4N0BA

Crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
473
structure length
468
Chain Sequence
ITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKETGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription activator
total genus 133
structure length 468
sequence length 473
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n0bA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0bA02
1FC4A 3F22A 4JEVA 4UVCA 1E17A 5ILUA 4BXUA 3KETA 2Z33A 5E20A 2GQNA 3GWPA 3ZZJA 2G7UA 3COGA 5LHHA 1R1TA 5ED4A 4P9UA 3EQLF 2VC0A 2CGPA 1XI9A 4ADEA 3OP7A 3F8NA 4PGHA 4UV9A 4LB6B 4JEXA 4CDGA 3T8RA 3EETA 2JG2A 4TV7A 1B9NA 2H6BA 2HOXA 1FYKA 2R5CA 5HXXA 1ZREA 2XV4S 2CFBA 1QZYA 2MBFA 5LGTA 5HS9A 5F1RA 3FM3A 1L3LA 2L54A 3DEUA 4KN7X 1TW2A 1EV7A 3NU7A 2D2WA 3DV8A 4LMYA 4D0PA 1ASNA 2UZKA 1B5OA 5CYVA 1V3FA 4KN4X 2X5DA 4UHTA 2Q7WA 4ZDLA 4EB5A 4U0WA 5L3BA 1ORDA 3E2ZA 2A6HF 1O4SA 3LV2A 2YX7A 5BJ3A 3KEOA 1O3QA 2O1BA 4W1VA 4RKCA 4R8HA 4PIWA 1AKAA 4EQQA 2IPQX 2EZ2A 1JS3A 2PLYA 2BIAA 1HW5A 2XH1A 1YQAA 2WK7A 2CINA 1ZGAA 4ESJA 3HUGA 1HW2A 5E17F 3F0HA 2YSRA 2XIGA 1BC7C 2CQKA 1FSHA 2KJCA 3DRDA 1ZRCA 4ZLVA 4G9YA 3O2PE 2A69F 2EA4A 2CJHA 2DGLA 7AATA 2PFBA 4P55A 1VEFA 5HOOA 1W7PA 1FG3A 1L0OC 2DK8A 2EFWA 3AEPA 4FFCA 1DJ9A 1AJSA 3LVLB 3WGIA 3VK3A 4RB0A 3SFZA 4BAYA 2R7FA 4WB0A 5IT9K 1MZBA 2BI3A 4GSAA 2XASA 2VBXA 1HBXG 4KMFA 1TQMA 4ZASA 2L01A 4RS8A 1QQIA 3NU8A 2F2EA 3ELPA 3HTSB 2FNIA 5L3EA 1GHCA 2XBNA 1SMTA 1B6AA 3EI5A 2G9WA 4HYEA 2Z1ZA 1LVAA 3AAFA 1BI1A 3DU4A 1B9MA 3GSBA 4I0BA 3ATHA 4PFFA 1O57A 2BI2A 3C1DA 3BCXA 2VMWA 2Z9UA 3CQ6A 1A04A 3C7JA 2W7LA 3AOVA 3D5LA 5LHIA 2VMUA 4M74A 3AENA 2STWA 3HL2A 3V7SA 1KA8A 5HDNA 3VK2A 3PGYA 1I6XA 2HDCA 4ZDPA 1T98A 4B9BA 2DU9A 2A68F 4ITXA 4OYTA 2A07F 4IHTA 2VONA 2O03A 3F8BA 5AONA 3E6CC 3DR4A 4M9XA 4AOAA 5BQTA 2NYXA 1Z3ZA 2C81A 2YRRA 5BJ4A 3LWFA 3QU6A 5DDGA 3HTUA 2LF8A 1OXPA 3KP7A 3KE2A 2O0RA 2HOEA 3Q9SA 1JE8A 1HKQA 4JEWA 4A0FA 4AZKA 4MNUA 1AHYA 2YCPA 3E9KA 3ECDA 2M87A 1T2KA 5D5UB 1N31A 3C3WA 4Q76A 2BI9A 4HQEA 2FNAA 1SD7A 1DPUA 1ZC9A 4HV6A 1EG5A 3QBOA 3AOWA 2HOZA 3F3XA 3TO7A 5HS7A 3E5QA 2JRTA 2X3LA 3EZSA 5F6FA 4BYYA 4RJ0A 3DR7A 3H14A 1G3WA 1MDMA 3GEZA 2CG4A 1IUGA 3MZYA 3COAC 1SFEA 1C0WA 3IRRA 3HRUA 3JWAA 4RKDA 2R2NA 4W1XA 4ETSA 2OGAA 1CZCA 1WQ2A 4RAZA 5D5WB 4IRIA 1HSTA 3A8UX 1V72A 4R5ZA 1X28A 1G3TA 1P92A 1IN5A 4OMAA 1FBQA 2QBTA 1XMAA 3JTHA 3RTRA 4OCAA 1EH8A 1Z7DA 1ASAA 1S0AA 1USTA 1GVJA 4KMUX 3WTTC 3HIFA 2DFIA 1IBJA 4WYDA 1UHWA 1WYVA 3EI7A 3QHXA 4OBVA 1QJ3A 2ZMEB 1C7OA 2VIBA 3FF5A 1KQ8A 1FZPB 2CWEA 1DPRA 4I01A 3R0JA 3VK4A 5DUIA 1REPC 1FYLA 1ASDA 4Q31A 1TASA 2DTRA 4GE4A 1LW4A 3NYUA 4KYOA 1MGTA 1RUOA 4IYOB 4ZYGA 3REOA 3GBXA 3HOSA 3DPTA 4GYGA 4ON0A 1QPMA 4TMRA 1OHVA 2EFQA 4A6DA 4LLLA 4L9TA 2FRHA 2V1PA 3KZZA 2DPUA 4KIGA 4DNCA 1ZODA 2XRNA 1QGPA 2L4AA 1JGSA 4PZJA 3V7RA 4ZDOA 1YS7A 2FBKA 2K86A 4HF2A 2VE9A 3FM5A 1W4MA 3RYPA 2XGXA 5K5RA 1ZHFA 1J2XA 2IVMA 3PQJA 2Q8KA 1U5TC 4KIFA 3B1EA 2CB1A 3FZVA 4MHGA 3A9YA 3FCRA 1AMRA 4LD5A 4WK8F 1JS6A 2Z20A 3TDUC 5F8VA 4Y13A 2VMTA 3GO5A 4M9ZA 9AATA 3V7CA 3GJUA 1LB2A 1IN8A 2ZSMA 4JE5D 3BP8A 3G7QA 3CBFA 2IRFG 1S29A 4OIOF 1ARTA 5BMZA 1JXSA 3A9XA 4GO1A 2ETHA 3GETA 1XD7A 3JU7A 2V9VA 5DD8A 3WTVC 5L3FA 1FNNA 4ENMA 2XROA 2P5KA 2Y48A 4JF0A 3N97A 3B73A 3BCBA 1I41A 2W8TA 3D6KA 3GVAA 2FA5A 2DBBA 1TNSA 1I1SA 2P7VB 2CSOA 3ZMDA 4UNOA 1GD9A 3BN1A 2XVCA 4E1OA 3MFKA 1IZ1A 4XLPF 3B8XA 1FP2A 2FE3A 1FT9A 4NQWA 1BI3A 1WI9A 4W8IA 4MTEA 3OOPA 2QM3A 2H6CA 4K2IA 2NS0A 2HTSA 3WTUC 5JVTA 3J7AO 3FXQA 3I0TA 5DEQA 3MWMA 4U0VA 4XQ2A 3FWEA 3DZZA 3PPLA 1BJ4A 2CH1A 1TATA 1S7OA 1ON2A 4FHTA 2GMUA 2WK9A 2ZJ2A 2VGZA 3E6DA 1R1UA 1AHGA 1IN6A 2BKWA 2GQQA 1KMJA 2CYYA 4BNCA 4XEWA 2W84A 3J81Z 4KUMA 2P6SA 5AIQA 4ZM4A 1Z7UA 3ZZKA 2CW0F 3WCOA 4WXCA 2XAHA 2ESNA 3FRKA 3FZ8A 1LDDA 2O6GE 3ZQ7A 1TLHB 1FSEA 1P6RA 3IKTA 4FT8A 3RKWA 4WYEA 3PQKA 4HF0A 1PP8F 2E7WA 2GB3A 2Z5UA 4F4EA 1XDSA 1S06A 1Z9CA 2W7DA 1HW1A 2VE8A 1C7GA 1CS1A 5M49A 4A0XA 2LKPA 4GE9A 2OZ6A 2QLZA 3HOTA 2VMRA 2QBYA 4ENNA 3N4MA 2OBPA 3TOAA 3TO9A 3MZHA 3RKYA 2GXBA 1DGEA 1DDNA 1LK9A 1RV3A 3AEOA 5EIGA 4EM0B 1MJ9A 1FC3A 4HAMA 3JTGA 1IN4A 4EGZA 1CJ0A 4F5IA 4O6ZA 2EFNA 3FD0A 1WWXA 4L9JA 2CY8A 2FF4A 1O61A 2HYFA 1FPQA 2VGWA 3NYSA 3WGHA 3EI9A 4S04A 4Y15A 1R22A 4ZSWA 4A0RA 3F6OA 4GDYA 4HX4A 2B0LA 3K40A 5LHAA 1KL1A 1HXDA 3USFA 4E77A 3CDHA 1EQBA 3RBFA 2X8UA 3E77A 2VMSA 1ZLJA 5BPIA 3ZN1A 4QLCU 2W8UA 2VXZA 2JJGA 4HA8A 3GLXA 5D8LB 5E5IA 4S05A 5D6FA 1OKRA 4QWQA 2YR2A 4IRGA 2QA3A 2HYGD 4GCVA 1ARSA 1AMAA 1TARA 1M7YA 4Q47A 4I2OA 4P9FA 2R0TA 3FHZA 1SFFA 2OA4A 2OQRA 4W5KA 2PJPA 4MTDA 2RGVA 4UHNA 1J0RA 2WWYA 4G7OF 3KP2A 2JISA 5C6UA 1QO0D 2YHKA 3RJPA 1Q1HA 1IRFA 5E3KA 1TNTA 1B4AA 1V2EA 3WTWC 3PDXA 2D1VA 5ERIA 3NX3A 3EUCA 1JG8A 1T3IA 4N0WA 5LGUA 1XMKA 2BEOA 1D5VA 2VT3A 4HQMA 1BN5A 4RGXA 4XLNF 3SZTA 5TJJA 2YKYA 2KIUA 4IRHA 1IVRA 5LRSA 2TPLA 2E1CA 3FVXA 2CH2A 3CO7C 1LC5A 2FQ6A 4A0ZA 2EJRA 4MEYF 2Z99A 3CUQB 4RITA 3ISLA 4WYGA 1XSDA 4OIPF 1RVUA 1J04A 2ZBKA 4HF8A 2BE5F 1B9IA 5H20A 2OQGA 1I48A 3MEBA 4HX8A 3JWBA 2JPBA 3E6MA 4P7YA 3AEJC 4CXRA 1H0MA 4H51A 2K02A 2ZUKA 3BWOA 2RFVA 1H9TA 2RC4A 3DODA 4FX4A 4PVFA 1SPAA 1O3TA 1F4KA 4TN4A 4UOYA 1B9HA 3I53A 1ZRDA 3FQ8A 5D5SA 4JK1X 1SAXA 5FFXA 3L09A 2F5DA 3VOMA 3MAFB 1ZH5A 1YIZA 1ZRFA 4OT8A 4WYFA 4UUVA 1W5SA 3H7FA 4EJWA 1ELUA 2AY6A 4WLJA 4XBFA 3PFIA 4M2MA 3ROUA 4A6RA 1J75A 3AATA 4RM1A 2M45A 2V1DA 4CBSA 2D45A 2AATA 2HOYA 1G6NA 1I5ZA 2EA2A 2O8XA 3NDNA 5E18F 2O61A 4L9NA 1WKMA 3FTBA 3KZYA 3F9TA 2OZUA 2YKXA 4A2UA 1B4XA 5DCMA 1SVVA 2DGMA 4CYDA 3WGBA 4ZWVA 3RCHA 2VGTA 4IF4A 3BWNC 1U5TA 4ZYHA 5DJ9A 1PP7U 1F5TA 1KU2A 1AAMA 2HUFA 2ZCWA 5KK1A 1G7XA 4EJOA 3IL2A 1YIYA 1GXQA 2E7XA 4OOIA 2YRIA 2Z9WA 2YKUA 4M71A 1QNTA 1IUYA 3CQ5A 3UWCA 2HKOA 2ACJA 2JPCA 1VP4A 3QPTA 3DQVC 1ZAOA 3WTYC 1O62A 2Z9XA 1YW9A 2IW5A 2GWRA 3EUHA 5L3DA 3ISPA 4U2HA 4XAUA 4KIBA 2BI5A 2D61A 4HLYA 2VOOA 4RGRA 1CF7B 4MQVA 4P96A 2COMA 2EH6A 3E97A 2NMPA 2ZFWA 5CVVA 2VMNA 1FX7A 5L3GA 5G0AA 3I4JA 4ZYDA 5G2QA 1QITA 2E7JA 1AKBA 1DJUA 3TATA 3P9KA 1Z1DA 4KYWA 1QIRA 2W25A 1SFUA 4NHJA 1IAYA 1YAAA 2W8VA 1TW3A 3QOPA 1FP1D 2QVOA 1K78A 1ZG3A 5E8GA 3FFHA 3KGWA 4KAMA 2HGCA 4JBAA 4U7BA 2EFOA 1D3YA 4AIJA 2FBIA 1D7RA 1X3UA 4IVNA 1O7FA 4AO9A 4LNMA 2JJEA 4RGSA 2J5OA 2R5CB 3IRQA 4A72A 2MD5A 3KP6A 3N5MA 4PFNA 3EI8A 3GZ5A 2CANA 3QN6A 1O3RA 4EMSA 3RPQA 2DR1A 3HRMA 3PAAA 3FMQA 3TGNA 5A2QZ 5K1YA 1CQ7A 2IA2A 4W91A 3WKSA 2QMAA 1S09A 1JHHA 1B59A 3HHGA 3E2ZB 1WYTA 5DV5A 1M0QA 3FSLA 2GA2A 5EUNA 4K2BA 3K1PA 1S3JA 1IRGA 1AJRA 5FT8A 2DLLA 3KP3A 4HOBA 2BHXA 1QBJA 1ARIA 2RV8A 2GMSA 3F6TA 1SZUA 2D66A 1MAPA 1SF2A 5DYMA 1C4KA 1XSXA 3CAIA 1AX4A 2VMQA 3AEMC 4JEYA 3O6BB 1GC3A 1V4RA 2R3SA 4HF1A 2R7DA 4B8XA 1FY7A 5EAVA 4LK1F 3TO6A 3A2BA 3FKDA 1W7PB 4U88A 4IHSA 4F5FA 4F5GA 2P5VA 2YOBA 3K28A 3EYYA 2PN6A 4MQRA 3ZPLA 4BMKA 5CVJA 1AJSB 3IHUA 1FYMA 1UU0A 1C0NA 3L9FA 3LFKA 2C0RA 2HQRA 3HSFA 3WY7A 4WXHA 4QGRA 1ONVA 1RVYA 2MH2A 1C7NA 3IHJA 2J5PA 3PA9A 2ESHA 4PDKA 2NNNA 2XAJA 3ZMVA 1YW8A 1UHMA 1BS0A 4P5OA 2PB2A 4IY7A 4WWCA 5D5VB 2XAGA 3ASBA 2VT2A 3T5XA 4JEZA 2VI8A 1UFMA 3JSPA 3R6SA 3ZMZA 3S2WA 4W1WA 1OYYA 3IKVA 5FO5A 3AENB 3VEPA 2DKJA 2FSWA 2VMYA 1KQ9A 5FLXZ 1WYUA 5LBQA 1D8KA 4N9HA 3UAKA 4PGGA 5ICFA 2ISZA 1N2TA 3VB2A 3WU1B 1ODDA 1ASBA 1XCVA 1LDJA 4YG2F 3NEUA 1BJOA 1TBXA 3WKRA 4GEBA 1S7AA 8AATA 3E6GA 5EAAA 2VOPA 1YTYA 1GEYA 1Y4IA 2FNUA 4RIZA 3LAPA 1ZLKA 1AWCA 3FMSA 3GZCA 4CVQA 4H0EA 1PMOA 1Z6TA 5EEGA 4L5IA 3NRAA 4JE5A 1DFOA 3QRFF 2V79A 2HFHA 2W7FA 2YPRA 3R60A 4LG0A 3TQNA 2HKXA 5CLSA 2VIAA 4LK0F 2GAUA 3HHHA 4MGRA 4WXDA 2E54A 3DPLC 4LC3A 1Z6RA 1O7LA 2A5YB 1U8RA 3B1DA 4EJVA 4HDVA 3AELA 1MLYA 4ZAHA 5LH9A 2DT5A 3OV8A 1YFHA 2EV5A 1MDMB 4WP0A 4ESBA 2P4WA 3D0SA 4GGGA 4WF2A 2XKPA 3DXWA 1QJ5A 1U6GA 2L3DA 1TOEA 2DK5A 4UVBA 3QM2A 1BM9A 1LEAA 3CJNA 3LSTA 1AKCA 3MQ0A 2E1NA 5LEJA 3DFGA 2O7CA 2XKOA 1CGPA 1S6LA 1BOAA 3WGGA 3GFLA 4HBLA 1S07A 4EVIA 3TOBA 1P3WA 2V0YA 3AEJA 1SZKA 2W8JA 1HKSA 3PD6A 4E3RA 1E5EA 4J5UA 2CJGA 1IN7A 2M30A 3E3VA 3I64A 1WYVB 4Q48A 2Z61A 3VODA 1F9NA 3GFIA 3CO6C 3M9AA 3QI6A 2KRFA 1UKJA 5HHYA 1BBYA 1WKHA 1RNLA 2PQ8A 2BYLA 1IXSB 1U2WA 4IXOA 1XSVA 2QQ9A 4ZWMA 4F5HA 4E3QA 2H27A 5JAYA 1CL1A 3LY1A 4NB5A 5DD4A 4UXNA 3GW2A 2V6CA 4MQQA 2O3FA 2WC2A 4G7ZF 3RIRA 1BQAA 3C18A 2D64A 4RB2C 4WXGA 2WKAA 4WYCA 4CICA 1FWZA 4ZZLA 3T32A 3KKIA 4LB5A 1PUEE 3GWZA 2MLKA 3TQXA 1AAWA 3BWNA 3T0YA 4GE7A 3J81K 2L4MA 2GSAA 3F8FA 4CGZA 3W6JB 1RIOH 5CJ9A 2LSOA 3ECHA 3PDBA 1YJSA 1IF1A 1Y0UA 5J8CA 3L2CA 3FX3A 3ULQB 4AH3A 4AIKA 1RI7A 1BJWA 3V8KA 3CQ4A 5D4RA 2EV6A 1TOKA 1DJEA 2KKOA 4KA4A 4ADCA 3MC6C 3RPUA 1WRJA 1TQPA 3MEXA 3LVMA 4KNYA 3LWSA 1R58A 3M8FA 2EK5A 2CTZA 5ILSA 5DCFA 1J59A 1LNWA 1D2FA 1YJYA 2OATA 1BW0A 2AY4A 2AY5A 1OXOA 1XN7A 1D7SA 3HRTA 1D7UA 2KIFA 2LF7A 2PB0A 1PFFA 2IP2A 1KKPA 3Q9VA 1IAWA 3N75A 2F8JA 1R36A 4GXOA 2K7LA 1ECXA 3BJ6A 4HX7A 1STZA 4IPAA 1D8JA 1YS6A 4R79A 1AY8A 3B02A 2P8TA 2ELHA 2BIEA 3BC8A 4KXKA 5BS6A 2RQPA 1ASEA 5F9SA 1SD4A 5FD6A 4R1HA 3BOQA 2PEXA 1U3EM 3GR9A 4HVKA 2C6YA 2E7UA 1J7KA 1M32A 2FBHA 2HS5A 2K4BA 1FOKA 1BT4A 4KFCA 4N0BA 2A3SA 2NNYA 1J32A 3I59A 4K2MA 3NRVA 3KFWX 3EI6A 3DKWA 1FBSA 1ASLA 3KLNA 4WCGA 2QYOA 3LQRA 3MAUA 2FEZA 3QPHA 1ULYA 1E5FA 3I5TA 1N8PA 2VN2A 4RJYA 1KU3A 5G09A 3QP5A 1BC8C 5KVRA 2D7YA 4B98A 2XHKA 2ADUA 4WBTA 5H6RA 1F1ZA 4M6YA 5HLIA 4L0ZB 2M5WA 2FOKA 3AEMA 1SFXA 2W7GA 5J8QA 2OD5A 3U1DA 2BV6A 1T39A 5FFZA 1EH7A 3J80K 4HDUA 2HZPA 1KL2A 3BDDA 2FM1A 3H3ZA 3ELKA 3E5XA 1ZN2A 4IJAA 4CZZA 4M2KA 5D4SA 1E2XA 2DGKA 1LKCA 4K2EA 4L5JA 1SD5A 3A9ZA 2QQBA 4BH9A 1MLZA 2AXLA 1GCKA 1JHFA 1KQ0A 4UVAA 4IXSA 2Y75A 2VLHA 4O6JA 3MBBA 4ENKA 2VMXA 4HZFA 3CUOA 1NHAA 1YOOA 5EIGB 2HUIA 3FXUA 1IXRC 3J80Z 2H94A 5FT6A 5E1XA 3FVUA 4F7ZA 4OIQF 1MDOA 3MAFA 4R8DA 1ASFA 3BJAA 3JW9A 5IWQA 2JJFA 4ZSYA 4M72A 3BY6A 2Z1YA 3W1HA 2FU4A 1CQ8A 4B09A 1XGNA 3M5UA 1B5PA 4EJTA 1DUXC 4XJPA 1DKAA 4MKJA 5CVIA 1M0OA 2BIGA 2LNBA 1V2DA 3BWGA 1MGVA 2X0LA 4CBRA 2D1HA 3ERED 1T0FA 1P4XA 3GFMA 2QWWA 1WKGA 1S08A 3ASAA 4M2JA 3ABTA 4F5MA 1M4NA 3TFUA 2ZO4A 2FQ3A 2ZSLA 4FL0A 1G3YA 2STTA 2VODA 3TDZC 5DX5A 2K4JA 2BWPA 3P9IA 1T6SA 3SQNA 2XAFA 4I98B 2KJBA 4LFUA 1LQ1A 1KYWA 1IX8A 1I1GA 3UE8A 1XDUA 3VFZA 3GZDC 3E6BA 5LHGA 5LEKA 2DAOA 1AHXA 5G4IA 1HKTA 1CQ6A 1AMSA 3BPVA 1GXPA 1Z91A 2PG4A 1JF9A 3G8MA 1FLIA 5EUEA 3I4PA 1XGSA 3ECOA 3CTAA 4L9VA 2JJHA 1M0PA 1GBNA 1BIAA 4RLGA 3EYIA 1UU2A 4DGTA 1LDKB 1HSJA 3LAJA 4EJUA 3NTJA 1SD6A 1X2AA 3FDBA 5CVRA 2UXNA 4XK1A 4MSOA 4EM1A 2HZTA 1D7VA 4A5MA 1KU7A 2JGTA 5D5XB 1P2FA 3R4TA 1RZ4A 4G94A 3P6KA 3RDIA 3MCZA 1YNUA 2ZC0A 4AO4A 5HLGA 2LDUA 2BGCA 5IT3A 5EQCA 1W7NA 1P4AA 3ELEA 1AY5A 1TTYA 2IJLA 1DGDA 3G0TA 1MJAA 2OU2A 2DW4A 2WK8A 3F21A 5DB5A 2W7EA 5F64A 2W7MA 3TKYA 1TQIA 5D8KB 4WX9A 1TOJA 3FVSA 4EMYA 1ARHA 3KLOA 3L00A 4RB3C 1XB4A 3NQOA 4WXFA 2DQLA 3AV7A 1MJBA 4OMYA 2P7CB 1H1CA 1MD0A 1YW7A 4UQVA 1DP7P 1ZGJA 1TOIA 2Z67A 2F5EA 4G8XA 4I8AA 2ZKZA 3O3KA 1M6SA 4P3MA 3V8JA 3BJOA 3KCCA 3WU0A 4ATPA 3QP6A 3DXJF 2F5FA 2ORDA 1H9GA 2HWVA 4YIIA 4IX8A 2A6EF 1KU9A 5E8IA 1R7JA 5A2QK 3SZPA 2C44A 4Q5SF 1W7MA 5DCMB 5E1ZB 2W7JA 4RAYA 4RGUA 2EB7A 2TDXA 4EGYA 4G7HF 3KP4A 3RCHB 1AOYA 2BYJA 2NAZA 3SHFA 3HBXA 2G7HA 5TF5A 2HORA 1U5TB 5JI6A 2XUBA 3IC7A 3FZ7A 3W1IA 3EIBA 3WLXA 4A0HA 3LVKA 1GC2A 2AS5F 5LLQA 5K5QA 4ISYA 1YIOA 2EPJA 2GIVA 1GEXA 2VMPA 3JW4A 5BPDA 1W3UA 3ZRPA 4GYIA 2RNJA 1GDEA 4XSZF 2PBIA 4BHPA 3L44A 3MC6A 2EFPA 3HQTA 1OYWA 3ML6A 3IWFA 3ZMSA 2YCNA 3MADA 3M7GA 3I16A 3TFTA 1ASGA 3JZLA 3F72A 4HV5A 1IX6A 5ICCA 2EWNA 2PI0A 1EJIA 2V1XA 4BHDA 2EZ1A 2K27A 3ZN0A 5TRDA 3L8AA 2GXGA 5FD5A 2UWMA 2AEVA 2QB2A 3WODF 5M4DA 2FN6A 3W1JA 2QZ8A 3Q5FA 3WGCA 5ICGA 1CL2A 2WV0A 1OATA 3BCAA 4M6XA 4MY5A 1K78B 3CUQC 5IT9Z 5AIPA 1G4XA 3E2YA 5DJ1A 1GEWA 4XJOA 2AEUA 1GC4A 4N9IA 4MEXF 3RKXA 2DOUA 4BA4A 1BQDA 3DXVA 3LA3A 2YU3A 3QPGA 3WG9A 1WSUA 4WB0B 2JT1A 2RVCA 1W7PD 5FLXK 4MQPA 3BZ6A 1YO5C 3K7YA 3BB8A 1ON1A 1ZARA 2Y0MA 4XJLA 5FB2A 3QU3A 3I54A 1MDXA 2P6TA 5AX8A 2CFXA 2ZMEA 5G2PA 4EM2A 2W8WA 4MQ9F 3HSEA 2YKVA 2VMOA 2IA0A 2DPDA 4U1TA 2GZWA 2JZYA 3RYRA 3MAJA 2HP2A 3F6VA 3GUDA 2QENA 4G6QA 1WYTB 4IYOA 1J5YA 5DUKA 1OHYA 1BIBA 4GRXA 2IT0A 2WTEA 3WTSC 3V4GA 4Y0DA 1G4DA 4RB1A 4A0GA 3ZMTA 3GF2A 1RUNA 1OYIA 3K2ZA 4I0AA 4CXQA 2PMUA 4UV8A 2DI3A 3GZ6A 2MH9A 5D95A 1XEYA 2E7IA 1O3SA 3BS8A 4ZM3A 1GC0A 2ZNYA 3ABUA 3U2RA 2DO7A 3L7WA 3G73A 3T1BA 5HLHA 1MDZA 1B1BA 3U9GA 3ZMUA 2VMZA 3VAXA 1AMQA 1EH6A 1BKGA 2D7ZA 4BHBA 1RV4A 2VYCA 3GYHX 1LC8A 3KGXA 3ZRQA 3NUIA 2PO3A 1ARGA 4OBUA 1DTYA 3Q8NA 5E1WA 2ZP7A 3FZ6A 3EIAA 3HYIA 4OIRF 4WLHA 3FQ7A 4YIFA 3R4KA 4E70A 1TOGA 1UU1A 3ZP5A 1VJOA 1C9CA 4AD9A 1PG8A 4XJMA 4MKKA 4DQ6A 1QZ9A 3TCMA 3GFJA 4JQFA 1XGOA 4BHCA 1YJZA 4ADBA 1U78A 4R5FA 3RI6A 4LLGF 1WSTA 3BV0A 4JF1A 1WYUB 4R2NA 4AVPA 4EV0A 2Q0OA 2Q2EA 3R0AA 4Q75A 4A6UA 4A5NA 2X5FA 3H3UA 1TPLA 3KP5A 3QGUA 3WZFA 4ITGA 5EFSA 4RAEA 2CO5A 2G6WA 1SZSA 3F8CA 2AY1A 1K6OA 5I92A 1BJOB 1ASMA 2BWOA 2RN7A 1YG2A 2W85A 5FGMA 2AY9A 4YFKF 5HS8A 4OMZA 1S8NA 1LJ9A 5J6XA 4O3MA 1BI2A 1AY4A 2M8EA 2D63A 2AY7A 3WE3A 3GZDA 1ASCA 1BJAA 2ISYA 3HRSA 1KYZA 3W6KB 4Z2YA 2CJDA 5ILVA 4ZH4F 4UHOA 3LVJA 2HP1A 2BYVE 3LQQA 4LG0B 3IWZA 3M1EA 4EB7A 1QISA 3H92A 1MKMA 4ATQA 2KIMA 3SXYA 1AHEA 1T38A 3KEQA 4I02A 3DYDA 4IXZA 3ZRRA 2R5EA 1LS3A 2W57A 4OTLA 5HDMA 4ENJA 2V1UA 4A00A 3B1CA 4LLNA 1M0NA 3NNKA 1AICA 3II0A 4F5LA 5HVQC 4G6DA 2PMHA 1K79A 1Z05A 2DQRA 2BI1A 4DQ2A 1FBUA 4F5KA 1AIBA 2VBZA 4OU0A 2QUFA 1YLFA 4OINF 2QB3A 4F5JA 2D5YA 4NOGA 1PMMA 3IF2A 3PD6B 3M8EA 3ACZA 4A0YA 4U7DA 1J9IA 5E4ZA 4AIHA 2GA1A 4CO8A 1W7LA 3K9TA 2VC1A 2VGUA 2EV0A 3RUYA 2VMVA 1OR7A 4Q6RA 2HTJA 3WCNA 2FXAA 4M9SA 4UHMA 1V2FA 4ZZDA 1X29A 5BOXA 1PDNC 2ZNZA 1ZYRF 4FX0A 1I43A 2BBYA 1LC7A 3HSRA 4ADDA 3I71A 5J8FA 2W7KA 4WD2A 1BI0A 3RI4A 2HEOA 4CHUA 1FG7A 2MLGA 4O5VA 2VLFA 3K1NA 3BPXA 5HDKA 3PIUA 5D6EA 3JAMK 1KMKA 2FYFA 3GXOA 3OKSA 3WTZA 2P5LC 5EUDA 5FT5A 2OKKA 5K8BA 5G4JA 5K5OA 1R1VA 4ASNA 3PDBB 4CXFA 1P4WA 3T8TA 2QLRA 4XSXF 4L0OA 2O0YA 2W7IA 3HVYA 2OAZA 4BQAA 1G3SA 4YFXF 1KKJA 2RKHA 2AY8A 1IXCA 3PJ0A 1UB9A 1CZEA 4IXAA 3HDOA 3QAHA 4A6EA 3RQ1A 5HDGA 3JAMZ 1OHWA 3FMRA 1R5GA 4ESFA 3P9CA 4Y0HA 2OKJA 4EFFA 5CVUA 1USSA 2XAQA 2IA1A 3BROA 3K1MA 1LW5A 1I27A 4LW2A 4AWXB 3FXRA 4U0YA 2CSTA 3LA7A 5LRRA 1IX7A 2AY3A 2ZJGA 2L02A 3NYTA 1G4VA 1YYVA 4AZJA 1IAXA 3EZ1A 3LG0A 4L0YB 1KGSA 2MC3A 4A6TA 1OMIA 2BWNA 2VBYA 1SMYF 5M46A 3E2FA 5JHUA 5JR3A 3CUQA 2W7HA 4L18B 1IJIA 4IW7A 2Z9VA 3HLMA 2A61A 2F5CA 2JTVA 2HQNA 1R5HA 4KT5C 4BQ0A 5M4BA 3F8MA 2NRAC 2ZXJA 3EDPA 2FNPA 2DKBA 2MA3A 1OPCA 2QBYB 2FMYA 4LGWA 4DBCA 4I7HA 4XRFA 4OC9A 2FMLA 4YFNF 4HLXA 1UCRA 2JSCA 2EO5A 1R00A 3NUBA 3R61A 3WX9A 2D65A 4LNLA 3WE2A 3WTXC 1AIAA 3P1TA 3CLOA 2YCTA 2M1BA 4Y17A 1AHFA 1B8GA 3I59B 2OQXA 2QQAA 2AY2A 3FQAA 3E5UA 3VOEA 3LA2A 1LEBA 4KDPA 1QZZA 1U08A 4LNJA 4PCQA 1W5TA 3K69A 6PAXA 4LJZF 1HQCA 4Y0IA 2VI9A 5L3CA 4A12A 2X4HA 4Q4ZF 2VBWA 3KE3A 4WYAA 4HW0A 1R23A 1ZG1A 3FFRA 5EEHA 5LGNA 2Z9OA 1ZG5A 2ZYJA 1BJNA 1IW7F 3JTXA 1MAQA 2UXXA 3DC1A 2HUUA 3N0LA 1O69A 3HT4A 3I58A 3K0LA 4LW4A 3RBLA 2OGEA 4KICA 5H6QA 3HMUA 2Z3YA 4M73A 4BA5A 2W24A 3VP6A 4EU1A 1G7WA 1XCBA 1ELQA 4ZYEA 2YX4A 2H09A 4J8LA 3I5UA 1VTNC 4WXBA 2VGSA 3DP7A 1W23A 3F23A 3JSOA 1XGMA 3G3ZA 5JFRA 3GX4X 5FT4A 3P7NA 1ZOBA 3R9AA 1X0MA 4I09A 2HR3A 1I29A 3B46A 1H0CA 2VGVA 1QGNA 1CF7A 5ICEA 2RDPA 2C7TA 3DF8A 1K7AA 2EGYA 3V8LA 3MKJA
chains in the Genus database with same CATH superfamily
1FC4A 3F22A 4JEVA 5TISC 4UVCA 1E17A 5ILUA 4BXUA 3KETA 2HQAA 5E20A 2Z33A 2GQNA 3GWPA 3J7AY 3ZZJA 2G7UA 5E3OA 3L1PA 3COGA 5LHHA 1R1TA 3KZIC 3H35A 1B8IA 5ED4A 4P9UA 3S93A 3DTEA 2LY1A 4XIDA 1D0XA 3EQLF 2LD5A 4X6AJ 3AG4H 3DBRB 2VC0A 2EQRA 4B48A 2CGPA 3S1NJ 1ZR2A 2H1LA 1XI9A 2W1OA 3OP7A 3F8NA 1YRNB 4ADEA 3BG9A 4PGHA 4UV9A 3VDXA 2DA1A 2OPTA 4LB6B 4BS9A 3K4KA 3OYLA 4JEXA 1GV5A 4CDGA 3BR3A 3T8RA 4A69C 4BL0B 4CBRA 1VQPI 3EETA 3OYDA 2JG2A 4FISA 4TV7A 1B9NA 2H6BA 2HOXA 1FYKA 2R5CA 5EF6A 5HXXA 1ZREA 2XV4S 1HF0A 1QZYA 2MBFA 3ZQIA 3DCFA 5LGTA 2CFBA 2WY8Q 5HS9A 2KT0A 2V26A 5F1RA 2R7QA 3FM3A 1L3LA 2OF7A 2L54A 3DEUA 4KN7X 1TW2A 1EV7A 3NU7A 2D2WA 3DV8A 3ESWB 4LMYA 4D0PA 2UZKA 3OSFA 2VKVA 5CYVA 1ASNA 1R4NB 1ZK8A 1V3FA 1GUUA 4KN4X 2X5DA 2QF7A 4UHTA 2Q7WA 4ZDLA 4EB5A 2KZGA 4U0WA 5L3BA 1ORDA 3E2ZA 2A6HF 4IO9F 5EGOB 1O4SA 3LV2A 4IL6C 3OYBA 2YX7A 5BJ3A 3KEOA 1O3QA 2O1BA 4W1VA 4RKCA 4R8HA 2VJIA 4PIWA 1AKAA 3JRDA 4EQQA 2IPQX 2EZ2A 4V2FA 1JS3A 2PLYA 2BIAA 1HW5A 2XH1A 2BZTA 1YQAA 2WK7A 2CINA 3OIPA 4E7ZA 1ZGAA 2KZVA 1WH5A 3HG9A 4ESJA 1DU0A 3HUGA 1HW2A 5E17F 3F0HA 1X1CA 3CCMI 2YSRA 2XIGA 5EYRA 2CV2A 1JTXA 1BC7C 2CQKA 4DJAA 1FSHA 2KJCA 5J1RA 1ZRCA 3DRDA 4ZLVA 4G9YA 2HZDA 3O2PE 2A69F 2EA4A 2K9QA 2CJHA 2DGLA 7AATA 2X1CA 2PFBA 4P55A 1VEFA 5HOOA 1W7PA 1FG3A 1L0OC 2DK8A 2EFWA 1YHQI 1SFKA 3AEPA 3OYCA 2EZHA 2DMQA 4RBOA 4FFCA 1DJ9A 1AJSA 3LVLB 3WGIA 3VK3A 4RB0A 3SFZA 4BAYA 5C4JJ 4C2TA 2R7FA 4WB0A 2DFHA 5IT9K 1MZBA 3DEEA 2BI3A 4GSAA 2XASA 2VBXA 1HBXG 4CH7A 4KMFA 1TQMA 4ZASA 1VQ6I 2L01A 4RS8A 1OCZH 4V2GA 3CZ6A 3OYHA 1QQIA 3X2QH 3NU8A 1VQ5I 2F2EA 3CQZJ 3ELPA 3HTSB 2FNIA 5IOZA 5L3EA 1GHCA 2XBNA 1SMTA 3LMMA 1VI0A 3B6CA 1B6AA 2BXZA 3EI5A 2G9WA 1XPXA 4HYEA 2Z1ZA 1LVAA 3AAFA 1BI1A 1BR4A 3DU4A 1B9MA 3GSBA 4I0BA 1HC8A 3H9GA 3ATHA 2YUSA 4PFFA 1O57A 3CCEI 2BI2A 3C1DA 1MNMC 1YE9A 3BCXA 3GMEA 4II3A 2VMWA 2M34A 2Z9UA 1A04A 3CQ6A 1M1EB 3C7JA 2KL4A 2PMZA 3AOVA 2W7LA 3D5LA 5LHIA 2VMUA 2DMPA 4M74A 3HL2A 2STWA 2L9RA 2XDVA 2P81A 4A3LJ 3AENA 3V7SA 1KA8A 5HDNA 3S3NA 3VK2A 5M3MJ 3MZ8A 3PGYA 1I6XA 2HDCA 1S7EA 1JKQC 4ZDPA 1T98A 3A01A 4B9BA 2DU9A 2IGNA 1K4TA 2A68F 4ITXA 4OYTA 2A07F 4PSXA 4IHTA 2VONA 1QZEA 2O03A 4J19A 1A31A 4XKBA 3RZDJ 3GTQJ 3F8BA 1ZKGA 1FIAA 5AONA 1I50J 3E6CC 3DR4A 4M9XA 4AOAA 5BQTA 1JTYA 2NYXA 4DBRA 1Z3ZA 4XNFA 2C81A 2YRRA 5BJ4A 3LWFA 3M07A 3QU6A 5DDGA 3HTUA 2LF8A 3MN2A 1OXPA 2WBMA 3KP7A 3TW6A 2M7BA 3KE2A 2DXIA 4PJ0C 2O0RA 2H1KA 2HOEA 2K40A 3BR2A 3Q9SA 2IS1A 1JE8A 1HKQA 4JEWA 4A0FA 4AZKA 4MNUA 1AHYA 2YCPA 2Q1ZB 3E9KA 3ECDA 1D1AA 2M87A 1LVKA 4C30A 4F91B 5D5UB 1T2KA 1N31A 3C3WA 4NC6A 4Q76A 4L5EA 2GBYA 2IGOA 4HQEA 2BI9A 3D5RC 2FNAA 1SD7A 1DPUA 1ZC9A 1VF9A 4HV6A 1EG5A 1TWHJ 3QBOA 2VASA 3AOWA 2HOZA 3F3XA 3TO7A 5HS7A 3E5QA 2JRTA 2X3LA 3EZSA 5F6FA 4BYYA 1JJ8C 4RJ0A 3DR7A 3H14A 1G3WA 1NTCA 1MDMA 2NS8A 3GEZA 2CG4A 4FE7A 4F3QA 4JOMA 3AL0B 1IUGA 3LSGA 3MZYA 4RM2A 3COAC 4UB8C 1SFEA 1C0WA 3IRRA 3HRUA 2HOSA 1D5YA 3JWAA 4RKDA 2R2NA 4CCJA 4I99C 4ETSA 2H8RA 4W1XA 2OGAA 3MD2A 3W2WA 1CZCA 1WQ2A 3A4CA 2QGUA 4RAZA 3WU2C 5D5WB 2R5ZB 4HG2A 4IRIA 1HSTA 3A8UX 1H8AC 1V72A 4R5ZA 4G12A 1X28A 2CV0A 3QPSA 1G3TA 1P92A 3ZCOA 1XS9A 2MD0A 1IN5A 4OMAA 1FBQA 2QBTA 1XMAA 5TGTA 3JTHA 3RTRA 1OFCX 4OCAA 2EILH 1ITYA 1VFCA 1EH8A 2GIZA 1MSEC 1Z7DA 1ASAA 2ZB9A 1S0AA 4MFEA 1USTA 1GVJA 2PMZN 3HIFA 2DFIA 4KMUX 4LITA 3WTTC 1IBJA 2E19A 4WYDA 1UHWA 1WYVA 3EI7A 3QHXA 3K6GA 4OBVA 1QJ3A 3H36A 2ZMEB 1C7OA 2E1MC 3OS2A 4Y4RA 2VIBA 3FF5A 1KQ8A 1FZPB 2CWEA 1DPRA 4I01A 3R0JA 2X6OA 2Z2SB 2B7EA 3VK4A 5DUIA 1REPC 1FYLA 2LK2A 1ASDA 4Q31A 5M3FJ 1TASA 2DTRA 4GE4A 1LW4A 3NYUA 2IGKA 9ANTA 4KYOA 1MGTA 5B3SH 1RUOA 4NC8A 4RLQA 4E7JA 4IYOB 4ZYGA 4M3GA 3REOA 3GBXA 4KT6A 3DPTA 4BGDA 3HOSA 4GYGA 4ON0A 2LYCA 1FIPA 1QPMA 2BY1A 3CCRI 3KYDB 4TMRA 3QWLA 2M2EA 3W2VA 1OHVA 2EFQA 2E2IJ 4A6DA 4LLLA 4L9TA 2FRHA 5GAHJ 3BZCA 2V1PA 5M5YJ 3KZZA 1E3HA 2QEXI 2DPUA 1VQ9I 4KIGA 1Y56A 5F0FA 4DNCA 3TL4X 4UUSB 5EJCA 2XRNA 1QGPA 1ZODA 2X48A 2L4AA 1JGSA 4AIDA 1K61A 4PZJA 3V7RA 4ZDOA 1YS7A 2FBKA 2K86A 4HF2A 4FETA 5IP9J 3FM5A 1W4MA 2VE9A 4KJZA 3RYPA 4JX5A 2XGXA 1S5LC 5DS9A 1ZHFA 1J2XA 2DOEA 2FQ4A 2IVMA 3PQJA 5K5RA 2Q8KA 3BTJA 1AU7A 1U5TC 4KIFA 2E71A 1WVRA 3DBLB 3B1EA 2CB1A 3FZVA 4MHGA 3A9YA 3FCRA 1AMRA 4LD5A 2MW8A 5B1AH 1ZELA 4WK8F 1JS6A 1Y6IA 2Z20A 3TDUC 5F8VA 4Y13A 2VMTA 3G1OA 3GO5A 4M9ZA 4BBSJ 9AATA 3V7CA 3GJUA 5EG0A 1LB2A 3QQAA 1IN8A 2ZSMA 4JE5D 3BP8A 4XKCA 3G7QA 3CBFA 3RKQA 2IRFG 1OLTA 4XLAA 2DA2A 1S29A 4OIOF 1ARTA 5BMZA 1JXSA 1RPWA 3A9XA 4Y3OA 4GO1A 2ETHA 1G2HA 3S8PA 3GETA 1Z3YA 1XD7A 3PJRA 2V9VA 3JU7A 1D1BA 5DD8A 4AU7A 3WTVC 4J00A 4A3BJ 5L3FA 1FNNA 3AG2H 3L2QA 2LH9A 4F55A 4ENMA 1PYVA 2P5KA 2XROA 2Y48A 4JF0A 2Y0SA 2FUG2 3DU6A 3N97A 4PSWA 5EZHA 2L7KA 3B73A 3BCBA 3ZQCA 1I41A 2O9LA 5F04A 2W8TA 3D6KA 3GVAA 1WZ2A 2FA5A 2DBBA 2Q2EB 3DKYA 1TNSA 3F0CA 1I1SA 2P7VB 2CSOA 2X6XA 3M1CA 1H89C 1Y39A 3ZMDA 4UNOA 1GD9A 3BN1A 2XVCA 5JVGF 1FMVA 4E1OA 3MFKA 1IZ1A 4XLPF 3B8XA 1FP2A 3O8HA 2FE3A 1FT9A 3S2HJ 2LMDA 2XPWA 2YU9J 2DN0A 4NQWA 1ETOA 1BI3A 1OCCH 1WI9A 2DJNA 4W8IA 2IXSA 3PNYA 3OYJA 1IV6A 4MTEA 3OOPA 2QM3A 2H6CA 4XQFA 3HXLA 1PUFA 1FJLA 4A3CJ 4K2IA 2NS0A 2HTSA 2ZSHB 2EZLA 3WTUC 5JVTA 2XGDA 3J7AO 3FXQA 1TWCJ 2RREA 3I0TA 3MWMA 4U0VA 5DEQA 4E7SA 1EF4A 1WI3A 4A3GJ 4PFOA 4XQ2A 1OCOH 3FISA 3FWEA 3DZZA 4YELA 3OSGA 1MBKA 3PPLA 1BJ4A 2CH1A 1X2MA 3IH2A 1TATA 1S7OA 1ON2A 2DA3A 4FHTA 2GMUA 3CJRB 2WK9A 2ZJ2A 2VGZA 3E6DA 3CCLI 1R1UA 3M4OJ 1IN6A 1AHGA 2VLAA 2BVMA 2GQQA 2BKWA 2ZXIA 3L2UA 2VQHA 3CESA 1KMJA 2CYYA 4BNCA 4XEWA 2W84A 2OJED 3J81Z 4KUMA 3S3OA 3N05A 5HNHA 2P6SA 5AIQA 2WB1A 3E7LA 3PUBA 2E2HJ 2E2JJ 1HA8A 4ZM4A 1Z7UA 4F93B 3ZZKA 2GXAA 2CW0F 3WCOA 4WXCA 2XAHA 2ESNA 3FRKA 3FZ8A 2VB6A 1DQUA 1LDDA 2O6GE 3ZQ7A 1TLHB 1FSEA 1P6RA 3IKTA 4QIWN 4FT8A 3RKWA 4WYEA 3PQKA 4HF0A 1PP8F 2E7WA 2GB3A 2Z5UA 4F4EA 2KMUA 2L2OA 1XDSA 1UAAA 1S06A 1Z9CA 3C2GA 2W7DA 1HW1A 4BY1J 2VE8A 2JUGA 2M0CA 1C7GA 2LKSA 1CS1A 1I39A 5M49A 2K9SA 4A0XA 2LKPA 1TZLA 4GE9A 2JA2A 2Y0SN 4CCKA 2OZ6A 2Z1DA 4II2A 1VQ8I 1BR2A 2QLZA 4X1EA 3HOTA 2VMRA 2QBYA 3OYMA 4ENNA 3FXJA 3N4MA 2OBPA 3TOAA 4BE1A 3S1QJ 5IYDJ 3TO9A 3S2DJ 3MZHA 3RKYA 2GXBA 1WHUA 2LOOA 1DDNA 3A2KA 1DGEA 1LK9A 1RV3A 3AEOA 5EIGA 4EM0B 2CQQA 4AVZA 3SJMA 1UJ8A 1SVOA 1MJ9A 2TCTA 2V9PA 1FC3A 2FD5A 4HAMA 4JYKA 3JTGA 2ZJRF 1IN4A 4EGZA 1RR7A 2KRHA 2B9SA 1CJ0A 2HOTA 4F5IA 4O6ZA 2EFNA 3FD0A 1WWXA 4L9JA 2CY8A 2FF4A 1O61A 2HYFA 1FPQA 2VGWA 3D1NI 3NYSA 3WGHA 3EI9A 2ECCA 4S04A 4Y15A 1R22A 3CCUI 4ZSWA 4A0RA 3F6OA 4V19K 1K83J 4GDYA 4AC0A 5IP7J 4HX4A 2B0LA 3K40A 5LHAA 3QPLA 2GLOA 1KL1A 2K3FA 2DMUA 1HXDA 3USFA 1D0YA 2VL8A 4P1WA 4IKFA 3CDHA 1EQBA 4E77A 3RBFA 2X8UA 1APLC 3E77A 2VMSA 1ZLJA 3I55I 5BPIA 3ZN1A 4QLCU 3H0GJ 3JRAA 2W8UA 2VXZA 2JJGA 1EKEA 3U21A 3JREA 4HA8A 4IQJA 1QVUA 2BW3B 3GLXA 3HGGA 5D8LB 5E5IA 4GDFA 4S05A 5D6FA 1OKRA 3A1YA 4QWQA 2YR2A 4IRGA 2QA3A 2HYGD 3B6AA 4GCVA 4CYCA 1AMAA 1ARSA 1M7YA 1TARA 4Q47A 3RCOA 4I2OA 4P9FA 2R0TA 2ZXHA 3FHZA 4LIUA 2OA4A 1SFFA 2WB1N 2OQRA 5J4YA 2ID3A 4W5KA 3P5JA 2PJPA 4MTDA 2CUFA 2RGVA 2WAEA 4UHNA 1Z7LA 2EINH 1J0RA 2WWYA 2DTZA 2VQLA 1RKTA 3BTCA 4G7OF 3KP2A 2JISA 4BUPA 5C6UA 1QO0D 5CPRB 2YHKA 3RJPA 1Q1HA 1IRFA 1Z77A 2E35A 2LLKA 5M5XJ 5E3KA 1TNTA 3CLQA 1B4AA 1V2EA 3WTWC 3PDXA 2D1VA 5ERIA 3NX3A 3EUCA 1JG8A 1T3IA 2DDAA 2MSYA 5E79C 4N0WA 3KYCB 5LGUA 1XMKA 2WA0A 2BEOA 3GTMJ 2ZXWH 1X2NA 2LRDA 3G6EI 3PSFA 2VT3A 2CJJA 1D5VA 3RQ4A 4HQMA 1XX5A 1BN5A 4PK4A 4RGXA 4XLNF 3SZTA 4BQOA 5TJJA 2YKYA 2KIUA 4IRHA 1IVRA 5LRSA 2TPLA 3ONQA 2R0QC 2E1CA 4B3AA 2JN6A 2CH2A 3FVXA 3CO7C 1LC5A 2FQ6A 1HLVA 3BR0A 2CFOA 2L7MP 4A0ZA 1R9TJ 2EJRA 3L2VA 4MEYF 4XONA 2Z99A 2QKMB 3CUQB 3JRIA 4RITA 5E3LA 3ABLH 1LE8B 3ISLA 4WYGA 1XSDA 4BKXA 4H4KC 4OIPF 1RVUA 1J04A 1OQYA 2Z16A 2ZBKA 3GTPJ 4HF8A 2BE5F 1X3ZB 5H20A 1O4XA 1B9IA 3DKXA 4OAYA 1FOYA 2OQGA 1I48A 5KHDA 3A03A 3EUAA 3MEBA 1Z0XA 3SEZA 4HX8A 5J47A 1RRJA 2JPBA 3E6MA 3JWBA 4P7YA 3WHBA 5GPCA 3AEJC 4CXRA 1H0MA 4H51A 2K02A 2ZUKA 3BWOA 5K7FA 2RFVA 1H9TA 2RC4A 3IAM2 3CP8A 3DODA 4NC7A 4FX4A 2DYRH 4PVFA 1SPAA 5FKOA 2CQNA 1O3TA 4M6VA 4NBQA 1F4KA 2JA7J 4TN4A 3ZQLA 3M3YJ 1B9HA 4UOYA 3I53A 1ZRDA 3FQ8A 5D5SA 4JK1X 1SAXA 5FFXA 1JKOC 2R93J 1IO2A 3L09A 2F5DA 4AYBA 3C2HA 3MAFB 3VOMA 4IEJA 3K4MA 1ZH5A 2HI3A 1TC3C 1YIZA 1ZRFA 2WY7Q 4OT8A 4UUVA 4WYFA 1TWFJ 1W5SA 3H7FA 4EJWA 4IHXA 1Y1VJ 4BDYA 1ELUA 2AY6A 3S32A 4XK4A 4WLJA 4XBFA 3PFIA 4M2MA 3ROUA 1N75A 4A6RA 1J75A 3AATA 4IZZA 2O7OA 4XR6A 4RM1A 2M45A 2V1DA 4CBSA 2D45A 2AATA 2F6CA 2HOYA 1G6NA 2NVTJ 1I5ZA 4CA0A 2AQEA 2EA2A 2O8XA 4E4HA 3NDNA 5E18F 2O61A 4L9NA 1WKMA 3FTBA 3KZYA 3F9TA 2OZUA 4XOTA 2YKXA 4A2UA 1B4XA 5DCMA 1SVVA 3H9QA 2DGMA 1W0TA 2CW8A 4CYDA 4W1UA 3WGBA 4ZWVA 3RCHA 3CP2A 4IF4A 2VGTA 3ABKH 1Y8RB 3BWNC 2Y2ZA 4IQ4A 1U5TA 2QSHX 4ZYHA 5DJ9A 1PP7U 1F5TA 3IH4A 1KU2A 4HRIA 1AAMA 2XF6A 1I3QJ 3AG1H 2HUFA 1UMQA 2ZCWA 5KK1A 1G7XA 2LY2A 4EJOA 3IL2A 1YIYA 1Y1WJ 1GXQA 2E7XA 4OOIA 3RQIA 3CCSI 1ZQ3P 2YRIA 2Z9WA 2YKUA 1T56A 2R7WA 1Z3XA 3HKZA 2HDWA 4M71A 1QNTA 1UG0A 2BHYA 1IUYA 3CQ5A 3PNVA 3UWCA 2O8KA 2HKOA 2ACJA 2JPCA 1VP4A 1ETXA 4D5FA 3QPTA 3DQVC 1ZAOA 3WTYC 1O62A 2Z9XA 1YW9A 1V55H 4DIQA 2PJRA 1YX3A 2IW5A 2GWRA 3EUHA 1B72A 5L3DA 3OYKA 3TEDA 3ISPA 4U2HA 4XAUA 1SANA 5LH9A 2ZC2A 4KIBA 2BI5A 2D61A 4C3HJ 4HLYA 2VOOA 3FDYA 3K4LA 2R4GA 4RGRA 1CF7B 4MQVA 4P96A 3HOXJ 2COMA 2LREA 1W0UA 2EH6A 1N25A 1W1WE 3E97A 2NMPA 2KPMA 2DA5A 2ZFWA 5CVVA 2VMNA 2V9KA 1FX7A 5L3GA 5G0AA 3I4JA 4ZYDA 1ORKA 5G2QA 1QITA 2E7JA 1AKBA 1BR1A 4B43A 1DJUA 3TATA 1XC5A 3P9KA 1Z1DA 4KYWA 2EIJH 1QIRA 4AYBN 2W25A 3AG3H 1SFUA 4NHJA 1IAYA 1YAAA 1B8IB 2W8VA 1TW3A 1XMXA 3QOPA 1FP1D 2QVOA 1K78A 1ZG3A 1RKWA 3BTLA 5E8GA 3FFHA 1E3PA 3KGWA 2HGCA 4KAMA 4JBAA 4U7BA 2EFOA 1D3YA 4AIJA 5FRMA 2FBIA 1D7RA 2JUCA 1ZGWA 3BT9A 2DDBA 2W00A 3ERMA 1X3UA 2VPRA 4IVNA 1O7FA 4AO9A 1GVDA 1A36A 4LNMA 2JJEA 4RGSA 2HOAA 2J5OA 2R5CB 3IRQA 4A72A 2MD5A 3KP6A 1JGGA 3N5MA 2JRMA 3EI8A 1IC8A 4PFNA 3GZ5A 5C3EJ 2F4IA 2CANA 1IV8A 1O3RA 3QN6A 4EMSA 3RPQA 2DR1A 3HRMA 3PAAA 2G0EA 3FMQA 3TGNA 5FLVA 1ETVA 5A2QZ 5K1YA 1CQ7A 1K6YA 2IA2A 4W91A 3WKSA 4FQGA 5CQGA 4BE0A 3WHCA 1S09A 2QMAA 2VJJA 1JHHA 2GOMA 4C3JJ 3GTGJ 1B59A 3HHGA 3E2ZB 1WYTA 5DV5A 1M0QA 3FSLA 2GA2A 4M3FA 5EUNA 1R71A 4K2BA 3K1PA 4RM3A 1S3JA 5FKNA 2XRLA 1IRGA 1AJRA 5FT8A 2DLLA 3KP3A 4HOBA 2BHXA 3DPUA 1QBJA 1ARIA 2LBFA 2EZIA 2RV8A 2GMSA 2OUMA 4DOZA 1SZUA 3F6TA 2D66A 1MAPA 1SF2A 3HKZN 5DYMA 1C4KA 1XSXA 3CAIA 3ASOH 4E7IA 1YJ9I 1AKHA 3RZOJ 1AX4A 2DA6A 5F0CA 2VMQA 3AEMC 5KAIC 4JEYA 3HUGB 3O6BB 4BU2A 5J40A 2L0KA 3IV5A 1GC3A 1V4RA 2R3SA 4HF1A 2R7DA 4B8XA 3CC2I 1FY7A 5EAVA 4LK1F 1N77A 3J7YJ 3TO6A 3A2BA 3FKDA 3LSRA 1W7PB 2R5ZA 4U88A 4IHSA 4F5FA 4F5GA 2P5VA 4LG3A 2YOBA 3K28A 3EYYA 2JJ7A 1P7IA 2PN6A 4MQRA 3ZPLA 4BMKA 2VJ5A 5CVJA 3IHUA 1W36C 2JVGA 1AJSB 2XPVA 1FYMA 2QCOA 1UU0A 2OTJI 1C0NA 4EEFG 3L9FA 3LFKA 2Y9ZA 2C0RA 2HQRA 3HSFA 3WY7A 4WXHA 4QGRA 1W5CC 1ONVA 1RVYA 3HC7A 2MH2A 1C7NA 4UB6C 3SFIA 3IHJA 3CCYA 2J5PA 3BG7A 3PA9A 2ESHA 4PDKA 5B1BH 2NNNA 2XAJA 3ZMVA 3DU5A 3IH3A 1YW8A 3OYEA 4XLHA 1UHMA 1BS0A 3OS1A 4P5OA 2YS9A 1JJ6C 1JI8A 2PB2A 4IY7A 4WWCA 5D5VB 2XAGA 3FK7A 1HDPA 4BY7J 3ASBA 2VT2A 3T5XA 4JEZA 2VI6A 1T08B 4HNUA 5KAFC 2VI8A 1UFMA 2CMPA 2KFDA 3OS0A 3JSPA 3R6SA 3ZMZA 3S2WA 4W1WA 1LKXA 1OYYA 2R7ZJ 3IKVA 5FO5A 2A5WA 5IT9Z 3VEPA 2MYSA 3AENB 2DKJA 2FSWA 2UUZA 1KQ9A 2NOGA 5FLXZ 2VMYA 3K10A 1J09A 2XC7A 1WYUA 4FE4A 1D8KA 4CSWA 5LBQA 1T0FC 4N9HA 3UAKA 4PGGA 5ICFA 2ISZA 3A01B 1N2TA 1RETA 3VB2A 4UUSA 3WU1B 1ODDA 1WGXA 1ASBA 1T33A 1XCVA 1LDJA 3SDGA 4YG2F 3NEUA 2VKEA 2VUMJ 1BJOA 1TBXA 3WKRA 4GEBA 1S7AA 1TWGJ 1X3WB 2RQQA 2GM4A 3E6GA 5EAAA 8AATA 2VOPA 1SEUA 3Q0WA 1YTYA 1GEYA 1Y4IA 2FNUA 5J4VA 4RIZA 3LAPA 5JLWA 4YIRX 1ZLKA 1X1DA 2K9NA 1AWCA 2V4JC 3FMSA 2L7FP 3Q0UA 5C44J 3UKGA 4AM3A 3GZCA 1X1BA 4CVQA 4H0EA 1PMOA 1Z6TA 1X1PA 5EEGA 4L5IA 3NRAA 4JE5A 1DFOA 3QRFF 2V79A 2HFHA 3KYLA 2W7FA 2YPRA 2NS7A 3R60A 4LG0A 3TQNA 2HKXA 3OR1C 5CLSA 2VIAA 4LK0F 2GAUA 3HHHA 4MGRA 2HVSA 2KP6A 3A0BC 4WXDA 3VYRB 5J1YA 4IOAF 3DPLC 2E54A 4LC3A 1Z6RA 1O7LA 2A5YB 1TP4A 1U8RA 3B1DA 4EJVA 3BR6A 4HDVA 1MLYA 3CF5F 2IS4A 2DT5A 4XICA 3AELA 4ZAHA 3HEFA 3OV8A 1YFHA 2EV5A 1MDMB 4WP0A 4ESBA 2A6TA 4PJMA 3H5NA 2JWTA 2P4WA 3D0SA 4GGGA 4WF2A 2XKPA 3W3CA 1QJ5A 3DXWA 1U6GA 2L3DA 2EIMH 2DK5A 4UVBA 1TOEA 3QM2A 1BM9A 3K4CA 1LEAA 4GFBA 1MBGA 3CJNA 3LSTA 1AKCA 3MQ0A 1GT0C 1XTAA 2E1NA 5LEJA 2CH0A 1U0JA 4G6TB 3DFGA 2O7CA 2XKOA 4BXFA 1CGPA 1S6LA 1BOAA 3WGGA 1TWAJ 5DM7F 3GFLA 4HBLA 1IJWC 1S07A 3CCJI 4EVIA 3TOBA 1P3WA 2V0YA 3AEJA 1SZKA 2W8JA 1HKSA 1ZTRA 3PD6A 4E3RA 2VIXA 1E5EA 4J5UA 1WFXA 2CJGA 1IN7A 2M30A 3HOUJ 3E3VA 3I64A 1JKPC 1WYVB 4Q48A 2Z61A 3VODA 1F9NA 3GFIA 3CO6C 3M9AA 1I6HJ 4MLOA 3H5AA 2CW7A 3QI6A 2K3PA 2KRFA 1UKJA 1X58A 3K4BA 2WAQA 5HHYA 1BBYA 2DJIA 5FROA 3JRHA 1WKHA 1MNEA 1RNLA 2PQ8A 2XF5A 2BYLA 1IXSB 1U2WA 1LFPA 4IXOA 1XSVA 2QQ9A 4ZWMA 4F5HA 4E3QA 2BVLA 2H27A 3DBHB 1CL1A 3LY1A 5JAYA 2MFZA 3CF2A 4N4OB 4NB5A 5DD4A 1D0ZA 2DFEA 4UXNA 3GW2A 4B1RA 1U8BA 4MIMA 2V6CA 3CJQB 4MQQA 2O3FA 2WC2A 4G7ZF 3RIRA 4DW6A 1BQAA 3C18A 2D64A 4RB2C 4QTRA 2WKAA 4WXGA 4WYCA 4CICA 3BG6A 2O5RA 1FWZA 4ZZLA 5GTIC 3T32A 3KKIA 4LB5A 1PUEE 3GWZA 2MLKA 3DTKA 5K7ZA 3HOVJ 3TQXA 1AAWA 3BWNA 3T0YA 4GE7A 2MC4A 5FKKA 3J81K 2L4MA 2GSAA 3F8FA 4CGZA 3W6JB 4CZCA 4XKVA 1RIOH 5CJ9A 2LSOA 2MGQA 3ECHA 3PDBA 1YJSA 3NARA 1U9OA 3K70C 1IF1A 1Y0UA 5J8CA 3L2CA 3FX3A 5HODA 2R5YA 1AA7A 3ULQB 5GADJ 4AH3A 1WPKA 4AIKA 4RAFA 2EPFA 2CV1A 1RI7A 3SEQA 1BJWA 1LFBA 2Y69H 3V8KA 2NVQJ 3CQ4A 5D4RA 2EV6A 1TOKA 2PX9A 4HEA2 5EG0B 1P9QC 1OCTC 2VXDA 2KKOA 1DJEA 5FKLA 2KQRA 3NWSA 4KA4A 4ADCA 3MC6C 3PSIA 3RPUA 2V7FA 1WRJA 2R7RA 4E7KA 4D1QA 3G71I 5H2FC 1HCRA 1TQPA 2M3AA 3MEXA 4HNVA 4XL9A 3LVMA 3K4NA 1RESA 4KNYA 3LSKA 1MBEA 1IG7A 3LWSA 1R58A 3M8FA 2EK5A 3IP4B 2CTZA 3PNTA 3VSLA 5ILSA 3BQYA 1BW5A 5DCFA 1V54H 1LNWA 2WADA 5EEAA 3H0DA 3CMYA 1J59A 1D2FA 1YJYA 1JT6A 2OATA 2W48A 4QSHA 1BW0A 4XKWA 2HYJA 2V6EA 1ETKA 2AY4A 2AY5A 1OXOA 1XN7A 3GTJJ 3AL0C 1D7SA 3HRTA 3O8GA 3A0HC 1D7UA 4B47A 1JT0A 2KIFA 2LF7A 5CQEA 1ZR4A 2PB0A 1PFFA 2IP2A 2LP0A 3CCQI 3Q9VA 1IAWA 1KKPA 3CC4I 1R36A 4GXOA 2F8JA 3N75A 2WAQN 2K7LA 1ECXA 4IHYA 3RSNA 3BJ6A 4HX7A 1STZA 3H3VK 4IPAA 2COBA 4NQWB 1D8JA 1YS6A 4R79A 1AY8A 3B02A 2P8TA 2ELHA 2BIEA 1PUFB 2LVSA 3OL3A 2BW3A 3BC8A 1ACIA 3ZQHA 4KXKA 5BS6A 2RQPA 3CC7I 1ASEA 5JHFA 4XRSG 5F9SA 1SD4A 5FD6A 4R1HA 3BOQA 1BJZA 2PEXA 3AKZA 1U3EM 3GR9A 4PJLA 3RPUD 4HVKA 2M4KA 2C6YA 2E7UA 1J7KA 4M3EA 1M32A 2DYSH 2FBHA 2ZMEC 2HS5A 1UG2A 2K4BA 1FOKA 1BT4A 1X1AA 4KFCA 3HPHA 4N0BA 2A3SA 2NNYA 1J32A 3I59A 4K2MA 3NRVA 3KFWX 2Y9YA 4GRIA 3DKWA 3EI6A 1FBSA 1FOXA 3S17J 1ASLA 3KLNA 4WCGA 2QYOA 3LQRA 3MAUA 2FEZA 3QPHA 1A6IA 1ULYA 2CUEA 2XGEA 1E5FA 3I5TA 1N8PA 2VN2A 5M5WJ 1KU3A 4RJYA 3QP5A 1BC8C 5G09A 5KVRA 2D7YA 4B98A 2XHKA 2ADUA 4WBTA 4DYRA 5H6RA 4D7MA 3FHNA 1F1ZA 4M6YA 5HLIA 4L0ZB 2M5WA 3BZKA 3FXKA 2FOKA 4LIVA 3JRBA 3AEMA 1SFXA 2W7GA 5J8QA 2OD5A 3U1DA 2BV6A 3Q3SA 1WCMJ 1T39A 5FFZA 1EH7A 3J80K 4HDUA 3QOEA 5F1JA 1KL2A 3BDDA 2FM1A 2HZPA 4BDZA 1JUMA 3H3ZA 3ELKA 1IUFA 3E5XA 2H8WA 1ZN2A 4M3DA 3MKLA 4IJAA 4CZZA 4BXXJ 4M2KA 1LPQA 5D4SA 1E2XA 2DGKA 1LKCA 2K85A 3LNQA 1DGRM 4K2EA 2CQ7A 4L5JA 1YJWI 1IDZA 1SD5A 2L9VA 2QQBA 4BH9A 3A9ZA 2ZSIB 1MLZA 2AXLA 1GCKA 1TT0A 1JHFA 1KQ0A 4UVAA 3PO2J 2Y75A 2VLHA 4IXSA 4O6JA 3S15J 3MBBA 4ENKA 2VMXA 4HZFA 3CUOA 3TW7A 1B5OA 5IPAA 3CDIA 1NHAA 1YOOA 5EIGB 2HUIA 3FXUA 2JA6J 1IXRC 1VNDA 3J80Z 2H94A 2R7XA 5FT6A 5E1XA 3HOZJ 4BEHA 3FVUA 4F7ZA 4OIQF 1MDOA 3MAFA 4R8DA 1ASFA 3BJAA 1V5GA 3JW9A 1T8IA 2JJFA 5HNFA 4ZSYA 5IWQA 4M72A 3BY6A 2Z1YA 1JKRC 3IUOA 3W1HA 2FU4A 1CQ8A 1WJFA 4B09A 1XGNA 3M5UA 1B5PA 1JUPA 1DUXC 2KDZA 4EJTA 2JMWA 4RLFA 4XJPA 1BW6A 2JVHA 1DKAA 4MKJA 3LSMA 2M7AA 2HXIA 4UUTA 1MBJA 5CVIA 1M0OA 2BIGA 2LNBA 3FKIJ 3BWGA 1V2DA 1A6QA 4CUGA 1MGVA 2X0LA 1E0EA 3PIOF 2D1HA 3FXLA 4B44A 4CCLA 1T0FA 1P4XA 3GFMA 2FJ1A 2QWWA 3ERED 3PO3J 1S08A 1WKGA 3ASAA 4M2JA 4LOCA 3ABTA 4F5MA 1M4NA 2IS6A 3TFUA 2ZO4A 1NK2P 1EJ9A 2FQ3A 2ZSLA 5EDNA 4FL0A 2KIQA 1G3YA 1WJCA 4CCOA 5F08A 2STTA 3S1MJ 3TMOA 3BTIA 2VODA 2IGMA 3OMYA 3TDZC 1W36D 2K4JA 2BWPA 5DX5A 1YRNA 4XLCA 3P9IA 2ID6A 4Y33A 1MH3A 3ASNH 4BJ6C 5IOYA 1T6SA 3SQNA 2XAFA 4I98B 1MBFA 2KJBA 4LFUA 3VPRA 1LQ1A 1KYWA 1IX8A 3W2AA 1I1GA 4JP0A 3UE8A 4HNTA 4A3EJ 2B63J 3S14J 1XDUA 3VFZA 3VYUB 3GZDC 3E6BA 5LHGA 5LEKA 2DAOA 1AHXA 5G4IA 2LY9A 1HKTA 1CQ6A 5CKTA 1AMSA 3BPVA 3KEYA 3TP3A 1Z91A 1GXPA 2PG4A 1JF9A 3G8MA 2V1NA 1FLIA 5EUEA 4RMNA 3I4PA 3WG7H 1XGSA 3ECOA 3CTAA 1S72I 4L9VA 2JJHA 5EGOA 1IRZA 1M0PA 2DT6A 1GBNA 1BIAA 4RLGA 3EYIA 1UU2A 4DGTA 1LDKB 2XAUA 1HSJA 3LAJA 4EJUA 3NTJA 1SD6A 2F4OB 1X2AA 3FDBA 4DGWB 5CVRA 2UXNA 4XK1A 5F0HA 4MSOA 4EM1A 2HZTA 3L2WA 1D7VA 4A5MA 1RC9A 1KU7A 3VYSB 2JGTA 5D5XB 2E60A 3A02A 5B5EC 2HDDA 2EBIA 3Q0VA 1P2FA 3R4TA 3GBGA 1H88C 1RZ4A 2QSFX 3FIWA 4G94A 3P6KA 2VQGA 3LSHA 1UHSA 3RDIA 3MCZA 1A35A 1YNUA 2ZC0A 5DTDA 1MMAA 1FTTA 5HLGA 2LDUA 2BGCA 5IT3A 4AO4A 5EQCA 5LD2C 1W7NA 1P4AA 3KIOA 3GLLA 5FJ8J 1AY5A 2BOLA 3ELEA 4C3IJ 1MSFC 1TTYA 2CU7A 2IJLA 2JK3A 1DGDA 3G0TA 1MJAA 2OU2A 3E0JB 2DW4A 2WK8A 3F21A 5DB5A 1IDYA 2W7EA 5F64A 1OCPA 2W7MA 3TKYA 1HOMA 1TQIA 5D8KB 3FK6A 4WX9A 1F36A 2E1MB 3VWBA 3NAUA 3HOYJ 1TOJA 3FVSA 2K9MA 1ARHA 4EMYA 3KLOA 4CCMA 3L00A 4RB3C 1U9NA 1XB4A 3NQOA 4XOPA 2DQLA 5C4XJ 4WXFA 4HSRA 3AV7A 1MJBA 1OR7C 4OMYA 4RAGA 2P7CB 1H1CA 1MD0A 2QKLB 3LSPA 1YW7A 3BQZA 4UQVA 4A3JJ 1DP7P 3DEWA 1ZGJA 3ZR8X 1TOIA 2Z67A 2F5EA 4G8XA 2DCEA 2NVUB 2MG4A 4I8AA 3PL8A 2ZKZA 1P7JA 3H1CA 1QRYA 4DBQA 3O3KA 1M6SA 4P3MA 3V8JA 1QU3A 3BJOA 1IGNA 3KCCA 1TL8A 1Z67A 3WU0A 4ATPA 3QP6A 3S3MA 3DXJF 2F5FA 2ORDA 1H9GA 2CUZA 3K4JA 2HWVA 3J7ZI 1MH4A 4YIIA 4IX8A 2A6EF 1KU9A 5E8IA 1R7JA 4HPQA 3SZPA 5A2QK 1CQTA 3I56I 4B4CA 2C44A 4Q5SF 1W7MA 5DCMB 1NG7A 5E1ZB 3OYNA 3C2BA 3FXMA 2W7JA 4RAYA 4RGUA 4DYCA 1S9HA 4I76A 2EB7A 2TDXA 4EGYA 2R7OA 4G7HF 3KP4A 3RCHB 1AOYA 2BYJA 2NAZA 3SHFA 2EH3A 2BY0A 2G7HA 1LUJB 2X6WA 3OYIA 3HBXA 5TF5A 2XGCA 2HORA 1U5TB 5JI6A 2XUBA 1KONA 2ME0A 3IC7A 3FZ7A 3W1IA 3EIBA 3WLXA 3L2RA 5K7HA 4A0HA 3LVKA 1GC2A 2AS5F 1V5EA 5LLQA 5K5QA 4ISYA 3V8LA 1YIOA 1MIJA 2R92J 4OAZA 1VQNI 1WJ5A 2GIVA 3U1KA 2EPJA 1GEXA 2VMPA 3JW4A 5BPDA 1NG6A 1W3UA 3QYEA 2XB0X 3ZRPA 2JA5J 4GYIA 2RNJA 2DFFA 5J1UA 4A3KJ 5FRNA 1GDEA 1F43A 4XSZF 2PBIA 4BHPA 3L44A 3DLAA 3MC6A 2EFPA 3IAS2 3HQTA 1OYWA 3ML6A 3IWFA 3ZMSA 2YCNA 1NH3A 3MADA 3S16J 1TT5B 3M7GA 3KX2A 4E7LA 2PJRB 3CMEI 1B72B 2HXOA 2E5NA 3I16A 3TFTA 1ASGA 3JZLA 3F72A 4HV5A 1IX6A 5ICCA 4Y52J 2EWNA 4W97A 2PI0A 4QPQA 1EJIA 4C2UA 1SFOJ 2V1XA 2KDOA 4BHDA 3FKJA 3K7AJ 2EZ1A 2K27A 3H5RA 4ANJA 3ZN0A 4XRMA 5TRDA 3L8AA 3CD6I 2AHQA 1QHGA 2GXGA 3MKWB 2XSJC 5FD5A 4IHWA 2UWMA 2AEVA 4U87A 2CUJA 2IS2A 2QB2A 3WODF 5M4DA 4FASD 2FN6A 4D9JA 3W1JA 1EA3A 2K9LA 2QZ8A 3Q5FA 1FEXA 4XLFA 4BBRJ 1Q1VA 3WGCA 4JX4A 5B66C 5ICGA 5DM6F 2L9NA 1CL2A 2WV0A 3BCAA 2W7NA 1OATA 4M6XA 1BL0A 4MY5A 1K78B 3CUQC 4KISA 5AIPA 2P0WA 3K70D 1RR8C 3SDBA 2NXNB 4JX6A 3HDDA 1G4XA 1GEWA 4XJOA 5DJ1A 2AEUA 1GC4A 2DOFA 4N9IA 4MEXF 3RKXA 2DOUA 4BA4A 1BQDA 3DXVA 3LA3A 2YU3A 4PUSA 3QPGA 3WG9A 1WSUA 4WB0B 2CRGA 2JT1A 2RVCA 1W7PD 2LTPA 5FLXK 4NUBA 3BZ6A 4MQPA 1YO5C 3K7YA 3BB8A 1ON1A 1ZARA 2Y0MA 4XJLA 5FB2A 3QU3A 3I54A 2W4SA 1ERDA 2LFBA 2Y31A 1MDXA 2P6TA 5AX8A 2CFXA 1R49A 2ZMEA 2HPMA 5F27A 5G2PA 4EM2A 2W8WA 2AO9A 2ICWG 4MQ9F 3HSEA 3G4SI 2YKVA 2VMOA 1V5FA 4ITVA 3HBLA 2IA0A 2DPDA 4U1TA 2HQ5A 2GZWA 2JZYA 2ELKA 3FBIB 3RYRA 3BLYA 3MAJA 3D5SC 3F6VA 3GUDA 2QENA 4G6QA 2HP2A 1QVTA 1WYTB 4A3IJ 1WJEA 4IYOA 1J5YA 4XRSA 5DUKA 4E6KG 1FTZA 2KHMA 1OHYA 1BIBA 3FXOA 2LBFB 4GRXA 2FOWA 2IT0A 2WTEA 3WTSC 2ECBA 3W6VA 2AQFA 5EZGA 4C2MJ 5FKMA 5IYBJ 1WH7A 3V4GA 4MO7A 1G4DA 4Y0DA 4RB1A 4A0GA 1UELB 3OOUA 5JLXA 3ZMTA 3GF2A 2ZJQF 1AKHB 1RUNA 2BXYA 1OYIA 3K2ZA 3MVPA 4I0AA 3OY9A 3ZQFA 4CXQA 3OL4A 1VQLI 2PMUA 2W82A 2BY3A 4UV8A 2XSDC 2DI3A 4NNJA 3GZ6A 1MMGA 3H9JA 2DA4A 2MH9A 2DA7A 2VQCA 5D95A 2F5VA 4BJ5C 1XEYA 5LFAA 2E7IA 1O3SA 2QA4I 3BS8A 4XN3A 1MW7A 3OIQA 4DZPA 4ZM3A 1A5JA 1GC0A 2ZNYA 3ABUA 4MFDA 2DO7A 3U2RA 3L7WA 4BQQA 3G73A 3T1BA 5HLHA 3S1RJ 1MDZA 1VZ0A 3FBNB 1B1BA 3I4MJ 3U9GA 3ZMUA 4F92B 2VMZA 3VAXA 1AMQA 1EH6A 1BKGA 2D7ZA 4BHBA 1RV4A 3VYTB 2VYCA 3GYHX 1LC8A 3KGXA 3ZRQA 3NUIA 3ZQQA 3BG3A 2PO3A 1ARGA 4OBUA 1DTYA 3Q8NA 5E1WA 5J3LA 1Y0NA 2OTLI 2ZP7A 5GTHC 3HJEA 4YRVA 3EIAA 4RDUA 3FZ6A 2R7SA 3HYIA 3OYAA 2BY2A 4OIRF 3QODA 4WLHA 4A3FJ 3FQ7A 4YIFA 3R4KA 4E70A 1TOGA 1UU1A 3ZP5A 1VJOA 4X0GA 1C9CA 4AD9A 1PG8A 4XJMA 1R5ID 4MKKA 4DQ6A 1QZ9A 3ABMH 1YOVB 3TCMA 3GFJA 1G8XA 1ENHA 4JQFA 1XGOA 2K5CA 2DOAA 3TBIA 4BHCA 1YJZA 4ADBA 3OYGA 1U78A 4R5FA 3ZXSA 3RI6A 4LLGF 1WSTA 2QSGX 3BV0A 2JSPA 1WYUB 4JF1A 4AVPA 4R2NA 4EV0A 2Q0OA 2Q2EA 3CMMA 3R0AA 4Q75A 4A6UA 4XMYA 4A5NA 2X5FA 2DMTA 3H3UA 1TPLA 2L7ZA 3KP5A 2CQXA 2KISA 3QGUA 3WZFA 4ITGA 5EFSA 2R7UA 4RAEA 2CO5A 2X1EA 2G6WA 1SZSA 3F8CA 4DZJA 2AY1A 1K6OA 5I92A 1BJOB 1ASMA 1YI2I 3F9KA 2RN7A 3HPGA 2BWOA 1YG2A 2W85A 2OV7A 5FGMA 2AY9A 4YFKF 2R7VA 2FX0A 5HS8A 4OMZA 1S8NA 1LJ9A 5J6XA 3JR9A 1BI2A 4ABZA 4O3MA 1AY4A 3SZGA 2M8EA 2D63A 2AY7A 3WE3A 3GZDA 1ASCA 1BJAA 2IAIA 2ISYA 2X1DA 2CS3A 4IOCF 3HRSA 1KYZA 3W6KB 4UY8I 4Z2YA 2CJDA 5ILVA 4ZH4F 4UHOA 1FMWA 3VSKA 1WJDA 3LVJA 2HP1A 2BYVE 2IBDA 1PVEA 3LQQA 4LG0B 3IWZA 1YIJI 3M1EA 1G59A 4EB7A 1QISA 5GPAA 3H92A 1MKMA 3MMYB 4PJNA 4ZC3A 4D5CA 4ATQA 2KIMA 3SXYA 1AHEA 2ZFUA 3HB9A 1T38A 1E3OC 3KEQA 4I02A 3DYDA 4IXZA 3ZRRA 1VQ4I 2R5EA 3EUHC 1R4MB 3V42A 2TRTA 1LS3A 2W57A 4OTLA 3I9V2 5HDMA 3HZJA 4ENJA 1NK3P 2V1UA 4A00A 2A05A 2OCCH 3B1CA 3E2YA 4LLNA 1X4OA 1M0NA 3NNKA 1MMNA 2E1OA 2WAFA 1AICA 3II0A 3ZQGA 4F5LA 1KZHA 5HVQC 1I3AA 2EIKH 3HGYA 1LFUP 4G6DA 2PMHA 2N8GA 4BE2A 1JUSA 2EZKA 1Z05A 1MMDA 2DQRA 1K79A 2BI1A 2X51A 4DQ2A 2X9DA 1FBUA 2JQ7A 4F5KA 4E7HA 5IP6A 1AIBA 2VBZA 3GZNB 1SVLA 4OU0A 2QUFA 1YLFA 4OINF 4BACA 2QB3A 2D5VA 2JA8J 4F5JA 2D5YA 4NOGA 3PUFA 1PMMA 3IF2A 3PD6B 3M8EA 3ACZA 5GAGJ 4A0YA 4U7DA 2HPIA 3PFYA 2HVQA 2I5UA 1WJBA 2UV1A 4AIHA 1J9IA 5E4ZA 5IYCJ 2GA1A 4CO8A 4BJTA 1W7LA 3BR1A 3K9TA 2VC1A 2VGUA 2MABA 2EV0A 1PJRA 3TP0A 3RUYA 2VMVA 4RA2A 1OR7A 3NWTA 4Q6RA 2HTJA 3WCNA 2FXAA 2X85A 4M9SA 4UHMA 1IRXA 1YITI 1V2FA 4ZZDA 1X29A 2GOXB 5BOXA 1PDNC 1AHDP 2ZNZA 1ZYRF 4FX0A 1I43A 1GDTA 2BBYA 2NVYJ 1LC7A 2I10A 1MBHA 3HSRA 3I71A 4ADDA 2DMNA 2VKDA 5J8FA 2W7KA 4WD2A 1BI0A 3HOWJ 1YX5A 3RI4A 2HEOA 3OIOA 4CHUA 1FG7A 2MLGA 4O5VA 3OYFA 2VLFA 1MMSA 2HU9A 3K1NA 1XG1A 3BPXA 5HDKA 3PIUA 2XPUA 1HDDC 1VQMI 5D6EA 4AUXA 1GLNA 3JAMK 1KMKA 2FYFA 4OWRB 3GXOA 3OKSA 3WTZA 2P5LC 5FLMJ 5EUDA 4XLEA 4EATA 5FT5A 2OKKA 5K8BA 5G4JA 5K5OA 3CCVI 2NVXJ 1OJLA 1R1VA 2LG4A 4ASNA 3PDBB 4CXFA 5HLTA 2HVRA 1P4WA 3ZRGA 3T8TA 2QLRA 4XSXF 4L0OA 1ETYA 1GV2A 2O0YA 2M8GX 2W7IA 1Z21A 3AFHA 2R5YB 3HVYA 3GTKJ 2OC6A 2OAZA 4BQAA 4NDLA 4PFPA 1G3SA 2BHZA 4YFXF 1KKJA 2E34A 2RKHA 5KNLA 2M4GA 3LOCA 4HSTA 2LKXA 2AY8A 1IXCA 4A3MJ 3PJ0A 1UB9A 1CZEA 1FOWA 4IXAA 3QAHA 1SC7A 3HDOA 2HNHA 3DWLE 4A6EA 5HDGA 3RQ1A 3JAMZ 4B3XA 1OHWA 3FMRA 1R5GA 4ESFA 4A3DJ 2QQ8A 3P9CA 3EPZA 4Y0HA 2OKJA 1QA6A 4EFFA 5CVUA 3DTIA 1K4SA 1USSA 2XAQA 2IA1A 3I4NJ 3BROA 1DGWY 3K1MA 1LW5A 1I27A 4F52A 4LW2A 4AWXB 3FXRA 4U0YA 2CSTA 3LA7A 5LRRA 3PIPF 1IX7A 4FCYA 1T95A 3JRGA 3JRCA 3QYBA 3CJTB 2AY3A 2ZJGA 2L02A 3NYTA 3OR2C 1G4VA 1YYVA 4AZJA 1IAXA 2M0MA 3EZ1A 1OCRH 3LG0A 1WJAA 1KGSA 4L0YB 3LL7A 2MC3A 2X6YA 4A6TA 3JCUC 1OMIA 2BWNA 1ETWA 2DT7B 1SMYF 2VBYA 3E2FA 4XORA 5M46A 3QYFA 2ME6A 5JHUA 3K2AA 5JR3A 3CUQA 2W7HA 2ZJPF 4L18B 1LE8A 4C9YA 1IJIA 4IW7A 2IEKA 4KITB 3G1LA 3UNGC 2Z9VA 4IX7A 1D1CA 3HLMA 2A61A 4I6ZA 1BA5A 2F5CA 2JTVA 2HQNA 4ZTFA 1R5HA 4KT5C 4BQ0A 5M4BA 3F8MA 4J01A 2DODA 2ZXJA 3PM1A 4ZYAA 3EDPA 2NRAC 2FNPA 5BNGA 2DKBA 2MA3A 2LC2A 1OPCA 2QBYB 2FMYA 1Y8QB 4LGWA 4I7HA 4XRFA 4DBCA 1VQOI 3BR5A 4OC9A 2FMLA 3E1SA 5GAEJ 1DU6A 4YFNF 4A93J 4HLXA 1UCRA 2JSCA 1MNDA 4CCNA 1R00A 2R7TA 2NOJB 2EO5A 3R61A 3NUBA 3WX9A 1DP3A 2D65A 4LNLA 3LSJA 3WE2A 2KRCA 3WTXC 1AIAA 3GCMA 3P1TA 3CLOA 2YCTA 2E36A 2M1BA 4Y17A 1AHFA 1B8GA 3DLLF 3I59B 2OQXA 3G1MA 5GP9A 1YJNI 2QQAA 4IHVA 2AY2A 3FQAA 5E3NA 3E5UA 3VOEA 3LA2A 2F48A 2RNGA 3BG5A 1LEBA 4N4NB 2LR8A 3LSIA 2WV1A 1QZZA 3LFUA 4KDPA 2L5QA 1U08A 4LNJA 4PCQA 1W5TA 4PJJA 3ZOBA 3K69A 5E3MA 6PAXA 4LJZF 4QPOA 2ELJA 1HQCA 4M3BA 4Y0IA 2VI9A 1QHHD 5L3CA 4A12A 2Y30A 2RAEA 2X4HA 4Q4ZF 2VBWA 3KE3A 4S0HB 4WYAA 4XM3A 2OCEA 4HW0A 1R23A 1ZG1A 3FFRA 4D7NA 5EEHA 5LGNA 4Z6YA 2Z9OA 3KPHA 3CDLA 1ZG5A 2M9HA 1ETQA 2ZYJA 2F4MB 1BJNA 3OWTA 4FTHA 2AXTC 1IW7F 3JTXA 1MAQA 2UXXA 3DC1A 2HUUA 4CYCB 1O69A 3N0LA 3HT4A 3I58A 3K0LA 4LW4A 1QPIA 4YEJA 4BQNA 3RBLA 2OGEA 4KICA 1SAUA 3GTLJ 5H6QA 3HMUA 2Z3YA 4M73A 4BA5A 2W24A 5KCMA 3JRFA 3VP6A 3UR3C 1N78A 1G7WA 3GTOJ 3CMAI 2KLOA 4EU1A 2VJ4A 1XCBA 1ELQA 4ZYEA 2YX4A 2H09A 3M8JA 4J8LA 3I5UA 1VQKI 2E5ZA 1VTNC 4WXBA 2VGSA 2XB5A 3DP7A 1W23A 3F23A 4XN0A 3JSOA 1XGMA 3SYTA 3G3ZA 4Y7NJ 3I3LA 5JFRA 3ZGKA 3GX4X 5FT4A 3P7NA 2XF7A 1OISA 3G2BA 4BEHB 1POGA 1ZOBA 1R6RA 3R9AA 1X0MA 3EUKL 2VPLA 1X19A 1VQ7I 4I09A 2HR3A 1I29A 3B46A 1X4PA 4ZJZA 1H0CA 1SVMA 2VGVA 1QGNA 4DYQA 4ZTJA 1CF7A 2VKHA 5ICEA 5IY5H 2RDPA 2C7TA 3DF8A 1UZCA 3MKYB 2L9SA 3HM5A 2I8DA 1K7AA 2EGYA 3MKZA 1BOBA 3MKJA
chains in the Genus database with same