNWA 3BY6A 3HTUA 5F6FA 3FZ6A 3F8CA 1QGNA 1ZRFA 1B6AA 2Z9UA 3F9TA 4KIGA 3HRUA 3FMRA 2JISA 2YCPA 3LQQA 2R7FA 3TO9A 2VMRA 5E4ZA 3MQ0A 3NQOA 1VJOA 3TCMA 4CO8A 4BH9A 4ZYHA 1YS6A 3QI6A 1Z6TA 1AKCA 4IX8A 4IYOB 4HF0A 1C7OA 2YCTA 3FXQA 2XVCA 4I02A 1W3UA 4ZZLA 4KA4A 5TF5A 3GEZA 3KGXA 4A00A 2V0YA 2NAZA 4HYEA 5HDMA 2ZSMA 2PBIA 4N9IA
chains in the Genus database with same CATH superfamily
4HNVA 4ATQA 5L3EA 1OPCA 5J3LA 1KGSA 2XB5A 2V9KA 5EUEA 4U0YA 1B8GA 4LG0A 5D6FA 2O3FA 5IPAA 2CB1A 1ZLJA 3FHNA 3UAKA 2WTEA 1TASA 3CJQB 2XHKA 2LSOA 3H9GA 4RITA 5F27A 1YW8A 1UMQA 2PB0A 3B46A 2EZIA 4U7DA 1C0WA 3JTHA 2TPLA 4YIRX 1T3IA 3T0YA 3L2WA 4I0AA 2OZ6A 3H9QA 1R5ID 2COBA 1YW7A 3BTJA 4UB6C 4O3MA 1WKGA 1A04A 3L2QA 4BE1A 2D64A 4KN4X 4W1WA 5HNFA 2TDXA 1AKAA 3QYFA 1LFPA 4IXAA 3F9KA 3Q8NA 1OKRA 2WB1N 3OYMA 3ZP5A 3BTIA 2LOOA 5FKMA 2HZDA 1ZQ3P 1IUFA 4AZJA 2XSJC 2K5CA 2DA5A 2FEZA 5H6QA 1ZARA 2X3LA 3JW9A 1ECXA 3OYCA 3Q0WA 3WGGA 5IWQA 3D6KA 1J7KA 3T1BA 4XRMA 2AXLA 2FXAA 2X1EA 4I09A 2WBMA 5TJJA 1O3SA 2QBYB 4L9TA 3OYAA 3OV8A 2KP6A 1CF7A 3A1YA 2ZMEA 2CV0A 2HKOA 3DR7A 4LW4A 4OT8A 4EQQA 4Q75A 2D2WA 4UY8I 2W24A 3EETA 3BS8A 4B9BA 2ELHA 1E2XA 2KISA 4E7LA 4E6KG 2EZ1A 2BY1A 4XK1A 3H9JA 2GOXB 1MNMC 3NWTA 2AEUA 3DTIA 3G71I 1S7EA 2M30A 2QUFA 2Z9WA 1MDZA 4ITGA 4MQ9F 3KFWX 4RS8A 4HNUA 3S3NA 1VQNI 4EFFA 1BIBA 1YJWI 4N0BA 1HLVA 5F08A 5HVQC 3PIOF 3QPSA 3EYYA 2M4KA 3UE8A 3ISLA 3S93A 2PMUA 3CP8A 2ZKZA 4KDPA 3HG9A 2XAGA 3GZ5A 1GHCA 1SZSA 3JSPA 4W1XA 2HDWA 2JSPA 2HVQA 4XBFA 2WC2A 4YFKF 2OZUA 2WAQN 5EEAA 4RB3C 3M8JA 4UNOA 2E7IA 2NMPA 1S07A 2PLYA 2VMUA 3OMYA 1W0UA 3GTPJ 2FX0A 4ESBA 3MC6A 4UHMA 1R00A 3HC7A 3FRKA 1WJCA 3JW4A 1OJLA 3KLOA 4BEHA 4ZSWA 4FQGA 3VWBA 1U5TA 1N75A 3IUOA 1VQ5I 3K1NA 4OTLA 1CQ6A 4ZM3A 2EZLA 2DMPA 3PAAA 1JGSA 4UVBA 1BKGA 2WV0A 1IV8A 3WGBA 2R92J 1SEUA 5G09A 3WTVC 2M2EA 2XASA 3M3YJ 2CUJA 2HYFA 4I8AA 4GDFA 3TQNA 1UHWA 4CXFA 2MLGA 2XV4S 2OTJI 3L00A 1IX6A 2ZNYA 3L44A 1JXSA 2IEKA 2W84A 3AG3H 1QPIA 3U21A 5AX8A 2CYYA 3FXOA 1TZLA 3OR1C 3IRQA 1X1AA 4C2TA 4TMRA 2XDVA 3P9KA 4LD5A 3CCLI 4IHVA 3F21A 4BDZA 1SD5A 1W36C 1SVMA 1WWXA 4BY7J 1D7SA 3FQ7A 2VMOA 5FGMA 5CJ9A 4ABZA 3OYKA 1V5FA 4HF1A 2LC2A 4A0RA 4A0GA 3HOYJ 3COGA 3H5AA 5B5EC 1FBUA 2VIBA 4J01A 1GVDA 3FHZA 4M74A 4R5FA 3O6BB 1UU2A 2DMUA 3MZ8A 1USTA 3J7YJ 1OYIA 2ZP7A 2WK7A 2BHYA 2QSFX 3CO7C 4XORA 2UZKA 1FYKA 2GIZA 3A03A 4KISA 2DKBA 4ZAHA 4XAUA 1JKOC 1SANA 3KP3A 3Q9VA 3CMAI 4M3DA 3GTJJ 4P3MA 1BQAA 4RGUA 2KDZA 2VN2A 4HDUA 1MDMB 1Z3YA 3BR5A 3ECDA 1VF9A 2V7FA 3D0SA 1UCRA 1TP4A 1AMSA 4GXOA 1P7JA 2IS6A 2YKYA 1LVAA 4UHTA 3ABKH 5DEQA 2H27A 5HLHA 4UUSB 1LB2A 1N78A 1ITYA 2O7CA 3F72A 1IVRA 3HSFA 3D1NI 2AO9A 2VI6A 4M3EA 4OWRB 3J80Z 1MSFC 3HOUJ 4OMAA 2EK5A 5J6XA 4C2UA 2BVMA 1Z05A 2L9VA 1WYTB 2BKWA 1S5LC 5C4JJ 2VGUA 2HOYA 2R7TA 4ZSYA 2XUBA 4YELA 4M72A 4ZZDA 2EPFA 2ZSLA 2R7SA 1M6SA 3K70C 2Q2EA 1D1CA 4BBRJ 3JWAA 2AXTC 3A02A 3BT9A 2KKOA 4AIHA 4BHDA 5TGTA 2JTVA 4BEHB 4Q5SF 5F1RA 2OF7A 3KYDB 2P7VB 3PNTA 3VYTB 3CUQA 4V2GA 2FQ6A 4GE9A 4ZC3A 1ZG5A 3MCZA 3QYBA 4KN7X 5CVVA 3LVMA 2IA1A 4A0HA 3ZQCA 3EZSA 3PFIA 3GTGJ 2R0TA 2HKXA 4JBAA 4E3QA 2L7ZA 4XIDA 2CUZA 3CMEI 2PJPA 1O69A 3G4SI 4P7YA 4FT8A 5FLVA 1W23A 3O2PE 3E6DA 3AFHA 3T32A 2ICWG 2BW3A 5HXXA 2LD5A 1AHDP 3BV0A 2HNHA 3CCQI 1G4DA 4KUMA 3DEUA 4L9JA 3AG1H 4HPQA 1DP3A 3KP6A 2MH9A 3B02A 3EUKL 1R49A 5LEJA 4A0ZA 2QQ8A 3EDPA 2O1BA 4ITXA 4A3CJ 4WYEA 1Y4IA 1JTXA 1JJ6C 4CXQA 4FTHA 1B9MA 4C30A 2KRFA 5K7FA 3IWZA 3SEZA 1HDDC 2Q2EB 2G0EA 1MMSA 2K27A 1M7YA 2GMUA 1SZKA 4G7OF 1FG3A 3I4JA 3BR6A 2I8DA 2CQXA 3ZRRA 5LD2C 4A93J 1S3JA 2CV1A 2E5ZA 3SDBA 3V42A 3BJOA 2RFVA 1Y56A 5IYBJ 4BAYA 5BPIA 2L01A 1R7JA 3RQ1A 3I59A 5M3FJ 1QZEA 1NH3A 3RBFA 2L7KA 1E17A 2QBTA 2EILH 2F4IA 2F2EA 1B4AA 4BQQA 2K9LA 4AYBN 2ZUKA 1D3YA 1UB9A 3JSOA 1BJZA 2EV5A 3LSHA 2W7NA 3DR4A 3DFGA 4PFOA 2VGSA 4OBVA 4A3GJ 2RQQA 3K7AJ 2L9NA 1OHVA 2W7GA 2CU7A 3HOTA 4NDLA 2ISYA 2GXGA 2NVTJ 1E3HA 2HWVA 4BA4A 3FWEA 1ELUA 2GWRA 1TQPA 1GEWA 1LW5A 3OYEA 3S2HJ 1J5YA 2XGEA 4S05A 1ZC9A 3MAFA 1LE8A 3JRHA 1P7IA 1VNDA 4WYDA 1ASFA 2DMTA 3MZYA 1DU0A 4A72A 2ESHA 3LWSA 3R60A 2HZTA 4IYOA 1X1DA 4K2BA 2KMUA 5IP7J 2JA7J 2A3SA 1PG8A 2QQBA 4A3DJ 3GSBA 2QCOA 3PFYA 3PQKA 5M46A 2JJ7A 1LPQA 5D4RA 1IAYA 1AKHA 4BHPA 1VZ0A 2UUZA 1AY4A 2ELKA 1B72B 2L4MA 1PUFA 1I27A 3ASAA 1L0OC 4LB6B 3UNGC 4QIWN 1QA6A 4IHSA 3TKYA 1V2FA 3FZ7A 4PIWA 4R2NA 3JREA 2OKKA 3DTEA 3KEYA 1FZPB 1QZ9A 2ELJA 4ZWMA 3DF8A 3I3LA 3Q5FA 1G59A 3KCCA 3K40A 1MJAA 2E36A 3I9V2 5E3NA 2WWYA 1OHYA 3WTYC 5GPCA 1YTYA 1Z0XA 1DDNA 1C9CA 3FCRA 2P7CB 1ZG3A 1LE8B 3CQ5A 3JRIA 1O3RA 1GCKA 4IXSA 1W7PB 6PAXA 1C0NA 4IPAA 4MEXF 3J80K 4ZDOA 2QENA 2FNIA 1VFCA 3I55I 1X0MA 5G4JA 2ACJA 4UV9A 3HOSA 4HX4A 1BIAA 4XLCA 1Y0NA 3LMMA 1FSEA 4F93B 2DXIA 5M5YJ 2R5YA 3EI9A 3KP2A 4FETA 3S32A 3JWBA 2EJRA 2DFEA 3EI8A 2A5WA 2P0WA 3N4MA 1NK2P 1D7VA 1LKCA 1BJOB 4G6DA 3BG5A 1P9QC 2ISZA 1J04A 1R4NB 2MGQA 2HXIA 4XLFA 1X3WB 2W7LA 4H4KC 3IF2A 4BJ6C 2O8KA 3LSMA 3RQ4A 4M3GA 2XKPA 2E1MB 2Y0SN 3BQZA 3MN2A 2W7JA 3REOA 2V1XA 1O62A 4WLHA 1ZGWA 1YITI 2DFFA 4NC8A 3K28A 2ZXWH 3DCFA 4AVZA 2BWOA 2QQ9A 4LK1F 4ZH4F 3ABTA 2LH9A 3FF5A 5M5XJ 4LK0F 4CYCB 1W7NA 4EMYA 3DPTA 3GBGA 3UR3C 3ATHA 5EGOA 2M3AA 2W8WA 3DKWA 2V1DA 2DTZA 3SFZA 4DZPA 2W7DA 5EUNA 1OYWA 5FT6A 1SZUA 3CUOA 4C3IJ 3QWLA 4ZDLA 1QVTA 5EF6A 2HQRA 4AVPA 3ELPA 3WTTC 3QU3A 4PSXA 1H88C 4PJMA 3MWMA 3LNQA 2A69F 2DPUA 1LW4A 3PPLA 2OQRA 4EM1A 2HQNA 2ZJRF 2VJJA 4M6XA 1WFXA 1GT0C 2HOAA 4B3XA 2CW8A 2YOBA 3TOAA 1M4NA 1YO5C 4L0OA 2CWEA 2LFBA 3A4CA 3NUBA 4ENNA 1V2EA 3KYLA 5TISC 1RVYA 3H14A 3IH3A 4D1QA 2HVRA 1VP4A 1VQ9I 1DGWY 3RCHA 3EI7A 5AONA 3F23A 1K61A 2C0RA 2UXNA 2OUMA 3FDYA 2GLOA 3CP2A 2CJHA 2XBNA 2E5NA 5D5SA 1HQCA 3RKXA 3VYSB 1EV7A 2WB1A 3TFTA 1ZGAA 2M8EA 3SZPA 1G3WA 2MC3A 2VMSA 4NOGA 3LFKA 1IN6A 4U87A 4YIIA 3O8GA 3TATA 5LHIA 4L5IA 2VI8A 1QHGA 1SFXA 1FOWA 3Q0VA 1J2XA 4C3JJ 3I4PA 3HPHA 4A3KJ 3S14J 1W7LA 2AY3A 4MY5A 1KU9A 4AC0A 1QPMA 2ZSIB 1R36A 2A68F 2OCCH 2P5VA 4G12A 3RQIA 4L18B 1ASNA 2R5CA 2CG4A 1G3SA 4IQ4A 4XONA 5K5OA 1HBXG 1DGEA 2CY8A 3LV2A 2NS7A 2LF8A 4LLGF 4XOTA 1ERDA 3LAJA 3GTLJ 4F5KA 4NNJA 4HX8A 4LMYA 2DA2A 4LNLA 1YRNA 3I5TA 4KJZA 2QSHX 3V8LA 4RGRA 4HLYA 3B8XA 3NU8A 4XJPA 1LQ1A 3VYUB 2FM1A 3I0TA 4IRHA 1I41A 1ONVA 1JUSA 1F1ZA 2D5YA 3NYTA 1W4MA 1VQKI 4QPOA 5JFRA 1RRJA 4XQFA 9AATA 3PSFA 1RUNA 3U2RA 4JOMA 4J19A 5FJ8J 3NYSA 3HRMA 2CFXA 1TQIA 4B09A 4CCOA 5IT3A 3E7LA 2IGNA 3HYIA 2BEOA 5AIPA 5FKKA 1EF4A 1XTAA 4UHNA 4U2HA 1S0AA 3U9GA 3ELKA 4GGGA 1LUJB 2BE5F 1MBJA 4CGZA 5E1WA 3W2VA 4A6DA 4F5GA 1P2FA 1HKSA 2CJJA 3AG2H 2P8TA 1O61A 3GBXA 2F5VA 5D95A 3QM2A 3FBIB 3EUAA 3WGCA 1WYVB 4CCMA 4G7ZF 2CSTA 2FU4A 1FP2A 5E1ZB 3NTJA 3IHJA 4NC6A 2JA8J 3I4NJ 2DGMA 1S09A 3TDUC 3KZYA 4ENMA 3AEMA 2W7IA 3G2BA 5J8QA 2GQQA 1U08A 3OY9A 2L7FP 2L7MP 2CJGA 4ENJA 1MJBA 3PD6A 5E17F 4BXUA 4J8LA 2WAFA 1JT0A 2H09A 4A5MA 1YX5A 2C44A 3FVSA 4Y13A 4A3LJ 3OYLA 2FQ3A 4LLLA 5FLMJ 1YNUA 5E5IA 2Y31A 3V7SA 3G3ZA 2JUGA 2EIMH 3H0GJ 1BJ4A 4RAFA 2EIKH 2FA5A 4ZLVA 3TDZC 2XPWA 1U5TB 1TW3A 1R23A 5LGUA 1D7RA 1OXOA 2E1MC 4LNJA 3WKRA 2KJBA 3S1QJ 2EIJH 3K4LA 3GFMA 3NAUA 2L02A 4IHYA 3C7JA 3GWPA 2GA1A 3E6GA 4WLJA 1YQAA 3CCEI 4W91A 3ELEA 1R5HA 1WJBA 3A0BC 5DV5A 4E7KA 1BBYA 3OSFA 1N2TA 1PMMA 1ASCA 5EIGB 3ZRGA 4X1EA 3JTXA 4NHJA 1Y8RB 3HOWJ 2HTJA 2XKOA 4DNCA 5BJ3A 3VSLA 4Q6RA 1J09A 3Q9SA 2O6GE 5LHAA 2DQRA 2R7XA 3RYPA 5E3OA 3CMMA 4CBSA 4JQFA 1ETWA 3OL3A 4PJNA 1J59A 4V19K 1JTYA 5LRSA 5DB5A 3EIBA 3S15J 2DYRH 2VQLA 1S9HA 4PGGA 1E5FA 4LW2A 2W8JA 4DW6A 5LHGA 2CQQA 3DXJF 1DU6A 1YAAA 2FUG2 5B1BH 3J81Z 4LLNA 2DA6A 2KDOA 4ADEA 1Z7UA 2LDUA 1LJ9A 4CDGA 3DQVC 4Y3OA 1H9TA 2ME0A 3J7ZI 3V7CA 1XCVA 1ARSA 1AMRA 1TWAJ 4UHOA 1FX7A 2EFQA 2EFPA 3BJ6A 5JVTA 1KQ9A 3MAUA 4BQNA 1K83J 2IVMA 2CFBA 2BI9A 4AIJA 2EB7A 2JN6A 2N8GA 3MKWB 3FKIJ 4MEYF 2XH1A 1IUGA 5DCFA 2ZXIA 3ZMDA 1HW2A 1OXPA 1IN5A 4RAGA 1VQ6I 2YCNA 3KIOA 3HDOA 3KKIA 3CF2A 2X6YA 4PSWA 2DMNA 1NK3P 5BPDA 2LKXA 2XRNA 4ANJA 4G9YA 4OMZA 1BW5A 3BCXA 5EQCA 3QPGA 3B6AA 3AENA 4OU0A 3TW6A 3ROUA 3J81K 1Q1HA 3KETA 1GEYA 2DA4A 5DUKA 1GC3A 1VQ7I 3G6EI 3LSJA 3HHGA 4LG0B 3RCHB 1K6YA 4A0FA 1WCMJ 3FXMA 3WU1B 3FK6A 4O6ZA 4EVIA 1KA8A 3FVXA 3WTXC 3HEFA 1AWCA 1N8PA 2DTRA 2XAJA 4XM3A 1V2DA 3QPHA 3I4MJ 3E77A 1IDYA 3N75A 3PA9A 2ZO4A 3VP6A 2LY2A 3BZCA 3C3WA 2IS2A 4RM1A 2KQRA 2M1BA 4H0EA 5LLQA 2VONA 3K2AA 2VE9A 1XPXA 5KVRA 2DK8A 4Y7NJ 3ZQLA 5GAEJ 2OTLI 1GBNA 1ETOA 4EB5A 4FX4A 4AH3A 4JX4A 5M5WJ 2JPBA 3GZNB 3FXLA 3AELA 1ZELA 1D0XA 5DD4A 4R8HA 2H1LA 1O4XA 3L2CA 1OCOH 2ECCA 1RPWA 2KIFA 3BR3A 3H5NA 3DC1A 4E1OA 1K78B 5CVJA 1FOXA 3P1TA 7AATA 2MYSA 1XCBA 1KU7A 1W0TA 4IRGA 4V2FA 4E7IA 2Z1ZA 2ETHA 4O6JA 4GSAA 1WQ2A 5ICCA 2CUEA 4IHXA 1POGA 2Z5UA 3JRFA 1WSUA 1ASMA 3DPLC 2HS5A 5F0CA 4LC3A 5HLTA 2VLFA 1FJLA 4CHUA 1BT4A 1GXPA 3EYIA 2HUFA 2K7LA 2BZTA 3W2AA 3L8AA 3DBRB 4JP0A 3ZQIA 1E5EA 3K4MA 2R7DA 1HF0A 2GQNA 1ORDA 2JGTA 4EMSA 4OBUA 3ABMH 3QOPA 4HSTA 4UXNA 1ZRDA 2NRAC 1MDXA 1XGMA 2EZHA 3LSGA 1MLZA 4ZYEA 2M4GA 1VQPI 5HHYA 2KHMA 3T8TA 4KICA 3QBOA 3GX4X 1X2MA 1W1WE 5KNLA 3E2FA 3M8FA 4A6TA 4EEFG 3ERED 4OCAA 3JTGA 1AAWA 2X51A 3P9CA 4X6AJ 4G7HF 3J7AO 4F91B 3AG4H 3F8MA 2DCEA 2ZFWA 4IO9F 3ZPLA 5FD5A 2IGKA 3C18A 1F4KA 3N0LA 1ZREA 3BZ6A 1X58A 3RJPA 4PFNA 3JRAA 1X3ZB 1UZCA 4BACA 4J00A 3HOXJ 2DYSH 1D5VA 2HXOA 4A2UA 1PVEA 3K7YA 3QN6A 2F4OB 3WU2C 3GUDA 5F8VA 1IF1A 1LDJA 1T0FA 4EJVA 4ZYAA 4MHGA 1DJUA 1TNSA 1IAXA 1P4WA 2DGKA 5DM7F 4A6EA 3N5MA 2EH6A 1ETXA 1XGNA 1W36D 1UG0A 3H1CA 2CJDA 2Z33A 1B9HA 2XF5A 1S8NA 5TRDA 4AOAA 4BQ0A 4MQPA 4FX0A 5E3LA 5HS8A 2O8XA 1ZN2A 2VL8A 1IO2A 1MBHA 2M87A 5ILVA 2YRIA 4HQEA 3BZKA 1P4AA 3K1MA 2BIGA 1UHSA 2KZGA 3P6KA 2X1CA 3HQTA 4PZJA 5DCMB 1J9IA 1ZLKA 3A2BA 4ZDPA 1G7XA 2JG2A 2LVSA 2OV7A 3AOVA 5LEKA 3HZJA 4BXXJ 4D7MA 1ETYA 2KIQA 4U88A 4ISYA 1HA8A 3E6BA 3ZMUA 2IS1A 3CCRI 1GC0A 1N77A 2EFWA 3K4KA 3F8FA 3OOUA 1JKQC 4F5IA 4JEYA 4CUGA 4HNTA 3NNKA 2FMLA 3CJRB 4ON0A 4DBRA 3HTSB 3S17J 1WYUB 3BWNA 4JE5D 3GW2A 5A2QK 1FMVA 3G1MA 2PMZA 2E1OA 4OOIA 3ZQQA 2VOOA 2BI5A 5F0FA 2M45A 3I56I 4HV6A 3WTWC 2HPMA 2C81A 1U9OA 1V55H 5FKLA 2CQ7A 4BGDA 1AKBA 2Z67A 2CW0F 3HBXA 1JT6A 1TWGJ 4YIFA 5CYVA 2CSOA 1D5YA 1EH8A 5EFSA 3HBLA 1XD7A 5K5QA 2VGZA 3HUGB 4W5KA 2IRFG 3U1DA 2R7UA 5DUIA 4GYIA 4EATA 1XS9A 3KP4A 3H7FA 1B9NA 4KMUX 2P6TA 1M32A 2VMPA 4A6RA 1C7NA 2BYJA 1Z6RA 2J5PA 4PK4A 4MFDA 1CL2A 2OGEA 3LY1A 5B3SH 3QP5A 3NRVA 3ERMA 3GFIA 4ZTFA 3HGGA 2W1OA 4M9ZA 4PUSA 4BNCA 1J32A 1FC3A 4HAMA 5J47A 4AZKA 1LFBA 4XJLA 4A12A 3EUCA 3VK3A 1FPQA 2WADA 4FCYA 2YU3A 1H0MA 3IHUA 5JHUA 4IL6C 3B1DA 3QP6A 1GUUA 2BW3B 3CC4I 3ZCOA 1G4XA 1U9NA 2Y9YA 3I53A 2H8WA 3PNVA 4WXDA 5J8CA 1QU3A 1AHYA 3TL4X 4XICA 4Z2YA 4AIKA 1NG7A 3MMYB 4IX7A 2D5VA 4L5EA 1TT0A 1XEYA 3ACZA 4GE4A 3S8PA 3ZOBA 3HSRA 4WXHA 4DGTA 2NNNA 3PUBA 1PP8F 3JAMZ 1HXDA 3F0CA 1ZRCA 2I5UA 2CTZA 4PFPA 4BYYA 1T6SA 2Y75A 3NUIA 1ON2A 1Z7LA 4II3A 5H20A 1TBXA 2JJFA 1MNEA 3WG9A 1SAXA 3WY7A 2PEXA 2QWWA 2FMYA 3OIOA 4MKJA 5EGOB 2QEXI 4TV7A 2IT0A 2NVUB 2XAHA 4CYCA 3BTLA 3H36A 3M5UA 9ANTA 1MZBA 3JCUC 1B5OA 1X1CA 2L4AA 2KPMA 2FBHA 2L3DA 5DM6F 2O61A 2XRLA 1T98A 3UWCA 5M4DA 2DJIA 2ZYJA 3S1RJ 1OYYA 5C6UA 1ARGA 1IN4A 4BMKA 1Z1DA 4KIBA 1W7PD 2R5ZA 4E77A 3VAXA 4FE4A 4XKBA 2BI3A 2RGVA 4JE5A 1IC8A 4MGRA 3ZQHA 3FXRA 3MZHA 2R2NA 4Y0HA 3QPTA 2FD5A 3QPLA 3GTQJ 3S2DJ 2VMQA 3SHFA 4C9YA 4F5JA 2VMTA 3EIAA 1FT9A 5J1UA 4ITVA 3T8RA 4YRVA 4W8IA 5CQGA 1B8IA 2BOLA 1SMYF 2FF4A 2W7HA 3W6KB 2CO5A 2HQAA 5F1JA 1O4SA 4YFXF 3E2ZB 4GFBA 2HYJA 3OKSA 1TQMA 2OD5A 3A9XA 4HF2A 4UVAA 1R1VA 1KYZA 3PIPF 1DP7P 1ACIA 3HRTA 3CESA 4Y15A 4DQ6A 1X1BA 1JJ8C 1PDNC 3FD0A 2YKVA 1KQ0A 3PGYA 3TFUA 3S1NJ 1V72A 3F0HA 4IEJA 3F8NA 3LVJA 4IOAF 1DQUA 3N97A 1IX8A 2CH0A 1KKJA 4RJ0A 4HF8A 5ICGA 4ETSA 4I98B 2HDCA 3W3CA 2OQXA 1WSTA 5AIQA 3TO7A 5A2QZ 1VI0A 3NX3A 1OLTA 3FKDA 5EYRA 1QVUA 5BOXA 4D0PA 2CINA 2XB0X 3RZDJ 2AEVA 3BN1A 5LGNA 1T2KA 1RNLA 2K4BA 4JK1X 2VBYA 3P5JA 2ZMEC 4PCQA 5E8IA 2VC0A 1MD0A 1GEXA 5DS9A 1AAMA 4BUPA 3ZZJA 2ZXJA 2G6WA 3MAFB 5FROA 3WG7H 4L9NA 4UQVA 3KEQA 2EFNA 5KHDA 3TGNA 2ZXHA 4XRSG 3IKTA 3VSKA 4EV0A 1DKAA 4RB0A 2Z3YA 3IP4B 2BIAA 3IV5A 3ZXSA 2NOJB 1FY7A 1YFHA 1ASEA 3GR9A 2O0RA 2A6TA 2DFIA 1XDSA 3DODA 4LIVA 1LEBA 1FWZA 5EZHA 5M4BA 3D5LA 4M3BA 5HLGA 2K9QA 1XMKA 1T08B 3DZZA 3LSRA 1Z7DA 1KL2A 4RGXA 2RNJA 1JGGA 1M1EB 2NS8A 3GF2A 2IW5A 2GXAA 2STTA 2VC1A 1BOAA 1T38A 2IA0A 3DBLB 2VBWA 2P81A 3QOEA 1TOEA 4D5CA 2RVCA 4G6QA 4XLAA 4IRIA 5I92A 5E8GA 3KLNA 2ESNA 5EG0B 4N0WA 1OCCH 1ENHA 3E9KA 3CCYA 1D1BA 3PNYA 3W6VA 3HSEA 4EGZA 1M0QA 2OKJA 2VT2A 2EV6A 2ZB9A 1I6HJ 3PUFA 5FT4A 2JUCA 2V79A 3P9IA 5FB2A 3BPXA 4CSWA 5HOOA 3S3MA 3N05A 4IVNA 1G2HA 2H94A 1ASBA 4F4EA 4Q47A 5D5XB 1IDZA 2MABA 3TEDA 5HLIA 3NDNA 5FRNA 1AICA 3MADA 5FD6A 2B63J 2NVYJ 4QGRA 1GXQA 1SVLA 4BJ5C 5JLWA 1J75A 5FKOA 2DOAA 1TOJA 1D8KA 2R93J 4I7HA 1R9TJ 3A01A 1CQTA 3PM1A 4ADDA 1MSEC 5D6EA 1UJ8A 1WYUA 4P1WA 4XL9A 3DU6A 2DKJA 4WWCA 2VIAA 2PN6A 4HBLA 1Z3ZA 3EQLF 4HA8A 4XLEA 5EIGA 3FX3A 3HB9A 2JT1A 2PQ8A 3PIUA 2BY3A 2IJLA 4RBOA 1WGXA 3OYHA 2YKXA 2MC4A 5DCMA 4QTRA 5FKNA 1F5TA 1UU0A 2VXDA 3H3ZA 1VQ4I 1ULYA 4P9FA 4XLNF 4E7ZA 4W97A 2FYFA 2A07F 1JG8A 3CLQA 2JJEA 2E35A 2FOKA 2FNAA 3WGIA 2D7YA 1MBGA 1TW2A 1W5SA 3LVKA 1FLIA 1OCZH 5FRMA 3ML6A 3KP7A 4B8XA 1CQ7A 1OFCX 4WBTA 1YIZA 4WXBA 5D5WB 1R58A 4W1VA 3PD6B 1R1TA 2DT5A 2W7FA 3BLYA 4KYWA 1UFMA 2FSWA 3BC8A 3BPVA 2WA0A 3FSLA 3WX9A 4ATPA 2LG4A 2VQGA 4IXOA 2CANA 1MDMA 2VBZA 3DEWA 3A2KA 2HFHA 5D5VB 2FBKA 2W48A 4P5OA 3HKZN 1XG1A 4XKWA 2VPRA 2F5EA 2GA2A 3IH2A 4WF2A 1BM9A 2K3PA 2Q1ZB 2YX4A 3BCBA 5EJCA 1PMOA 2CH2A 1DGDA 1R6RA 2HORA 4QPQA 1A36A 4RMNA 3TW7A 2JSCA 3CJNA 3LL7A 3AEMC 3W1HA 2M0MA 2PFBA 1RR8C 3AEOA 2OCEA 3F6VA 3BOQA 3BR0A 4MSOA 3GCMA 2GBYA 2LMDA 3ECHA 4Y4RA 5BQTA 1AMAA 4FL0A 4JEZA 1IBJA 2Z9VA 3W1JA 3NWSA 1D0YA 4IZZA 3B6CA 1FIAA 2HOSA 3AL0B 1U6GA 3L2VA 1TC3C 1TT5B 3FFRA 4RAZA 3ABUA 4OIPF 3DRDA 2JJGA 2AHQA 4L9VA 2W00A 4B98A 3HIFA 3TP0A 4E7HA 5EAVA 2QKLB 1YIOA 4FE7A 3CF5F 1ETQA 4M9SA 3BCAA 1MAQA 4S04A 4I99C 3GLLA 1XSXA 3FMSA 4JF0A 2K3FA 1IUYA 3EPZA 3RTRA 3K6GA 3GZCA 3I58A 4R5ZA 1D2FA 2W82A 4JF1A 3IAS2 1QGPA 2R4GA 4Q4ZF 5DJ1A 2NS0A 1P6RA 1CZEA 4Y0IA 2NVQJ 1D8JA 2IXSA 4CXRA 3O8HA 3A9YA 4PFFA 1JHHA 1O7FA 4XSXF 2RREA 4LGWA 3ZQFA 2G7HA 2X5DA 5G0AA 1ETVA 2NNYA 4BS9A 4U0VA 2ZJQF 3OP7A 5KK1A 2PJRA 2AY4A 1S7OA 5J40A 1Y1WJ 4EJWA 3ULQB 4II2A 2VLAA 4CYDA 2CH1A 1MBEA 3S2WA 2R7OA 2XIGA 2W57A 1MDOA 3K1PA 2NYXA 2VQCA 3T5XA 1TARA 1RR7A 4A3IJ 1YOOA 4H51A 2OQGA 3DBHB 3OYDA 1IX7A 4G8XA 1HC8A 3AENB 3IL2A 1A5JA 4N4OB 3VOMA 2L9RA 4YG2F 5FFXA 4CCJA 3W6JB 3FVUA 4QLCU 2BBYA 3K0LA 3WTUC 1MKMA 3CCSI 2AY1A 1Z3XA 1R1UA 3M07A 3QGUA 2X4HA 2JA2A 3A01B 1O7LA 3KE2A 1V5GA 2MLKA 4M6VA 4DJAA 3OYBA 2HUIA 5LH9A 3W2WA 2K40A 2VOPA 2GOMA 1U8RA 2PI0A 4IXZA 5B66C 3E6CC 3GTMJ 2W7EA 5L3FA 2PMZN 2BI1A 1TATA 1WPKA 3I71A 3L7WA 2ZMEB 3OS2A 2JQ7A 4F7ZA 3E2YA 4GRXA 1ZOBA 4OIRF 1DFOA 4KITB 3GVAA 4ADCA 2HEOA 1EKEA 1LEAA 2R7VA 4JX6A 2JJHA 4P55A 2RNGA 3MFKA 1DGRM 3HM5A 4PDKA 3ZMZA 2QLZA 2JA5J 1DTYA 4QSHA 2OU2A 4M2JA 3V7RA 2QVOA 3EI6A 3O3KA 4C3HJ 1UELB 1CQ8A 4L5JA 5IOZA 2KL4A 3IH4A 2XSDC 1XB4A 2F48A 1A6QA 1BL0A 4BL0B 3AATA 2X0LA 1FSHA 1FC4A 3MAJA 3CQ6A 1BJOA 3ZMVA 2VMNA 1ZKGA 4Q31A 2IA2A 4WXCA 2YX7A 2V9PA 4R79A 4F5HA 1BW6A 3DYDA 4HLXA 2Z99A 3F6TA 2K02A 2K9MA 1YYVA 3K4NA 4RGSA 2V6EA 5H2FC 3RBLA 2PG4A 3FK7A 2QM3A 4EM0B 4BA5A 3F6OA 4NQWB 4WYGA 3JRGA 3MEXA 5GTHC 1W5CC 4IJAA 4DOZA 4M3FA 4RIZA 5D8KB 2HGCA 4M6YA 1KL1A 1WH7A 2K86A 3HDDA 1CS1A 2LRDA 4MQQA 2KIUA 2HP1A 2QLRA 1OATA 1AY5A 1FEXA 1QIRA 2VMZA 2RDPA 4WB0B 4ESFA 5DJ9A 2BGCA 2CUFA 2VKHA 3BDDA 1EH6A 5BS6A 4XN0A 3RI4A 5LBQA 2DDAA 1U5TC 2FNPA 3OIPA 5CVIA 1B59A 1BI2A 2HTSA 1ZODA 2VMWA 1TOKA 1HW1A 2DMQA 3B73A 2IBDA 3WE2A 1A31A 2D65A 3KGWA 2HPIA 1KMJA 2MH2A 4XRFA 3ECOA 1QHHD 1SFEA 4B43A 5IP6A 2OBPA 2HDDA 2YKUA 4YFNF 3K9TA 1PYVA 5KAFC 2R7QA 4L0YB 3VEPA 1DJEA 2D1VA 2VODA 3BB8A 4N4NB 2CV2A 3FZVA 2HR3A 3H3VK 2BXYA 4WP0A 3CUQC 1GV2A 2Q7WA 4ESJA 1ARHA 2E1CA 1F9NA 3BR1A 2K85A 2ZBKA 1XGOA 3MBBA 4WYFA 2QKMB 3DKYA 1B8IB 1T33A 1REPC 5K8BA 3TO6A 3RPQA 3PJRA 2IPQX 4WCGA 1H1CA 4K2MA 4HVKA 3E0JB 4WXFA 2F5DA 5BNGA 5HNHA 4FFCA 3TOBA 2MA3A 4FHTA 2JRMA 2L0KA 5LHHA 3WTZA 2Y30A 3LWFA 1FTZA 4GDYA 1V5EA 2H1KA 3Q0UA 2G7UA 4JYKA 2XAUA 1RKWA 1AJRA 2UXXA 2O5RA 3R9AA 4RKCA 1YRNB 4J5UA 1H0CA 2ZJPF 1IN7A 2DAOA 3SFIA 3DPUA 3M7GA 2DR1A 2F5CA 2EINH 2Y2ZA 3GLXA 2VBXA 1SPAA 3HHHA 5ILSA 3OWTA 4LOCA 2WK8A 2RAEA 1G8XA 3P7NA 2LNBA 3VYRB 1F36A 1IJIA 3KPHA 1B5PA 1LS3A 4AU7A 1H8AC 3OL4A 2DODA 1QNTA 2W25A 1BQDA 5KAIC 2DBBA 1RVUA 2R5CB 2OA4A 2VXZA 1JHFA 2AY9A 4HV5A 2Y69H 1U3EM 3PDXA 3LQRA 4BBSJ 2R3SA 1VQMI 3TBIA 1ZYRF 2VKDA 1HKQA 3HPGA 3RIRA 4IW7A 1BJWA 3LA3A 4IOCF 5BMZA 4CH7A 4HW0A 4IF4A 2R0QC 2HOTA 1LVKA 3WKSA 4OINF 1LC7A 2Z61A 3EUHC 2CQKA 2XGCA 1I48A 5EUDA 1X4PA 2KRHA 2UV1A 1M0PA 1QQIA 3VDXA 1I1GA 1S6LA 3HOVJ 4WK8F 3ISPA 4KNYA 3I64A 3F22A 1LFUP 4MQVA 3HRSA 1WZ2A 4A5NA 4MO7A 4EB7A 3L1PA 4ZM4A 1P92A 1OQYA 1XSVA 1CZCA 1HSJA 2AY2A 3VK2A 2M8GX 3K10A 4DBCA 3KZZA 2IAIA 2X5FA 5G2QA 2DFHA 1YIYA 1BR2A 4CA0A 2CW7A 3K4JA 2JWTA 2DT6A 2V4JC 2FQ4A 4CCKA 3S16J 4HOBA 1E0EA 4MQRA 4Q48A 4A69C 2BHZA 3MKYB 3IRRA 2AS5F 2AY5A 1I1SA 3D5RC 1FG7A 4F5MA 1MNDA 2IP2A 3RCOA 5DD8A 1DPRA 4A3FJ 1RV4A 5F9SA 4IHWA 1TWFJ 4CICA 1FIPA 4G6TB 4Y0DA 3FM3A 2EGYA 1JUPA 2LKPA 5F64A 4XEWA 3BP8A 4A0XA 1WYTA 3LVLB 5IT9K 3I54A 1JI8A 5EG0A 2IS4A 1B4XA 1SMTA 1CJ0A 1MMGA 4UUSA 2X85A 2YPRA 3LSTA 3OYNA 2B9SA 4ZJZA 4BQAA 1JS6A 4IY7A 1OCTC 1YS7A 2YU9J 1IRFA 1AHXA 1ZGJA 1IN8A 2A5YB 5L3CA 3NRAA 2DDBA 3GZ6A 5D4SA 5G4IA 2ORDA 2R7ZJ 1RUOA 4GEBA 5JAYA 1IRXA 2MD0A 4G94A 1HKTA 3UKGA 3C1DA 1MMNA 1G3YA 2P5KA 1YJ9I 3MEBA 4EM2A 4BDYA 2A6HF 2DQLA 1AJSB 1WHUA 2VKVA 4XRSA 1E3PA 2EZ2A 1XC5A 2HU9A 3BJAA 4D5FA 3EI5A 1GC4A 1U78A 4ADBA 2LBFA 1W7PA 1RC9A 1XI9A 8AATA 3FQAA 1R71A 2EO5A 5EEGA 2E2HJ 4RLFA 2B0LA 5HDGA 4FISA 1IW7F 3LA7A 1K4TA 2VT3A 1HW5A 1FNNA 2X9DA 1GC2A 2VQHA 3IAM2 5EAAA 2BV6A 1B1BA 2ZFUA 3H3UA 1WRJA 3QRFF 1ZR2A 2Z9OA 2E7UA 1QRYA 1PUFB 2YRRA 3FBNB 5LRRA 3GO5A 2CMPA 4EJUA 2YHKA 5ED4A 1T8IA 5DYMA 5E20A 3K4BA 1MBKA 1U0JA 4UB8C 2AY6A 2F5FA 3RUYA 1GD9A 2LK2A 4BJTA 5J1RA 3WU0A 3CO6C 2VMVA 3PL8A 3DTKA 3QHXA 3WODF 5F0HA 4L0ZB 4WB0A 2PMHA 3RKYA 1D1AA 1KKPA 3PDBB 3BG3A 5J8FA 3OS1A 3E2ZA 4IKFA 4I0BA 3ZMSA 3FKJA 1LKXA 4OMYA 1VEFA 2W7MA 3BWNC 1KU2A 4CZZA 1AHFA 1I3QJ 2K9SA 4LFUA 4NQWA 1Y1VJ 3A0HC 4DGWB 1S72I 1V4RA 1VQ8I 1FTTA 3DKXA 2VLHA 3OR2C 3ZZKA 3GWZA 1QO0D 4RA2A 1WJAA 4XKCA 1MLYA 2RQPA 4A0YA 2X1DA 1WI3A 3M8EA 1BJAA 1D0ZA 2OAZA 3ZGKA 3FXJA 1WKMA 4EGYA 1YG2A 1ZH5A 5JVGF 5HS7A 2D7ZA 4AUXA 3BG6A 1I3AA 2VJ4A 2XF7A 2E71A 2R5ZB 4NC7A 5GPAA 3I59B 4CZCA 2R5EA 2MSYA 4P9UA 5E3KA 2JZYA 1ORKA 3VPRA 5IT9Z 4NUBA 3SZTA 2Y0MA 1D7UA 2CFOA 4U1TA 3E5QA 1ASLA 4JEXA 1K79A 2JVHA 4XJMA 1FMWA 1BC8C 2QZ8A 4RKDA 3SDGA 3I16A 4HDVA 2V1UA 4WD2A 4K2EA 3W1IA 2WAEA 4B48A 3ONQA 4XN3A 1FYMA 1FOKA 1UU1A 3G7QA 2QBYA 2EA4A 4KT6A 3DV8A 1AY8A 2VE8A 1O57A 2V9VA 3EZ1A 1TNTA 3WTSC 5CPRB 3KE3A 2LF7A 2M9HA 5M49A 1RETA 2OJED 1I39A 4AYBA 1IGNA 1QJ5A 4JEVA 2ZJ2A 2J5OA 2I10A 2JK3A 1QISA 1MW7A 2E7JA 5KCMA 1KMKA 4E7JA 1OMIA 4R8DA 1IZ1A 1BI3A 1STZA 1IAWA 1B9IA 4MLOA 3COAC 1SC7A 1TWCJ 1OR7A 3HMUA 3DXWA 3BQYA 3CCVI 3R61A 2KFDA 1TOIA 2X6XA 4CCNA 3AOWA 2QB2A 5ICFA 5ILUA 3CC2I 2VYCA 1BW0A 3WZFA 2YR2A 2EFOA 4AIDA 3A8UX 5D5UB 1WH5A 1ZR4A 2AATA 2LLKA 2BHXA 2Z20A 2CQNA 2W8VA 3RSNA 4Q76A 3CLOA 1LC5A 2XF6A 2V1PA 2RC4A 1DJ9A 3II0A 2BWPA 2ZJGA 1SFFA 3IC7A 3H35A 2D61A 3F8BA 2MW8A 3SQNA 1PUEE 2OATA 3FISA 3RKWA 2PB2A 1AOYA 1LK9A 3ZN0A 4F92B 2RV8A 1ASAA 3M1CA 3R4KA 3FFHA 4IHTA 3SEQA 5IP9J 4ZYGA 1RV3A 3G0TA 3R0JA 1S7AA 3QAHA 1OR7C 3HVYA 1ARIA 1LDKB 2ZNZA 1IRGA 4RB1A 4E70A 2LTPA 1SFOJ 2A6EF 2EZKA 1KZHA 1Y39A 1JUMA 5IOYA 5CKTA 3C2HA 2QQAA 4LIUA 2BI2A 3AEJC 2H6CA 1S29A 3V8KA 1T95A 3OS0A 2XGXA 2QYOA 3FXKA 1LC8A 2Q8KA 2DW4A 2E7WA 2BYLA 2A05A 4E7SA 4DIQA 4WYAA 5GAGJ 5JLXA 3RI6A 1OCRH 1YE9A 1TLHB 1NG6A 2WKAA 2KIMA 2JPCA 3FIWA 3H5RA 4RB2C 3HOZJ 3KP5A 1H9GA 5F04A 2KJCA 4E4HA 1AMQA 4Y17A 4CBRA 2COMA 5EEHA 5ICEA 4U7BA 1X3UA 3CZ6A 3M9AA 5GADJ 2O0YA 1VQOI 4OIQF 1PJRA 4MIMA 1EG5A 3M1EA 2BXZA 2E2JJ 3CAIA 3DP7A 1PP7U 2E1NA 3CC7I 3JRBA 1K4SA 5FLXZ 5IYDJ 2DOUA 3HLMA 2GSAA 2TRTA 3C2BA 2FBIA 2P4WA 3TP3A 5LGTA 2QA4I 3LSIA 4XK4A 1Z67A 1UKJA 3H92A 1MMAA 3GFLA 1EJ9A 5B1AH 2HYGD 5C4XJ 2D63A 3GZDA 3D5SC 1AX4A 1YIJI 1MH4A 2BYVE 2DN0A 5FFZA 3DLLF 2H8RA 2GZWA 3MVPA 4E3RA 2DI3A 4DQ2A 1NHAA 1ODDA 2ME6A 1PFFA 4QWQA 1FP1D 1YW9A 4AWXB 2ECBA 1IG7A 1ARTA 4GO1A 4DYCA 4HZFA 5FO5A 2LR8A 5L3BA 3BWOA 4XR6A 4N9HA 2GIVA 5IYCJ 3V4GA 3PO3J 4MKKA 1RESA 2M7AA 3TQXA 2LP0A 1GDEA 4KAMA 1RI7A 4LJZF 4ZWVA 4GCVA 3FQ8A 2LYCA 2Y9ZA 3NEUA 1O3TA 1Z21A 3GTKJ 3QU6A 1EH7A 4BE2A 4RM2A 2Z9XA 1ELQA 4MFEA 4PJJA 5L3DA 2QMAA 1BA5A 3FDBA 1Y0UA 2Z2SB 3R4TA 4XLHA 1G4VA 2L2OA 2VGVA 3LSPA 2XAFA 1AJSA 2JMWA 2VKEA 3G1OA 2B7EA 3LFUA 4HX7A 1QZYA 2CRGA 3I5UA 2W8UA 4TN4A 3PSIA 1LDDA 1XMAA 1X28A 3FM5A 2HOZA 1YJZA 1FYLA 1AIAA 3CBFA 2ID6A 2DPDA 2DOFA 4ZTJA 4R1HA 1KQ8A 1W7MA 3E5XA 2HZPA 1SD6A 4I2OA 2LKSA 2AQFA 1VQLI 4WX9A 4U0WA 1ZK8A 2VIXA 3RPUA 5D8LB 4F5LA 1KYWA 1K78A 2DU9A 2E7XA 3ZN1A 1SD4A 4GRIA 5JR3A 1WJEA 4UUTA 1CF7B 1TOGA 3CQ4A 3HT4A 1ETKA 3RKQA 2VB6A 1XMXA 2GB3A 1NTCA 5DDGA 3E6MA 2XC7A 2VMXA 3GJUA 1XGSA 3J7AY 2VGWA 3K69A 5H6RA 3TMOA 1MJ9A 3OSGA 2DK5A 2DA7A 1UG2A 3PO2J 1J0RA 2DGLA 3LOCA 1G6NA 2OPTA 4I76A 2EBIA 1OCPA 4Y52J 2X6WA 2HVSA 2XPUA 5K7ZA 1AHGA 5HDNA 3WE3A 3ZR8X 1P3WA 3AAFA 3SJMA 3ABLH 3F3XA 4JX5A 4NBQA 2EV0A 2UWMA 5FLXK 2WV1A 1EQBA 3V8JA 3E5UA 2E60A 5JHFA 3L2UA 4ZASA 2GAUA 2R7RA 3MC6C 4UUVA 2X8UA 4HEA2 3AEJA 4RDUA 5E1XA 1Y8QB 3GMEA 5DTDA 5FT5A 2QF7A 4B44A 3GXOA 2F6CA 1SVOA 1MMDA 3VK4A 1MAPA 5LFAA 3RZOJ 1YOVB 1SFKA 2ZCWA 1C7GA 4B4CA 2H6BA 3QODA 1IV6A 2V6CA 1HOMA 3GZDC 2FOWA 3ZQGA 2KT0A 4B1RA 2ZC0A 3ZQ7A 1APLC 3OIQA 1OHWA 3GYHX 2ZC2A 3HXLA 3ESWB 4A3MJ 3VODA 1M0NA 3LA2A 4XNFA 4LB5A 3A9ZA 2MBFA 2ADUA 3M4OJ 1SF2A 2KLOA 2OGAA 1DUXC 3E97A 2QA3A 1HSTA 1BJNA 4BHBA 4KMFA 1SAUA 2W4SA 3BWGA 2K4JA 3R0AA 1JKPC 2G9WA 4RAEA 1QBJA 2P6SA 1WJFA 2P5LC 1QJ3A 3WCNA 3K4CA 1EA3A 5C44J 1F43A 3BR2A 3GTOJ 1FBQA 4WYCA 2DOEA 1XX5A 5E79C 3RDIA 1ZTRA 3IKVA 1VTNC 4EU1A 4UVCA 1G3TA 4NB5A 5GTIC 1E3OC 2VJ5A 1FBSA 1Z91A 3FXUA 4D7NA 5K1YA 1SD7A 5G2PA 4CVQA 2JVGA 3HL2A 2R5YB 2QSGX 1WVRA 5J1YA 2KZVA 1KONA 4K2IA 1IXCA 4X0GA 3DXVA 2DO7A 4OC9A 1MBFA 2LY9A 4Z6YA 1ON1A 4AM3A 1ASDA 2Z1YA 3DWLE 1YJNI 2O03A 1DPUA 4ZYDA 1WKHA 2OC6A 1CL1A 2NOGA 4AD9A 1U8BA 5L3GA 3QQAA 3CTAA 4KFCA 5HS9A 3PDBA 3ZRQA 1A35A 4HSRA 2BIEA 2DLLA 2Q0OA 1AHEA 3WLXA 2EWNA 1XDUA 2AY7A 3BG7A 2BWNA 2R7WA 4GYGA 3H0DA 1MH3A 1N31A 4F5FA 1GVJA 1G7WA 2AY8A 2EQRA 4IQJA 2YUSA 2WAQA 1B72A 2F8JA 2JA6J 3JZLA 1AKHB 1YLFA 1WYVA 4AO4A 5GP9A 2VGTA 2XROA 1IXRC 1WJ5A 4EJTA 1USSA 1O3QA 2M7BA 5C3EJ 3PJ0A 1TTYA 5E18F 2L54A 1Z77A 1U2WA 4A3JJ 3S1MJ 4RLGA 3HJEA 3JR9A 1TL8A 2DJNA 4C2MJ 4BE0A 1HCRA 4A3BJ 1BI0A 2D1HA 3S3OA 4JEWA 1TPLA 5GAHJ 4BU2A 1GLNA 4OAZA 1R22A 4M73A 5CVUA 3WCOA 2Z1DA 3FZ8A 2LBFB 2BY2A 5FT8A 1P4XA 3LSKA 3G8MA 3ZRPA 1WJDA 1R4MB 2MD5A 1X2AA 1I6XA 3DLAA 2VUMJ 4M9XA 1BOBA 2MG4A 3DU5A 3U1KA 4M71A 3L9FA 2CGPA 2D66A 2GMSA 3KZIC 4B3AA 2VI9A 1JKRC 4FASD 4YEJA 2DT7B 2HI3A 3MKJA 4UOYA 2CS3A 3AL0C 1JF9A 1S06A 1JS3A 2DA1A 5CVRA 2HQ5A 3BG9A 2E19A 3ASNH 4RLQA 2STWA 1I29A 2HP2A 5ERIA 2Z16A 3VOEA 3CQZJ 5EDNA 1X1PA 2EH3A 4RM3A 2MFZA 4LNMA 1T0FC 2W85A 3EUHA 2FRHA 4XLPF 1X29A 1SFUA 1GV5A 5J4YA 1OISA 2X48A 3CDHA 3RYRA 3LAPA 5M3MJ 3K70D 3CCMI 1XSDA 4RJYA 4DZJA 1JE8A 3AV7A 4KXKA 2JRTA 3OOPA 3USFA 1MGTA 1K6OA 4KT5C 2X6OA 1ZHFA 5JI6A 3CD6I 1A6IA 4XMYA 2L9SA 3AKZA 2M5WA 3G73A 1YX3A 2XAQA 1YI2I 4AO9A 3WHBA 4Y33A 2ID3A 3CCUI 3HUGA 1W5TA 2XGDA 5CLSA 2FNUA 1ZG1A 3SYTA 4PJLA 2LY1A 3B1EA 4DYRA 1EJIA 3VFZA 2GM4A 1CGPA 4OYTA 4MNUA 3HKZA 5K7HA 1R5GA 2NVXJ 1IRZA 5J4VA 1BC7C 4O5VA 4HRIA 2Y48A 1BN5A 3PQJA 4P96A 1BS0A 2M0CA 1X19A 2VASA 2V1NA 4I6ZA 4PGHA 3X2QH 5IY5H 3JAMK 4UV8A 2QGUA 3IWFA 4M2MA 2HUUA 2YS9A 2EPJA 1YJSA 2M34A 1AU7A 3DEEA 4W1UA 3KEOA 4D9JA 4BQOA 2EA2A 3E3VA 4XQ2A 2KRCA 3AEPA 4HG2A 3FTBA 3BROA 1UHMA 1RZ4A 3ZMTA 4EJOA 4I01A 3LG0A 1I50J 2L5QA 3HGYA 2AQEA 2E54A 2IGMA 4XSZF 3CUQB 3JU7A 2YSRA 1BR4A 2W7KA 1YJYA 4ENKA 2HOXA 1IXSB 2FN6A 4F55A 1FOYA 4HQMA 4M2KA 4OIOF 1YHQI 3CDLA 1IJWC 3SZGA 2PJRB 2A61A 3DU4A 4XKVA 4B47A 4MTDA 2VJIA 4BHCA 2D45A 2C6YA 1Q1VA 2XPVA 3WGHA 3GETA 2K9NA 1I43A 4ASNA 1SVVA 3R6SA 1AIBA 3FMQA 3NARA 2BVLA 3WHCA 3OYGA 1ZAOA 2FE3A 2O9LA 1M0OA 4RAYA 3SXYA 4S0HB 2DA3A 3C2GA 3VB2A 3NYUA 2RN7A 3KYCB 4BXFA 1MGVA 1K7AA 1WI9A 1Y6IA 2HOEA 2RKHA 3MKLA 3OYJA 1HDPA 1T39A 1I5ZA 1QZZA 1GDTA 4XJOA 4DYQA 5HDKA 1Z9CA 2VPLA 1QITA 4KYOA 2BY0A 2F4MB 4KIFA 3CJTB 3JRDA 2WY8Q 4CCLA 2O7OA 1XN7A 4PJ0C 2PO3A 2IGOA 4OAYA 3CCJI 2C7TA 2QB3A 2VMYA 3L09A 4A6UA 1N25A 4GE7A 3K2ZA 5DX5A 1BI1A 1V3FA 1BR1A 2GXBA 1KU3A 1ASGA 1L3LA 4WXGA 1C4KA 3ASBA 3G1LA 5K5RA 1X2NA 2FJ1A 1S08A 2WK9A 4MTEA 1TWHJ 2E2IJ 2W8TA 3GFJA 3MKZA 4F52A 5E3MA 2Y0SA 3B1CA 3NU7A 3RPUD 1RIOH 1AA7A 1LNWA 4PVFA 1UAAA 5BJ4A 3BTCA 4A3EJ 3Q3SA 2NXNB 1V54H 2LREA 3BY6A 3HTUA 5HODA 5F6FA 3FZ6A 3F8CA 1T56A 4DBQA 3MD2A 1QGNA 1ZRFA 3QYEA 1B6AA 2Z9UA 2TCTA 1MIJA 3F9TA 4KIGA 3HRUA 3FMRA 2JISA 2YCPA 3LQQA 2R7FA 5EZGA 3TO9A 4F3QA 2VMRA 5E4ZA 3MQ0A 3NQOA 1VJOA 3TCMA 4CO8A 4LITA 4BH9A 2WY7Q 3OYFA 4ZYHA 3E1SA 1YS6A 3QI6A 1Z6TA 1AKCA 4IX8A 1RKTA 1X4OA 4IYOB 3CMYA 4HF0A 1C7OA 4BY1J 2V26A 3KX2A 2YCTA 3FXQA 2XVCA 4I02A 4BKXA 1W3UA 4ZZLA 4KA4A 5TF5A 3OYIA 5CQEA 2PX9A 3GEZA 3KGXA 3CDIA 4LG3A 4A00A 2V0YA 3ASOH 2NAZA 4HYEA 3JRCA 4XOPA 2ZSHB 1H89C 3L2RA 2ZSMA 5HDMA 2E34A 2PBIA 4N9IA
chains in the Genus database with same CATH