4N0BA

Crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
473
structure length
468
Chain Sequence
ITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKETGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription activator
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 133
structure length 468
sequence length 473
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n0bA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0bA02
3MAFA 1G6NA 5ILSA 3F8FA 1ZRCA 2HP2A 3N0LA 5HOOA 1UHWA 1ZAOA 4ZWMA 1DUXC 1MDXA 2QMAA 3J81K 2HDCA 2OQRA 4ZWVA 2ZBKA 4CXQA 2IP2A 5DCMA 4KIBA 4S04A 4Q47A 2F5FA 1OHYA 5E17F 1PUEE 2PN6A 2HOEA 4LB6B 1F1ZA 2F2EA 2FMLA 3GFMA 2WK7A 3E2ZB 2VGZA 4M71A 2EV0A 5ICEA 2D66A 2NAZA 2QQBA 3PGYA 3ULQB 3R9AA 3EDPA 3FWEA 5M46A 3H7FA 2VOPA 2RDPA 1YIZA 3E5XA 1R1VA 3G8MA 3D0SA 1LDKB 4BHCA 1RVYA 1YYVA 2W57A 4W91A 4HW0A 4BHDA 1MDMA 3FM5A 1BT4A 1GCKA 1S06A 2VGTA 2HQNA 2KIFA 4WF2A 3TOAA 2D63A 1C0WA 5JVTA 1N2TA 2DKBA 2FM1A 4UOYA 1H0CA 4OINF 1OHWA 1HXDA 1G3TA 2A61A 1E17A 3KKIA 2C0RA 2VMXA 2FBHA 3AENA 3DRDA 4RB2C 2ESHA 1CGPA 3A9YA 4GDYA 1XSDA 2FA5A 1MAQA 1V2DA 2D45A 1QZYA 2MA3A 1SD5A 3LQRA 1IJIA 3NYSA 4PIWA 2IA0A 1M0OA 2CGPA 1FYMA 3IC7A 3QGUA 2OZUA 3WLXA 1ONVA 1B9MA 4Q4ZF 2WWYA 1WWXA 4QGRA 1KYWA 3JWBA 3WTZA 4DNCA 1O4SA 1LK9A 1XMAA 1OATA 2XASA 2DK8A 1QISA 5DUIA 2VC0A 4L5JA 2BKWA 2IVMA 5EAVA 1JF9A 4ZYDA 3TO9A 1Z91A 4HDUA 2VODA 3JWAA 4MQPA 4A6TA 3RI4A 1L0OC 2JJGA 1CQ6A 1J75A 4O5VA 1C4KA 4F5FA 4YFKF 3WTVC 1G7XA 1SZSA 3NX3A 2ZO4A 1IX6A 3E6BA 4EJOA 2W7JA 1K7AA 1J2XA 2GA2A 1WYVB 2EFNA 3J81Z 2XAJA 3ATHA 4IYOB 1TQPA 1F9NA 2PQ8A 1HW1A 3KLOA 3E6CC 3VOEA 4FL0A 2JG2A 3RDIA 5DYMA 3BWGA 1R22A 3HRMA 4RM1A 4XAUA 1B1BA 2CSTA 2HR3A 3BB8A 2UZKA 2DO7A 3QPGA 1LW4A 2DBBA 2BI2A 2X4HA 5A2QZ 3BC8A 1TOJA 4JBAA 2QWWA 3T32A 1MLYA 3LVKA 2OA4A 4MQQA 4I02A 3K1NA 3VODA 3FHZA 3JTXA 1IW7F 1DDNA 3HUGA 1V72A 3GUDA 3J7AO 4B98A 3DYDA 4F5JA 5DV5A 4ENMA 3C7JA 1J7KA 3JW4A 2X5FA 2ISYA 3D5LA 2C6YA 2GZWA 3U9GA 3BN1A 5E1ZB 1HQCA 3E9KA 2V1PA 2YHKA 3UE8A 1OPCA 4P5OA 4GEBA 4KAMA 4BHPA 3C1DA 1YJSA 3WTTC 2BGCA 2LSOA 2G6WA 3VAXA 2D61A 2YRRA 4U1TA 1S3JA 5G0AA 3LA7A 1V3FA 4PFNA 5EUDA 3BCXA 2W25A 2UWMA 1Q1HA 1GC4A 1ARTA 3GEZA 1AHFA 1RV4A 2K7LA 2HUIA 2KKOA 1YG2A 2FBKA 2JJFA 3IKVA 4ADDA 3I59B 3E2FA 2XUBA 3E3VA 4DQ2A 4AO4A 2BIEA 2EK5A 1NHAA 2YU3A 3PD6A 3GR9A 5L3DA 1KA8A 2JISA 3GVAA 2YX4A 3F6OA 2HQRA 2YKUA 4ITGA 3R61A 1X29A 2DGKA 1JG8A 3GETA 2VMSA 1YO5C 3LVJA 3WKSA 3AEMA 1AKBA 1KMKA 3FSLA 2Q2EA 3W1JA 3TATA 2QM3A 5FD5A 3W1IA 4FT8A 3H3ZA 4E70A 1AMAA 4CXFA 4GCVA 1YOOA 1AY8A 3BWNA 4RITA 1OMIA 2R5EA 3OOPA 1YIOA 2CINA 4K2IA 3ISLA 2P6TA 5EEGA 2OU2A 3RBLA 6PAXA 2DQLA 3MZYA 2BWNA 1Y4IA 3L44A 3B02A 1IN5A 3BCBA 4M2MA 3GW2A 3M9AA 3EI5A 3Q9VA 2JZYA 3FD0A 2VBZA 2E7WA 3IWZA 4KN7X 4RAEA 1ZODA 2HP1A 1IN8A 1BJNA 1J32A 4MQVA 4MKKA 3FM3A 1FLIA 2F5CA 2UXNA 3F8BA 2QB2A 4A2UA 3C18A 3F22A 2A6HF 4BYYA 2BHXA 2GA1A 5HS8A 2VBYA 1XI9A 5HHYA 4U2HA 3CUQB 1UB9A 3MC6A 4HLXA 3G73A 1Z05A 3KGXA 2R7FA 2AY6A 4IRHA 3WCOA 3Q5FA 4GE4A 1JHFA 4UVAA 2QA3A 3BZ6A 3HOSA 1W5TA 3G7QA 3NYTA 5DCFA 1OHVA 3FMQA 1SZUA 1BI0A 3AOWA 1GEXA 3PA9A 1JGSA 4TN4A 5CLSA 2XGXA 5D5SA 3LWSA 1J04A 4I09A 4H51A 3FX3A 1TQIA 5L3CA 1PMOA 4BMKA 3CUQC 1LDJA 3QP5A 1B9IA 4KFCA 5HDGA 4WYAA 3EYYA 3H92A 3DXVA 4ESJA 4MY5A 2WKAA 3BJOA 3VK4A 2FQ3A 3ZRRA 2W8UA 3QOPA 1B59A 2GMSA 2QVOA 2Z3YA 2ORDA 3HIFA 2M87A 1WSTA 5ERIA 3A8UX 1O69A 3GFJA 1XSVA 1QIRA 3AEJC 2GQNA 2PMUA 4UXNA 5F9SA 3NNKA 2VXZA 3CDHA 1RV3A 3CTAA 2YCTA 3M5UA 1AKCA 2PMHA 4GE9A 1DJUA 2IRFG 1EV7A 3P9CA 2BE5F 3Q9SA 3LQQA 1FP1D 3HSEA 3RKWA 1W7MA 1LJ9A 1GEYA 3WTWC 5E5IA 1GD9A 4NQWA 3VB2A 3B1DA 5M4DA 3EIBA 2HKXA 1IRGA 2JSCA 2X5DA 2MBFA 2P5LC 3WTXC 1EH8A 3GFIA 3R4TA 5F1RA 1CZEA 4EU1A 4LG0B 3RBFA 1D7UA 3T0YA 2XAQA 1T3IA 5EIGA 2VE8A 2G7UA 2ZUKA 4XQ2A 4LGWA 1BJOB 2ZMEB 3ELPA 1HSTA 1AHYA 3W6JB 3TFUA 3QU6A 1U5TA 3MFKA 3FKDA 4JF0A 1O61A 3MZHA 1BJ4A 1LEBA 2E7UA 1RI7A 5TJJA 4W1VA 2HZTA 1R5GA 2VBWA 3N97A 3EI8A 3WTUC 1YTYA 3DP7A 3F9TA 2FN6A 4WBTA 3U2RA 1YAAA 5K5QA 5FT5A 1UU1A 1FBQA 4HV6A 4Q6RA 3QPHA 4ON0A 1IF1A 1FOKA 4JEZA 4E77A 2XH1A 5L3BA 4H0EA 3QM2A 2MH2A 1LQ1A 4M9SA 1QITA 2DGMA 3MAFB 2BV6A 2QLZA 1EH7A 1I27A 3N5MA 4ZLVA 1I6XA 1JE8A 3LVLB 5DD8A 1RNLA 1ZRFA 3TKYA 1AY4A 3BV0A 2V6CA 3ZRQA 4F4EA 1IXRC 4A12A 4L5IA 3K1MA 1IN6A 5L3FA 3W6KB 5J8FA 2HS5A 3L9FA 3ZP5A 1IAYA 1Z6TA 5E8GA 1O3SA 3GZDA 4IVNA 3GX4X 5TF5A 3V7SA 3T8RA 1LVAA 4W1WA 1D2FA 1W4MA 2W7MA 4I98B 1IX8A 2CO5A 5D4RA 3I16A 4BXUA 1SD4A 4EGZA 5KVRA 1KU9A 3VOMA 2P4WA 4R1HA 5CYVA 5D95A 3K1PA 1DPUA 4KNYA 4A0RA 5FO5A 4L9JA 4KYOA 3R4KA 1TOEA 4ZM4A 1QQIA 2VMWA 3RUYA 1ZREA 4RJ0A 4AIKA 3WGCA 1ZHFA 4XJOA 4F5HA 4RS8A 1FYLA 3ABTA 3KP7A 4E3QA 3RYRA 2ISZA 2FNIA 1FX7A 4I0BA 5H20A 2L54A 3BDDA 2VMVA 4LW2A 4O6JA 4K2EA 4KN4X 4WYGA 3E6GA 4U7DA 2VMZA 5HLGA 4UHTA 3DR7A 5LHIA 1TTYA 4ADCA 3WE2A 4I0AA 2ZJGA 2QLRA 3MKJA 1WSUA 5LH9A 4P96A 2BIAA 2FNUA 1SFXA 2OD5A 1U78A 2F5EA 3M1EA 1GBNA 2D7YA 1ZGJA 4EV0A 5H6QA 2O3FA 1ZH5A 1G3YA 2COMA 4W8IA 3L7WA 3HTUA 1L3LA 2J5OA 3LAJA 4UUVA 1AJSA 2W8VA 1HW2A 2DTRA 3F8NA 1S7OA 2R5CA 4A6RA 4AIHA 1TNSA 2ESNA 3F8MA 1R1UA 1UFMA 2C44A 1B9NA 1C0NA 2OGAA 5ICFA 3BY6A 1TARA 2HUUA 1VEFA 2W8WA 2NS0A 4LJZF 3K2ZA 3KLNA 3DF8A 3NEUA 4ENKA 3FZ8A 1XCVA 2Z1YA 2JPCA 3V8KA 4AO9A 2NNYA 2BIGA 2F8JA 4HX4A 1LC5A 1O3QA 1O7LA 2VGUA 1FWZA 3DPLC 3ZMTA 4EM1A 5HXXA 1B6AA 3BJ6A 2O6GE 5G2QA 3PDBA 1BN5A 4M6YA 4R5FA 3VP6A 1CQ8A 2Z61A 4E3RA 2ZC0A 3GLXA 1ON1A 3E5QA 1FZPB 4LLNA 2HWVA 2NMPA 3FZ7A 2VLHA 4ZH4F 1VJOA 3ZZKA 3F23A 4KICA 1K78B 1FP2A 3P9IA 3K0LA 1QJ5A 2VC1A 1MDZA 1RIOH 3TO6A 1WYTA 2Z9UA 1HSJA 1ELUA 1J0RA 3G0TA 4R2NA 1IRFA 3WGGA 1J9IA 2VMNA 3OV8A 3GSBA 4ESFA 2B0LA 1H1CA 5AONA 1CJ0A 1MAPA 4HLYA 4L0YB 4J5UA 4F5KA 4HBLA 3B46A 4HQEA 1WKGA 1D8KA 2MD5A 3CJNA 4RGRA 2STWA 4GYGA 1M0PA 1G4XA 1W7PA 2XIGA 2R3SA 2ACJA 1UU2A 1H9GA 2RNJA 3ZMDA 2V79A 4LNJA 4ZM3A 2O61A 3T8TA 1XSXA 3KP5A 1SVVA 3HDOA 2D64A 3WCNA 3PD6B 1AJRA 1KU7A 2FXAA 2QYOA 2G7HA 1BOAA 2HOXA 3JSOA 4Z2YA 1EQBA 1D8JA 4A0GA 4R5ZA 3ZZJA 3VEPA 3T1BA 3ZPLA 4WLJA 2FNAA 4P9FA 4GSAA 3K69A 4WCGA 5IT9K 1Z6RA 4AZJA 3HL2A 2E54A 1GXPA 2YCPA 4DBCA 3BOQA 4WX9A 2MLGA 2HORA 2L01A 1G7WA 2F5DA 4LD5A 5FT6A 2XVCA 3KGWA 1XMKA 1YW8A 5D5XB 2EO5A 1LKCA 2W7DA 4IJAA 3SZTA 3ZMUA 2DT5A 3L09A 1DGDA 1D7RA 1TPLA 3RYPA 4MGRA 3AEMC 2EA4A 1OKRA 5TRDA 3WX9A 3QRFF 4ZASA 3RKXA 3FMSA 2AEUA 1WKMA 1BW0A 4IXOA 1ZGAA 4N9HA 1MD0A 3T5XA 1CF7B 4MKJA 2R0TA 4HAMA 4F5GA 3H3UA 3DKWA 4G8XA 5FGMA 2VI9A 1WYUB 4BHBA 7AATA 3I64A 3WU0A 1S0AA 2QBYB 4LNLA 3KFWX 2RC4A 4WXDA 3SXYA 1T0FA 1X3UA 1MDOA 2KRFA 3TGNA 2JRTA 3HHGA 3G3ZA 2UXXA 1LS3A 1BC7C 4Y0DA 4BA4A 1OYWA 2H94A 2JTVA 2R2NA 2YKVA 3F3XA 2W7HA 3DZZA 5DX5A 3HLMA 2EFWA 2ZKZA 4RKDA 4A6UA 3GZ6A 3C3WA 4XJPA 2W84A 3TDUC 4TV7A 1TW2A 2A68F 1X28A 1ASBA 2CW0F 3ZN1A 4QLCU 1YJYA 2W7LA 3AELA 5D8KB 3MC6C 1U2WA 2PG4A 1R7JA 4Q31A 3FVUA 2W7IA 1XGMA 4WB0A 4IF4A 1ARIA 2M8EA 4ATQA 5D4SA 1DGEA 4AWXB 3B8XA 3COAC 1XB4A 3I5TA 2NRAC 3QHXA 1SMYF 2AY2A 2JJEA 4IRGA 3LAPA 4MHGA 3CQ6A 4ZYEA 1UKJA 4U0YA 4ADBA 1MKMA 1BI3A 4ZSYA 3LSTA 4XLPF 3RKYA 3IHUA 2YX7A 1FC4A 2DPDA 2D2WA 1R1TA 2BI9A 3GWPA 1KU2A 1ZLJA 5IT9Z 3IKTA 1EG5A 2ZXJA 1WI9A 2DLLA 2XKOA 2NNNA 4JEVA 1KL1A 1R58A 4EJUA 3KZZA 4L9TA 3HSFA 2ADUA 3JAMK 4L0OA 4LK1F 1FSHA 1ORDA 3CO6C 1FY7A 2P7VB 4EGYA 3ELKA 4CXRA 2AATA 1MGTA 1GC0A 4NOGA 1U6GA 2D1VA 1I29A 3E2ZA 2Z1ZA 2WK9A 1D5VA 3EIAA 3P7NA 4L18B 4IPAA 5LHAA 2WTEA 5AIPA 2ZSLA 2VIBA 2ZCWA 5BPDA 3ZMVA 2BWOA 1STZA 2GIVA 1E2XA 2AY5A 4JEYA 4ENJA 2A5YB 1XDUA 3MEXA 4MQRA 1D7SA 1ZARA 4RGUA 3NRAA 3NRVA 1SD6A 1Z7UA 2FSWA 2QENA 5DD4A 3WG9A 1R23A 4A72A 2ELHA 4ZYHA 1B4AA 2XRNA 1BI1A 2E1CA 2IJLA 4LFUA 5HS9A 1U3EM 2ETHA 5K5RA 1XDSA 3EETA 4I2OA 2YPRA 2OBPA 1ZC9A 4OMZA 1W7PD 1BQDA 3N4MA 2VLFA 2HGCA 2P5VA 1TOGA 5G2PA 4RB3C 4HX8A 4PCQA 3DODA 1P4WA 3FRKA 2YR2A 3GJUA 3QU3A 3OKSA 3USFA 1ZN2A 1SMTA 4NHJA 4EM0B 5JI6A 3GO5A 4UVBA 1QPMA 1IN7A 2V0YA 3BS8A 1YNUA 1YJZA 4Q5SF 5HDMA 1ASFA 2Z9VA 4A0HA 3RTRA 1UCRA 2MH9A 4KMUX 1PMMA 2WV0A 1QO0D 1ASNA 1MLZA 3UWCA 4CO8A 5E18F 2VN2A 1FC3A 3RPUA 4W1XA 1I43A 4OIOF 4RGSA 1USSA 3F72A 2HTJA 2EFQA 1UU0A 3D6KA 1O3TA 3Q8NA 5EQCA 3KZYA 4HV5A 3FDBA 4CHUA 5BPIA 1EJIA 3GZDC 1M0NA 3JAMZ 2CTZA 1WYVA 3FQAA 2E7JA 2K4JA 4IYOA 1GVJA 3RCHB 3S2WA 4MTEA 4HF1A 3IRRA 2JPBA 2OQGA 3WGIA 2AY7A 1ASEA 4L9NA 4P55A 2VGWA 3GZCA 4U0VA 2P5KA 3BWOA 4IXZA 1S7AA 4EQQA 1IBJA 3TQXA 2KJCA 2PEXA 1KL2A 4E1OA 1I5ZA 2A07F 4R8DA 5JAYA 3AV7A 4UNOA 3AAFA 2AEVA 2W7EA 4MQ9F 1AAWA 5DJ9A 2OKJA 3GF2A 1M7YA 2PO3A 4JEWA 4OT8A 3CAIA 4WXFA 1T39A 3V7RA 1J5YA 1MZBA 1V4RA 5LEJA 1LC7A 1IXCA 1BI2A 1E5EA 4BAYA 2LKPA 4EJVA 1TATA 2R5CB 3MQ0A 1XGSA 2EA2A 1UHMA 4U7BA 4G9YA 4P3MA 2M30A 4WP0A 3V4GA 3L00A 2EV6A 2O03A 4R8HA 1ZOBA 3MAUA 1PG8A 2Z5UA 3I59A 2QQ9A 3M8FA 4IW7A 1IXSB 1CL1A 5H6RA 4RKCA 1C7NA 1H0MA 1BQAA 1ECXA 3WTSC 3DXWA 2BEOA 4Y13A 2LF7A 2W85A 4RB1A 2KIUA 3A9ZA 1VTNC 2GXBA 3JSPA 1XGOA 4WXHA 2EFOA 1GC2A 2HOYA 1AHEA 4K2BA 1FT9A 2JJHA 4RIZA 2YOBA 3PJ0A 3E5UA 1I41A 3IL2A 3HVYA 4N9IA 4OBUA 4YIFA 1WYTB 4WD2A 2IT0A 2X8UA 1G4DA 3FFRA 2DGLA 3N75A 2W8TA 1W23A 3JW9A 5DCMB 3PDXA 3PIUA 1M0QA 1TOIA 2PI0A 3REOA 1SD7A 1GDEA 1W7NA 4OIPF 2L4AA 4A5NA 2C81A 4WYEA 4N0WA 2VMRA 2W7FA 5LGNA 1M32A 1B4XA 1QGNA 2E1NA 2YKXA 1S08A 1YS7A 1ZG3A 3NU8A 1T2KA 3SQNA 4AZKA 1ARHA 1GC3A 2IPQX 2K02A 3FVSA 3CUQA 2M5WA 1ULYA 1VP4A 4ZAHA 3MEBA 3E2YA 1ARGA 4DQ6A 5CJ9A 2XHKA 3KP6A 3ERED 1RVUA 4QWQA 3FCRA 5LBQA 1MDMB 3LG0A 1KGSA 3I4PA 3ECOA 2RFVA 4TMRA 3P9KA 5G4IA 4RAYA 2XAFA 4IXSA 2FF4A 1K6OA 3WU1B 2STTA 5ILVA 1BJWA 4ZDLA 3HYIA 1PFFA 4B8XA 3HOTA 3VK3A 3R0AA 3ML6A 1TBXA 3V8JA 3LFKA 1KU3A 1AHGA 3DXJF 3CUOA 1S8NA 1AWCA 3AENB 3TCMA 2CWEA 1KQ8A 2EV5A 2V9VA 4EVIA 1W5SA 2D5YA 3E97A 2EZ2A 5D5VB 3W1HA 4UV9A 1ZYRF 2LNBA 3GXOA 1YW9A 4M2KA 1LEAA 4ZZLA 1GHCA 4N0BA 5LEKA 4HF2A 3I4JA 3ABUA 3QPTA 2EB7A 2GXGA 4LW4A 2RVCA 3HTSB 3FVXA 2E7IA 4OIQF 2MLKA 4MTDA 1KMJA 1PP8F 5K1YA 2HEOA 2JGTA 3BCAA 2PB2A 1BBYA 3EUCA 1ELQA 1HKQA 2H6BA 1HW5A 5D6EA 4OIRF 5JFRA 2HZPA 4KIFA 3ZN0A 3V8LA 2JT1A 1XCBA 3ASBA 5E8IA 5LGTA 4S05A 1AAMA 2EGYA 3WTYC 2DKJA 1R5HA 2RN7A 5JR3A 3FF5A 4LG0A 1ZRDA 4HVKA 3I71A 3MWMA 2FMYA 2EH6A 4JK1X 1BM9A 2W8JA 5FFXA 2OGEA 2CANA 3V7CA 1FG3A 3I0TA 1BJOA 2ZMEA 1P4AA 4F5LA 3RIRA 1AOYA 2ZNYA 5ILUA 1OR7A 4HYEA 1BS0A 1AIAA 3K7YA 5HS7A 1YS6A 3GYHX 3WODF 2A69F 4G7ZF 2L3DA 1D7VA 4J8LA 4F5MA 1DJ9A 3BJAA 4EJTA 1F5TA 1I1GA 2D1HA 2HUFA 3F8CA 5AX8A 5J6XA 2YSRA 1TQMA 1P4XA 3ASAA 3PQJA 2RKHA 1N8PA 2RGVA 2FRHA 1SPAA 3HBXA 3WY7A 1IUGA 2CFBA 4G94A 3KP4A 1T6SA 3DV8A 2EWNA 2AY1A 1FYKA 2XV4S 3J80K 4KDPA 5ICCA 4PVFA 3EQLF 2P7CB 1ASDA 2CJDA 3LVMA 4ENNA 5JHUA 4F7ZA 3HSRA 2OKKA 1AKAA 5DEQA 4IRIA 1OXPA 1IN4A 5BJ4A 4G7OF 4EB7A 2BBYA 4L9VA 5IWQA 5F8VA 2X0LA 4CZZA 3DC1A 2EJRA 1P92A 2CG4A 2EFPA 5A2QK 2TDXA 4CBSA 4XRFA 5D6FA 3O2PE 4BH9A 2VIAA 3I53A 4A00A 3IRQA 2V1UA 4KT5C 3TOBA 3K28A 5E1WA 4A0FA 3CBFA 3H14A 2O8XA 2MC3A 2HYFA 1P6RA 3FZVA 2Y48A 4YFNF 3MBBA 1ASMA 4WXCA 1BC8C 4D0PA 3B73A 4KXKA 1FBUA 3RJPA 4LK0F 2OQXA 4BA5A 1DFOA 3IHJA 2BI3A 3EI7A 2QBTA 1FSEA 1AMSA 2DI3A 2QUFA 1BIAA 3E6DA 2W7KA 2D7ZA 3L8AA 4KA4A 2BI1A 5J8CA 4R79A 4Q48A 3WKRA 3KEQA 3HT4A 3BWNC 2WC2A 5AIQA 1XN7A 1AIBA 2ZSMA 1SAXA 4M74A 2PFBA 3FQ8A 4FX4A 2XBNA 1OXOA 3QBOA 3KP2A 4PZJA 4LNMA 2VT3A 1JS3A 3FFHA 2VGSA 1TOKA 2IW5A 3LY1A 2FQ6A 1HKSA 5DB5A 3ZMSA 5FT4A 2FBIA 5F64A 2VOOA 3E77A 3TDZC 2EPJA 5EUEA 4A5MA 2VMUA 3HRUA 4M9ZA 3ROUA 4OTLA 4ZYGA 1ODDA 4Y17A 2Z67A 2M1BA 2QQAA 4AD9A 1RUOA 3AEOA 3QAHA 5E1XA 2VMOA 4IXAA 3NTJA 1EH6A 3J80Z 4LB5A 5HLHA 4LLGF 4G7HF 1W7LA 1SFEA 4EJWA 4ATPA 1IVRA 3HHHA 3M8EA 1S29A 2GWRA 4L0ZB 4P9UA 3BP8A 4FHTA 1Z7DA 5FT8A 1MJAA 4EMYA 4OU0A 4KIGA 1QBJA 2K4BA 5IT3A 4DGTA 3B1CA 2DU9A 2HKOA 2HYGD 1HKTA 4WK8F 4ISYA 3KE2A 3NQOA 1ASGA 3HQTA 1J59A 4GE7A 4HF0A 2Z99A 3NYUA 3RQ1A 1B5OA 3PPLA 1OYIA 1K78A 5HDNA 3F6TA 1W3UA 3K9TA 1YFHA 2VGVA 2GAUA 2A6EF 2P6SA 3LA2A 1DPRA 3AATA 2YCNA 1MJBA 4UHMA 2CY8A 5LRSA 4RGXA 2D65A 2Y0MA 1IAXA 4UHOA 5EFSA 5BJ3A 4XLNF 3ACZA 4PDKA 1KQ0A 4XEWA 2HTSA 4CICA 5HDKA 3OP7A 3BROA 1BJAA 1SFUA 4A0ZA 4OCAA 3VK2A 3ECDA 2Z9OA 5DUKA 5EIGB 5ED4A 1ZG5A 2A3SA 3NU7A 4WXBA 2ZFWA 3JTHA 3FXRA 4JQFA 2RV8A 1U5TB 2YRIA 5K5OA 2Y75A 1Y0UA 2DFIA 5HVQC 2V1DA 3CLOA 2FU4A 4FFCA 5F6FA 1I48A 1FBSA 3GBXA 4A0YA 3DPTA 3WGBA 5E3KA 3IF2A 3CQ4A 4HA8A 3R60A 3FXQA 2DPUA 3SFZA 3FZ6A 2WK8A 4WWCA 3U1DA 3SHFA 2H27A 4IHSA 1C7OA 1X2AA 1TLHB 4AH3A 1U5TC 2R7DA 1WQ2A 5CVIA 3O3KA 3B1EA 5K8BA 2VMQA 5LHHA 1ON2A 3CO7C 1E5FA 1O62A 3IWFA 3KP3A 1XEYA 1Z3ZA 1O57A 1P3WA 3GWZA 3EYIA 4Y15A 2RQPA 3RI6A 1F4KA 1DP7P 2AS5F 3WZFA 4G6DA 1K79A 3CQ5A 2CFXA 2LF8A 4U88A 4ITXA 1FNNA 1TNTA 4YG2F 4BNCA 1CL2A 4YFXF 4XJMA 1CF7A 2GB3A 3MADA 2DK5A 1R36A 1IAWA 4NB5A 2V1XA 1JS6A 4I7HA 4ZZDA 4M73A 3BPVA 2CQKA 3ISPA 5FFZA 3I58A 3II0A 1WYUA 5EEHA 4GYIA 5HLIA 2YKYA 2QBYA 5BS6A 4IY7A 1IZ1A 4B09A 4IHTA 1XD7A 3GFLA 3DFGA 1DKAA 2QZ8A 4Y0HA 5FLXK 2CH2A 5I92A 5LGUA 4UQVA 4ZDPA 3DEUA 3HRTA 3TO7A 3GZ5A 2HFHA 4GO1A 4UVCA 4JE5A 5FD6A 1KQ9A 4XJLA 1GXQA 4XK1A 4OYTA 4RJYA 2DAOA 3WE3A 3A9XA 3NUIA 3P6KA 8AATA 5KK1A 3O6BB 2KJBA 4CGZA 1V2EA 2M45A 3UAKA 1Z9CA 1DJEA 4UV8A 3PAAA 2AY4A 1YLFA 2Z9XA 4XBFA 2DOUA 2ZYJA 1G3SA 1LNWA 4ADEA 1LC8A 5BOXA 1ZG1A 2FEZA 1DTYA 1SZKA 2Q8KA 3AEPA 2VMPA 1SFFA 1S07A 1A04A 5E4ZA 4Q76A 1ZLKA 1AJSB 5LLQA 1QJ3A 2ZP7A 4I8AA 3HRSA 2VONA 4PFFA 2FOKA 3HMUA 3FQ7A 3QN6A 3MCZA 3LV2A 4HF8A 1CQ7A 2O1BA 4GRXA 5J8QA 3R0JA 4GGGA 1V2FA 5LRRA 3RPQA 2Z33A 4O3MA 4BQAA 1QGPA 2OAZA 4XSXF 4CBRA 2L4MA 1USTA 1C7GA 4Y0IA 3VFZA 2W7GA 3FMRA 5G4JA 4YIIA 1U08A 2VBXA 1N31A 1IX7A 1G4VA 1ASCA 4UHNA 4HDVA 3BPXA 1QZZA 2Q7WA 1ASAA 1TASA 4OOIA 2L02A 2BI5A 4LMYA 3K40A 5CVRA 4MEYF 4F5IA 5CVVA 5C6UA 3PDBB 1XGNA 4M9XA 1T38A 2VMYA 2VYCA 2BYLA 1TW3A 4OBVA 3NUBA 1PDNC 4G6QA 5E20A 4EFFA 4AIJA 1P2FA 4PGGA 2CB1A 3TQNA 2GQQA 4HQMA 3I54A 5D5UB 3SZPA 3DU4A 1KYZA 4RLGA 4K2MA 1WRJA 4Q75A 2CSOA 3A2BA 2VMTA 2OATA 5FLXZ 4LLLA 2VI8A 2TPLA 9AATA 4MEXF 5L3EA 4B9BA 1Z1DA 1X0MA 4EMSA 2PB0A 4OMAA 2EZ1A 1S09A 1W7PB 1FG7A 4OMYA 3JTGA 2K86A 1OYYA 1S6LA 5M4BA 2IA1A 2XROA 1QZ9A 1BKGA 4LC3A 1PP7U 1JHHA 2O0RA 2KIMA 5ICGA 4KMFA 3KE3A 5FB2A 1D3YA 4RAZA 3EUHA 1IUYA 1KKJA 2DQRA 2XAHA 4HOBA 4OC9A 4WLHA 4I01A 1ARSA 4ETSA 1MGVA 2NYXA 1GEWA 4WYDA 4JEXA 1R00A 3PQKA 4BQ0A 3R6SA 4ZDOA 1SF2A 1KKPA 2HOZA 2XAGA 2J5PA 2AY3A 5DDGA 2E7XA 1CZCA 3AEJA 3PFIA 4A6DA 4WXGA 2DW4A 5EUNA 1YQAA 5BMZA 4A6EA 1RUNA 2AXLA 4IX8A 5LHGA 3L2CA 2BYVE 2H09A 3F0HA 4WYCA 2O7CA 4FX0A 3DR4A 2W24A 2CYYA 3ECHA 5D5WB 1B8GA 5L3GA 3RCHA 2FNPA 4KUMA 2Z9WA 1O3RA 1T98A 5G09A 2G9WA 3EI9A 3EZ1A 2BWPA 3I5UA 2FE3A 4MSOA 4XSZF 4EM2A 3MAJA 1WKHA 2AY8A 3FTBA 3ZMZA 4M6XA 1I1SA 1YIYA 2PLYA 4KYWA 1B5PA 3WGHA 3EZSA 2O0YA 4HX7A 1M6SA 2X3LA 2VE9A 3ZQ7A 2ZJ2A 4CDGA 1YW7A 1FPQA 4O6ZA 4W5KA 4PGHA 3F6VA 4U0WA 1AX4A 1M4NA 5CVJA 2C7TA 3NDNA 1G3WA 3P1TA 1LDDA 2Z20A 4HZFA 4M2JA 2CH1A 2VT2A 2Q0OA 2PBIA 4M72A 1LW5A 5M49A 4MNUA 3QI6A 1ASLA 2K27A 2OZ6A 5CVUA 2BYJA 2AY9A 3JU7A 3ZRPA 4ESBA 4JE5D 1U8RA 2CJGA 4ASNA 1C9CA 3KEOA 3KCCA 2CJHA 4EB5A 2GSAA 1AHXA 3LA3A 5D8LB 4CYDA 4AVPA 1MJ9A 2LDUA 2DR1A 2ZNZA 4P7YA 3AOVA 1AY5A 4AOAA 4WB0B 3LWFA 2H6CA 5BQTA 4RB0A 1LB2A 2IA2A 2P8TA 1O7FA 3E6MA 1HBXG 1AMQA 3TFTA 3ELEA 2XKPA 2QB3A 3COGA 3FXUA 4CVQA 4GXOA 3M7GA 4WYFA 2PJPA 1JXSA 1REPC 1QNTA 4A0XA 1AICA 4JF1A 3F21A 3JZLA 3KETA 3QP6A 1RZ4A 3EI6A 2GMUA 3DQVC 1AMRA 5DJ1A 1H9TA 2FYFA 1BIBA 5EAAA 4ZSWA 1B9HA 1CS1A
chains in the Genus database with same CATH superfamily
3MAFA 1G6NA 1RPWA 3F8FA 5ILSA 1ZRCA 2HP2A 1PVEA 3N0LA 4NC7A 5HOOA 1UHWA 1VZ0A 1ZAOA 2LRDA 2MFZA 3M1CA 2DJNA 4ZWMA 1DUXC 1MDXA 2QMAA 3J81K 2FQ4A 2HDCA 2OQRA 2BHYA 2ZBKA 4EATA 2IP2A 5DCMA 5B1AH 4ZWVA 4CXQA 4KIBA 4S04A 4Q47A 3JRBA 2F5FA 1OHYA 2IGOA 5E17F 1MBGA 4BXFA 3SEZA 1PUEE 2PN6A 2HOEA 4LB6B 1F1ZA 2F2EA 2FMLA 3GFMA 1JT6A 1MSFC 3ZR8X 5FRNA 4M71A 2EV0A 5ICEA 2VGZA 2D66A 3E2ZB 2NAZA 2QQBA 3H0GJ 3PGYA 3K7AJ 3ULQB 3OL4A 3R9AA 3ZQQA 1JTXA 2WBMA 4F91B 1OCOH 3EDPA 3FWEA 3J7AY 5M46A 3H7FA 2LFBA 2VOPA 4DGWB 2RDPA 1YIZA 3E5XA 1R1VA 3SYTA 1GDTA 3G8MA 1Z67A 3D0SA 1LDKB 4BHCA 3DLAA 4YRVA 1RVYA 1YYVA 3CZ6A 2W57A 4W91A 2YUSA 4HW0A 4BHDA 1MDMA 2L7MP 3FM5A 4B3AA 1BT4A 2ID3A 1GCKA 1S06A 2CQXA 2AQFA 3OIOA 2VGTA 2HQNA 2KIFA 4WF2A 4DYCA 3TOAA 2D63A 3DLLF 3OS0A 5JVTA 1C0WA 2HI3A 2V1NA 1N2TA 2VJIA 2DKBA 3NARA 4XMYA 2FM1A 4UOYA 1H0CA 2V9PA 4OINF 1OHWA 3CCMI 3ZXSA 1HXDA 1LFUP 3HBLA 1G3TA 2A61A 3OYMA 1E17A 2C0RA 3K4CA 2VMXA 3KKIA 2FBHA 1OCCH 3AENA 1MH3A 4BUPA 3DRDA 4RB2C 2LD5A 2ESHA 1CGPA 3A9YA 1N78A 4GDYA 3LSJA 4J00A 1XSDA 2FA5A 1MAQA 1V2DA 2D45A 1QZYA 4BEHA 4CCMA 2MA3A 1SD5A 5F0HA 1TT5B 2NVYJ 1A6QA 2MSYA 5F27A 3LQRA 3MZ8A 3PNYA 3CCSI 1IJIA 3NYSA 2IA0A 4PIWA 1M0OA 2CGPA 5GAEJ 1FYMA 1TWCJ 3IC7A 2JA5J 3QGUA 4M3BA 2OZUA 3WLXA 1ONVA 1B9MA 4Q4ZF 2WWYA 4OWRB 3AG3H 1WWXA 4QGRA 1KYWA 1FMWA 1Y1VJ 3JWBA 3S3MA 3WTZA 5FKNA 4DNCA 1O4SA 4DJAA 1LK9A 1ZGWA 5F08A 2KRHA 1XMAA 1OATA 2XASA 2DK8A 3PSFA 1QISA 5DUIA 2VC0A 4L5JA 4IOAF 2IVMA 2BKWA 5EAVA 1VQPI 1JF9A 5FROA 4ZYDA 3TO9A 2IAIA 1Z91A 4HDUA 2VODA 3JWAA 2P81A 4MQPA 4A6TA 3RI4A 1L0OC 2JJGA 2KT0A 1CQ6A 3KYDB 3M8JA 2CUEA 4O5VA 1J75A 1AKHB 4YFKF 1C4KA 3BG3A 4F5FA 3WTVC 1G7XA 2Y69H 1SZSA 3NX3A 2ZO4A 4B3XA 2L9SA 1IX6A 4IO9F 3E6BA 3HG9A 4EJOA 1OFCX 2W7JA 2XSDC 1K7AA 1J2XA 2GA2A 1MW7A 3Q0WA 1WYVB 2EFNA 3J81Z 2XAJA 3ATHA 4IYOB 3WU2C 1TQPA 1F9NA 2PQ8A 1HW1A 3KLOA 4YEJA 3VOEA 3E6CC 2CV0A 4FL0A 4XQFA 2JG2A 5TISC 3RDIA 5DYMA 3BWGA 1R22A 3AFHA 3HRMA 4RM1A 4XAUA 1B1BA 2CSTA 2HR3A 3BB8A 2UZKA 2DO7A 3QPGA 1WJ5A 1LW4A 2DBBA 1APLC 3VYRB 2BI2A 4BQOA 2X4HA 5A2QZ 4II2A 3BC8A 3CMEI 1TOJA 4JBAA 2QWWA 3T32A 1MLYA 3LVKA 2OA4A 2QEXI 2FJ1A 2JA2A 2X9DA 3K1NA 4I02A 3VODA 2R7SA 3FHZA 1V55H 1IW7F 3M3YJ 3JTXA 1DDNA 2ECBA 3HUGA 3CC4I 1V72A 3GUDA 3MKYB 3ONQA 3J7AO 4B98A 3DYDA 1VI0A 4F5JA 5DV5A 4ENMA 3C7JA 1J7KA 3JW4A 2V7FA 2X5FA 2ISYA 3D5LA 2C6YA 2GZWA 3U9GA 4M3DA 3BN1A 5E1ZB 2VUMJ 2RNGA 1HQCA 3E9KA 3RQIA 2V1PA 2YHKA 4FE4A 3UE8A 1OPCA 4P5OA 4GEBA 4BBSJ 4BHPA 4KAMA 2LG4A 3C1DA 4A3KJ 3WTTC 2BGCA 4CYCB 2LSOA 2VJ4A 4C3IJ 3H0DA 1K4SA 2V6EA 3PNVA 3GTLJ 3DCFA 1ACIA 2D61A 2G6WA 3I4NJ 3VAXA 2YRRA 3H5AA 4U1TA 1S3JA 5G0AA 2DYRH 3LA7A 1V3FA 4PFNA 2LR8A 5EUDA 3BCXA 2W25A 2UWMA 1Q1HA 1GC4A 1W0UA 1ARTA 1LE8B 4NNJA 3BR3A 3GEZA 1AHFA 1RV4A 2K7LA 2HUIA 2KKOA 1YG2A 2FBKA 2V9KA 5C4XJ 2JJFA 5B66C 1TWFJ 3IKVA 1Z3XA 1OLTA 3I59B 3E2FA 2XUBA 3E3VA 4DQ2A 4ADDA 5HODA 4AO4A 2BIEA 2EK5A 1NHAA 2EZHA 4IEJA 2YU3A 3PD6A 4PJLA 4DBRA 3GR9A 1N25A 1XTAA 2RREA 5L3DA 1KA8A 2JISA 3GVAA 2YX4A 3F6OA 2I8DA 2LKSA 2HQRA 1ZTRA 2YKUA 4IOCF 4ITGA 3R61A 3K4JA 3GTJJ 3H5RA 1VQLI 1X29A 4BDZA 2DGKA 1JG8A 1NTCA 3G1LA 3GETA 3B6CA 2VMSA 1YO5C 3LVJA 1MNEA 3LL7A 3WKSA 3AEMA 2X6YA 1AKBA 1P7JA 5EGOB 1KMKA 3FSLA 2Q2EA 3H36A 3W1JA 4CZCA 3TATA 2PMZA 2QM3A 1X1AA 5FD5A 3W1IA 1ITYA 4FT8A 3H3ZA 4E70A 1AMAA 4CXFA 4GCVA 1YOOA 1AY8A 3JRGA 3BWNA 4RITA 1OMIA 2R5EA 3OOPA 1YIOA 4RLQA 4BGDA 2CINA 4K2IA 3ISLA 2P6TA 5EEGA 2OU2A 3RBLA 3FBNB 2MG4A 6PAXA 2DQLA 3MZYA 4M3GA 2BWNA 1Y4IA 3L44A 3B02A 1IN5A 1WVRA 3BCBA 5F0CA 4M2MA 2IGNA 3GW2A 4XORA 3M9AA 4RAGA 3EI5A 3Q9VA 4XOTA 1X4PA 2JZYA 3HOUJ 3FD0A 2VBZA 2E7WA 3IWZA 4KN7X 4RAEA 1ZODA 1UAAA 2HP1A 1IN8A 3Q3SA 1BJNA 1J32A 4MQVA 3HKZA 4MKKA 3A0HC 3FM3A 1FLIA 2F5CA 4HPQA 2UXNA 1IJWC 1E3OC 1Y0NA 3F8BA 2QB2A 4A2UA 3C18A 3F22A 2A6HF 1BR2A 3S1QJ 2KDOA 4BYYA 2BHXA 2GA1A 2KZVA 5HS8A 5CKTA 4BJ6C 2VBYA 4AYBN 4HNUA 1XI9A 2ZC2A 3HOYJ 4U2HA 3CUQB 3QPSA 1UB9A 3MC6A 5HHYA 4HLXA 3G73A 1Z05A 3KGXA 2R7FA 4HEA2 4IRHA 5K7ZA 3FK6A 3GTPJ 2AY6A 3OIPA 2CU7A 3Q5FA 3WCOA 2CQQA 2DA6A 2DDAA 3W2WA 4GE4A 3GZNB 1JHFA 4UVAA 2K40A 2QA3A 3BZ6A 3HOSA 3OS2A 4C30A 1W5TA 5M5YJ 3G7QA 3NYTA 1N75A 5DCFA 1OHVA 3RQ4A 2FUG2 3FMQA 4IQJA 1SZUA 3I9V2 3OS1A 1BI0A 3AOWA 2P0WA 4NC8A 1GEXA 3PA9A 1JGSA 4MO7A 2R7RA 4FASD 4UUSA 1AHDP 3FKJA 4TN4A 2JVHA 3BLYA 5CLSA 2R0QC 2XGXA 5D5SA 2HQAA 3OR2C 1WFXA 1J04A 3LWSA 2LVSA 2VJJA 4I09A 4H51A 2LH9A 2EINH 5EZGA 3FX3A 1TQIA 5L3CA 1PMOA 4BMKA 3CUQC 3A4CA 1LDJA 1SAUA 3QP5A 1B72A 1B9IA 4KFCA 5HDGA 4WYAA 3EYYA 3CCVI 1ETKA 3H92A 4ESJA 3DXVA 4MY5A 2HOTA 1FOWA 1BJZA 2WKAA 1MMNA 5KCMA 3J7YJ 3BJOA 3VK4A 2BW3A 2FQ3A 3ZRRA 3H3VK 2W8UA 3QOPA 1B59A 3HJEA 4BBRJ 1FMVA 3OSFA 2GMSA 2QVOA 2Z3YA 3AL0C 1R4NB 2ORDA 3HIFA 2M87A 1W36D 1WSTA 5ERIA 3A8UX 5CPRB 2PJRA 3VPRA 1O69A 4IX7A 3GFJA 5GAGJ 2H1KA 1XSVA 1QIRA 3AEJC 2L9NA 2GQNA 3QOEA 2PMUA 3BR5A 4UXNA 5F9SA 3NNKA 2CS3A 2VXZA 3CDHA 3OOUA 1RV3A 3CTAA 2E2IJ 4LG3A 2YCTA 3M5UA 2ZSHB 2PMHA 1AKCA 4GE9A 1MBJA 2IGKA 5GPCA 1DJUA 2IRFG 2BVMA 1EV7A 1S7EA 3P9CA 2BE5F 3EUKL 4Y3OA 3Q9SA 3LQQA 5IYBJ 4CUGA 2BVLA 1FP1D 2DDBA 3HSEA 3VYUB 3LSMA 3RKWA 5GPAA 1LJ9A 1W7MA 1GEYA 4BKXA 3WTWC 5E5IA 1GD9A 4NQWA 1ETXA 3BR6A 3VB2A 3B1DA 5M4DA 2V26A 3EIBA 2HKXA 1IRGA 2JSCA 2X5DA 2MBFA 1WJEA 2P5LC 3MKZA 3ZQLA 3WTXC 2VKVA 1EH8A 3VYSB 3GFIA 2L9RA 3R4TA 2LMDA 5F1RA 1CZEA 4EU1A 4LG0B 3RBFA 1D7UA 3ABLH 5E3MA 1SC7A 3T0YA 2XAQA 3HGYA 1Z21A 3FXKA 2MGQA 1HA8A 2K5CA 4I76A 1ZQ3P 3LOCA 1T3IA 5EIGA 2VE8A 2G7UA 2ZUKA 2OUMA 4XQ2A 2DA7A 2HDWA 4LGWA 2ZMEB 1BJOB 2NVQJ 3DWLE 3ELPA 1HSTA 4XRSG 3W6JB 1AHYA 3TFUA 3QU6A 1U5TA 4BY7J 3MFKA 3FKDA 3HOXJ 4HNTA 4JF0A 5GTHC 1O61A 4XN3A 3MZHA 1BJ4A 4X1EA 1LEBA 4IL6C 1OCRH 3RCOA 4FE7A 2XB0X 2E7UA 3K4BA 1RI7A 3HEFA 5TJJA 1U0JA 2VLAA 1ZELA 4W1VA 2HZTA 1R5GA 2VBWA 5C44J 3N97A 3EI8A 3WTUC 1YTYA 1MH4A 3DP7A 3F9TA 2FN6A 2JVGA 1YI2I 4WBTA 3LMMA 2R5ZA 2QSGX 2NS8A 3U2RA 1YAAA 5K5QA 5FT5A 1UU1A 1FBQA 4HV6A 4HSTA 1S5LC 2EIKH 4Q6RA 3CMMA 2ZMEC 4E7IA 2IEKA 3QPHA 4ON0A 5KHDA 1MBHA 2AHQA 1IF1A 4JX5A 1FOKA 1RKTA 1OR7C 4JEZA 4DOZA 4E77A 3W2VA 2XH1A 3DEWA 5L3BA 4H0EA 3QM2A 2KPMA 1YOVB 3SFIA 2MH2A 1ZK8A 1LQ1A 4M9SA 2OJED 1QITA 2DGMA 3MAFB 2BV6A 2QLZA 1EH7A 1I27A 2CMPA 3K6GA 3N5MA 4ZLVA 3LSKA 4QPQA 5FLVA 1JKPC 1I6XA 1JE8A 3LVLB 3BZKA 5DD8A 5BNGA 1RC9A 1RNLA 2DFHA 2VB6A 1ZRFA 3TKYA 1AY4A 3BV0A 2V6CA 3ZRQA 4F4EA 3FDYA 1IXRC 4A12A 4L5IA 3K1MA 2NOJB 1VQ5I 1IN6A 5L3FA 3W6KB 5J8FA 3JRHA 2HS5A 1D1AA 3L9FA 3ZP5A 2B9SA 3IAM2 4BE0A 1HF0A 1IAYA 1WJDA 1Z6TA 4N4NB 5E8GA 1O3SA 3GZDA 4IVNA 3OYEA 3GX4X 1MNDA 2Y2ZA 1WZ2A 3V7SA 3OY9A 3T8RA 5TF5A 1R71A 1LVAA 4W1WA 2L7FP 3PL8A 1D2FA 3FKIJ 1V54H 1W4MA 5F1JA 2W7MA 4LIVA 4I98B 5M3MJ 1IX8A 3IP4B 2CO5A 2W1OA 2BXZA 5M5XJ 5D4RA 3S2DJ 3I16A 4BXUA 1SD4A 4EGZA 5KVRA 3HPGA 1KU9A 3VOMA 3OMYA 1YX3A 2P4WA 1PUFA 4R1HA 1MMGA 2R4GA 3CJRB 4D1QA 5CYVA 5D95A 3K1PA 2K85A 1DPUA 4KNYA 4A0RA 2R7UA 5FO5A 4L9JA 4KYOA 5J40A 3R4KA 1TOEA 2K3FA 5IOZA 4ZM4A 1QQIA 2VMWA 3RUYA 1R4MB 1ZREA 4XK4A 3MVPA 4AIKA 4RJ0A 3A01B 3WGCA 1GVDA 1ZHFA 4XJOA 4F5HA 4RS8A 1FYLA 3ABTA 3KP7A 3L2WA 1OJLA 4PJ0C 3C2BA 4BQQA 3CP2A 4E3QA 3RYRA 3S93A 2XC7A 2ISZA 3I4MJ 2FNIA 1FX7A 4I0BA 3DEEA 2L54A 3BDDA 5H20A 2VMVA 2B7EA 3S1NJ 4LW2A 1QHHD 4O6JA 4K2EA 4KN4X 4WYGA 4A3IJ 3E6GA 2ZB9A 4U7DA 3TMOA 1W0TA 2VMZA 5HLGA 4UHTA 3L2QA 5LHIA 3DR7A 5FRMA 1TTYA 2XGEA 4ADCA 4RM2A 3WE2A 4I0AA 2Z16A 2ZJGA 2QLRA 3MKJA 2K9MA 1WSUA 5LH9A 4P96A 2BIAA 2FNUA 1SFXA 4DZPA 2OD5A 4AU7A 1U78A 2DTZA 2F5EA 3M1EA 1Y56A 1GBNA 1POGA 1Z7LA 1ZGJA 4EV0A 5H6QA 2D7YA 2BHZA 3OIQA 1QA6A 2O3FA 1ZH5A 3B6AA 4DZJA 1G3YA 2COMA 4W8IA 1VQ4I 3L7WA 1X3ZB 3HTUA 2LYCA 2JQ7A 3JCUC 1O4XA 2AXTC 2TCTA 2J5OA 3O8HA 3LAJA 1L3LA 4UUVA 1AJSA 3U21A 4JOMA 1X1CA 2W8VA 1HW2A 2DTRA 3CF2A 3HB9A 3F8NA 1S7OA 2R5CA 4A6RA 4AIHA 1TNSA 4Y7NJ 1FIAA 2IGMA 2ESNA 4XLCA 3F8MA 4Y33A 3S1MJ 3OWTA 1R1UA 1SVMA 1UFMA 1WJBA 2UV1A 2C44A 1B9NA 1C0NA 2MC4A 2OGAA 5ICFA 3BY6A 1TARA 5EG0B 2HUUA 2JMWA 1VEFA 2W8WA 2HYJA 4YELA 1QU3A 2NS0A 4LJZF 3K2ZA 3AG1H 3KLNA 3DF8A 3NEUA 5JVGF 4ENKA 1W36C 1XCVA 2Z1YA 1YRNA 3D5RC 2JPCA 3V8KA 1HOMA 3FZ8A 4AO9A 3WHCA 5J1YA 2X48A 2NNYA 3UR3C 1U9OA 2BIGA 2F8JA 1A6IA 3DTIA 4HX4A 1LC5A 1O3QA 1O7LA 2OF7A 3CD6I 3TW6A 2VGUA 1FWZA 3DPLC 3PUFA 3ZMTA 4EM1A 5HXXA 4XICA 1B6AA 3BJ6A 2O6GE 5G2QA 3PDBA 1BN5A 4M6YA 4II3A 2DA5A 2GBYA 4R5FA 3VP6A 1CQ8A 2IS2A 2Z61A 4E3RA 2ZC0A 3GLXA 1ON1A 3ZCOA 3FXOA 3E5QA 1F36A 1FZPB 3BT9A 4LLNA 2HWVA 2NMPA 3FZ7A 2E1MB 2VLHA 4QSHA 4ZH4F 1VJOA 2XF6A 3ZZKA 3F23A 1TWAJ 4KICA 1K78B 2D5VA 1FP2A 3P9IA 3K0LA 4AYBA 1QJ5A 3SDGA 1OCPA 2VC1A 4W1UA 4E7KA 1RIOH 1MDZA 3TO6A 1WYTA 2Z9UA 1HSJA 1I39A 2OCEA 2Y0SN 4FTHA 1NH3A 5GAHJ 1ELUA 1J0RA 2DCEA 3G0TA 1JJ6C 4V2FA 2O8KA 4R2NA 1IRFA 4ZYAA 3WGGA 1J9IA 2VMNA 3OV8A 3GSBA 3K4KA 3JREA 4ESFA 2B0LA 1H1CA 5AONA 4KT6A 4I6ZA 1CJ0A 1H8AC 4M6VA 1MAPA 1ETOA 4HLYA 4L0YB 1I6HJ 4BU2A 2DN0A 4J5UA 4F5KA 4UY8I 4HBLA 3VYTB 4HQEA 3B46A 2LBFB 1WKGA 3TBIA 1D8KA 2MD5A 3BTLA 3CJNA 4RGRA 2STWA 2E1MC 3IAS2 4GYGA 1M0PA 3KZIC 1W7PA 2XIGA 1G4XA 2R3SA 2ACJA 1UU2A 1H9GA 2M9HA 2RNJA 2ELJA 3KPHA 3ZMDA 2V79A 4LNJA 4ZM3A 4HG2A 2O61A 3T8TA 2DJIA 4B4CA 1XSXA 1VF9A 3KP5A 4RLFA 3IH3A 3GTQJ 1SVVA 2KQRA 2D64A 3HDOA 2BOLA 3WCNA 3PD6B 2JUGA 3QYEA 1KU7A 2FXAA 1AJRA 3GCMA 1XX5A 2QYOA 2G7HA 4P1WA 1BOAA 4XONA 2HOXA 2AO9A 3JSOA 2LK2A 2KLOA 4Z2YA 5EDNA 1IG7A 1EQBA 1D8JA 4A0GA 1JKQC 4R5ZA 3ZZJA 3VEPA 3T1BA 3ZPLA 3BQYA 4WLJA 2FNAA 4P9FA 1HDDC 2CUZA 4GSAA 4F93B 1U9NA 3K69A 3C2HA 1AA7A 4WCGA 3JRFA 5IT9K 5LFAA 1Z6RA 3E0JB 1JGGA 4AZJA 3HL2A 1A5JA 4QPOA 4IKFA 2E54A 2DT6A 1GXPA 1W5CC 3NWTA 2YCPA 4DBCA 3BOQA 4WX9A 2MLGA 2HORA 2L01A 3PIPF 4E7HA 1UJ8A 1G7WA 2F5DA 4LD5A 5FT6A 2KMUA 4H4KC 3ZQHA 1JI8A 2XVCA 3KGWA 2PX9A 1FTZA 5E79C 1XMKA 1YW8A 5D5XB 2WB1N 2CRGA 3PJRA 2EO5A 2NS7A 1LKCA 2W7DA 4IJAA 4CCOA 3SZTA 1DQUA 1Z0XA 3ZMUA 3KYLA 2ID6A 4E6KG 2DT5A 1TP4A 3L09A 4LOCA 1KZHA 1D7RA 1DGDA 1TPLA 3RZOJ 3RYPA 4MGRA 3AEMC 2EA4A 1OKRA 2VXDA 5TRDA 1RRJA 1K61A 5HLTA 3WX9A 2QCOA 3QRFF 2BY3A 3RKXA 3FMSA 4ZASA 2AEUA 1HDPA 4XRSA 1WKMA 1BW0A 2DA1A 1TZLA 4IXOA 1X19A 1ZGAA 4N9HA 2NVTJ 1MD0A 3T5XA 1CF7B 1MBEA 4MKJA 5M5WJ 2R0TA 4HAMA 4F5GA 1B8IA 4C2UA 2XRLA 3H3UA 3DKWA 4G8XA 5FGMA 2VI9A 3DBHB 3FXMA 1WYUB 4BHBA 2K9NA 7AATA 3I64A 3WU0A 1S72I 1S0AA 2LY1A 2QSFX 2QBYB 2W48A 4LNLA 3KFWX 2RC4A 5J3LA 1V5GA 4WXDA 4RA2A 1T0FA 1X3UA 3SXYA 2KRFA 3CCRI 1MDOA 1FOXA 3CMAI 3TGNA 2JRTA 2HPIA 3HHGA 2DMPA 3G3ZA 2UXXA 1LS3A 1BC7C 4Y0DA 4BA4A 1OYWA 2H94A 2JTVA 2R2NA 2VPRA 2YKVA 3F3XA 2W7HA 3H9QA 1YJNI 2CJJA 3DZZA 5DX5A 3HLMA 2LC2A 2EFWA 2ZKZA 3BQZA 4RKDA 4A6UA 3GZ6A 1UG2A 3C3WA 2W84A 1YIJI 4XJPA 3TDUC 2O9LA 3S16J 4TV7A 1TW2A 2MD0A 2A68F 4RMNA 3I55I 1X28A 1ASBA 1XPXA 1FEXA 2CW0F 3ZN1A 3JRCA 4FCYA 4ABZA 4QLCU 3OYGA 1YJYA 2W7LA 3AELA 2ZJQF 1MBFA 5D8KB 3MC6C 2XPUA 5KAFC 1U2WA 2PG4A 3CCYA 2HVSA 3C2GA 1R7JA 4Q31A 3FVUA 2W7IA 1XGMA 2E36A 3DU6A 4IF4A 1ARIA 2M8EA 1IV6A 4WB0A 4ATQA 5D4SA 2HOAA 2HPMA 1DGEA 4AWXB 3QYBA 3COAC 1XB4A 3B8XA 2NRAC 3I5TA 3QHXA 1SMYF 2AY2A 1JKOC 4YIRX 3NWSA 4IRGA 2JJEA 1NK3P 3LAPA 2VKEA 4MHGA 3LSGA 3K70D 3CQ6A 4ZYEA 1UKJA 1I3AA 4U0YA 4ADBA 1MKMA 4CCLA 4RDUA 1BI3A 2DOFA 4J01A 4AM3A 4ZSYA 3CCEI 2X85A 3LSTA 4XLPF 3RKYA 3IHUA 2YX7A 1FC4A 5F0FA 3OYLA 2DPDA 4CCKA 2D2WA 1R1TA 2BI9A 3GWPA 1KU2A 1ZLJA 5IT9Z 1OCZH 3IKTA 1EG5A 2ZXJA 1WI9A 2DLLA 3A03A 2XKOA 5DM6F 2NNNA 4JEVA 2R5YB 4ZTFA 3KIOA 4NQWB 1KL1A 3CCJI 1M1EB 1R58A 2ZXWH 4EJUA 3KZZA 4L9TA 3HSFA 2ADUA 5JLWA 3JAMK 4L0OA 4LK1F 1FSHA 3LNQA 1ORDA 4UB8C 5IY5H 3CO6C 1K4TA 1FY7A 2P7VB 3CC7I 3O8GA 2JA6J 4EGYA 3ELKA 4CXRA 2AATA 2VQCA 3LSRA 1MGTA 1GC0A 4NOGA 1U6GA 2D1VA 2L5QA 5EF6A 1I29A 2Z1ZA 3E2ZA 2WK9A 1D5VA 3EIAA 3P7NA 5IP9J 4L18B 4IPAA 3BG6A 3E1SA 5LHAA 1SEUA 2WTEA 3K4NA 4M3FA 1FOYA 5AIPA 2EH3A 2ZSLA 5F04A 2VIBA 2ZCWA 2X1DA 2CUJA 3ZMVA 5BPDA 1DU0A 2BWOA 1STZA 2DMTA 4RM3A 1WJCA 2GIVA 1E2XA 5IP7J 2AY5A 4JEYA 5GTIC 4ENJA 4PFOA 3CCQI 2A5YB 1XDUA 1U8BA 3MEXA 4MQRA 1IC8A 1D7SA 2Y9YA 1ZARA 4XKWA 4RGUA 3NRAA 3NRVA 1SD6A 1LUJB 4PJNA 2LOOA 3I3LA 1Z7UA 4A69C 4IHXA 1I3QJ 2FSWA 3D5SC 2QENA 1ZR2A 3BTJA 4A3CJ 5DD4A 3WG9A 4M3EA 1R23A 4A72A 2DFEA 2ELHA 4ZYHA 1B4AA 2EPFA 2XRNA 3CCUI 1BI1A 4F92B 2E1CA 2HZDA 2IJLA 4LFUA 5HS9A 1U3EM 2ETHA 5K5RA 1XDSA 3EETA 4I2OA 2YPRA 2OBPA 1IO2A 3ZGKA 2H8RA 2M34A 3TP0A 1ZC9A 4OMZA 1DGRM 5JLXA 1W7PD 3WHBA 1BQDA 3N4MA 2GIZA 2VLFA 3AG2H 2HGCA 2P5VA 2EILH 2TRTA 3G1MA 4NDLA 5EZHA 1TOGA 3OR1C 1ETWA 5G2PA 4RB3C 4HX8A 4PCQA 3DODA 2GLOA 1P4WA 3FRKA 2YR2A 3ABKH 3TP3A 3GJUA 3QU3A 2HQ5A 3PO2J 1TWHJ 3OKSA 4V19K 2VQLA 3QWLA 3USFA 1ZN2A 1SMTA 4CCNA 4NHJA 3AG4H 4EM0B 3GO5A 5JI6A 2EQRA 4UVBA 3VWBA 1QPMA 1IN7A 3KYCB 2V0YA 3BS8A 1YNUA 1YJZA 4Q5SF 5HDMA 3M07A 1ASFA 3JRDA 2Z9VA 4A0HA 3RTRA 4DYRA 1MNMC 1UCRA 2MH9A 3AL0B 1XC5A 2CW8A 4KMUX 2WV0A 1QO0D 1PMMA 1R5ID 1ASNA 2EZKA 1MLZA 3UWCA 4U87A 4CO8A 5E18F 2LREA 2UUZA 2VN2A 3ZQGA 1FC3A 2WY7Q 3RPUA 4W1XA 1I43A 4OIOF 1RKWA 4RGSA 1IUFA 1ORKA 1USSA 2L9VA 3OYJA 3F72A 2HTJA 2EFQA 1UU0A 4I99C 1AKHA 3D6KA 1O3TA 3Q8NA 5EQCA 1YE9A 3EUHC 3KZYA 4ZTJA 4HV5A 4XLAA 2LKXA 2Y0SA 3FDBA 3SZGA 2AQEA 4CHUA 5BPIA 1EJIA 3H1CA 4JP0A 3GZDC 2M7AA 4Z6YA 1M0NA 3JAMZ 4E7SA 1WYVA 2CTZA 2E7JA 3FQAA 5DTDA 2K4JA 4IYOA 1GVJA 2Y9ZA 3RCHB 2QGUA 3S2WA 3K10A 4MTEA 1GV2A 4HF1A 3IRRA 3PO3J 2LY2A 2JPBA 2DA4A 2OQGA 3ESWB 3WGIA 4C2TA 4AVZA 5H2FC 2AY7A 1ASEA 2H8WA 4L9NA 4P55A 4CCJA 2VGWA 3GZCA 2CQNA 4U0VA 4D7MA 2CV1A 2P5KA 4D7NA 3MKWB 3BWOA 1X1PA 1S7AA 4EQQA 1IRZA 1IBJA 2KJCA 4IXZA 2PEXA 1KL2A 3TQXA 4KJZA 2BY2A 4E1OA 4FETA 1I5ZA 2A07F 4R8DA 5JAYA 3AV7A 5E3OA 3AAFA 4UNOA 3PUBA 2AEVA 2W7EA 2OC6A 4MQ9F 1SFKA 2CV2A 2CUFA 3A0BC 1VQKI 1AAWA 5DJ9A 2OKJA 3GF2A 4Y52J 2VL8A 1M7YA 2PO3A 4JEWA 4OT8A 3CAIA 4WXFA 1T39A 3V7RA 2WAEA 1J5YA 3RKQA 1MZBA 1V4RA 1HLVA 3A1YA 4V2GA 5LEJA 1LC7A 1IXCA 2CFOA 1BI2A 1E5EA 4LITA 1UHSA 4BAYA 4CYCA 2LKPA 4EJVA 1TATA 2R5CB 3MQ0A 4BJTA 1XGSA 4XLHA 1QHGA 2EA2A 1UHMA 4U7BA 4G9YA 4P3MA 2M30A 3DKYA 4WP0A 2BXYA 3V4GA 3L00A 1SVLA 2EV6A 1LE8A 2O03A 3QQAA 4R8HA 1ERDA 1ZOBA 3MAUA 3DBRB 1PG8A 2Z5UA 3I59A 4MLOA 1IV8A 2B63J 4XRMA 2QQ9A 3M8FA 1JUSA 3K70C 3OYAA 4IW7A 4GFBA 2XF7A 1IXSB 1CL1A 5H6RA 2WB1A 3PFYA 4RKCA 1X2MA 5C4JJ 1C7NA 2GOXB 1H0MA 1BQAA 5DS9A 1ECXA 1Z3YA 4XLFA 3WTSC 1ZKGA 3DXWA 2BEOA 4A3MJ 4Y13A 2OPTA 1V5FA 3LSIA 2LF7A 2W85A 4RB1A 3GTKJ 2KIUA 4Y4RA 3VDXA 4E4HA 3A9ZA 4PK4A 2KFDA 1VTNC 2GXBA 3JSPA 1XGOA 3CLQA 4WXHA 2F5VA 2EFOA 3NAUA 1GC2A 2Y31A 3BR1A 2HOYA 5J1RA 1AHEA 1HCRA 3G71I 4K2BA 1FT9A 2JJHA 5IYCJ 4RIZA 2YOBA 3S2HJ 3PJ0A 3E5UA 1I41A 3IL2A 3HVYA 4N9IA 2ICWG 4OBUA 4YIFA 1WYTB 3BR2A 4WD2A 2XB5A 2IT0A 2QQ8A 9ANTA 2VKDA 2M3AA 2X8UA 4B47A 1G4DA 2X6XA 2VIXA 3M4OJ 3FFRA 2DGLA 3P5JA 3N75A 3S14J 2W8TA 1W23A 3DTKA 5CQEA 3JW9A 1T56A 5DCMB 3PDXA 3PIUA 1M0QA 2KIQA 1TOIA 4E7ZA 5IP6A 2PI0A 3REOA 1SD7A 2R93J 1GDEA 4RAFA 2MW8A 2QF7A 2L4AA 4A5NA 4OIPF 1W7NA 2C81A 4WYEA 1UELB 4N0WA 2VMRA 2W7FA 5LGNA 3L2RA 1M32A 1B4XA 1QGNA 2E1NA 2YKXA 4HNVA 4IZZA 3ZQIA 1S08A 4UUTA 1YS7A 1R9TJ 4J19A 1UG0A 1ZG3A 3NU8A 1T2KA 3K4LA 3SQNA 1BA5A 4AZKA 1J09A 1VQ7I 1MMAA 5FKKA 1ARHA 1GC3A 2W4SA 1YJWI 2IPQX 4G6TB 2K02A 3FVSA 1FJLA 2NVXJ 3CUQA 4AIDA 2M5WA 1ULYA 1VP4A 4ZAHA 3WG7H 3MEBA 3E2YA 1ARGA 4DQ6A 5CJ9A 2XHKA 3IH4A 3KP6A 3ERED 1RVUA 4QWQA 1NG7A 4PSWA 3FCRA 5LBQA 2GM4A 1MDMB 1W1WE 1WH5A 3LG0A 1KGSA 3I4PA 3ECOA 2RFVA 3E7LA 3P9KA 3DPUA 3DTEA 2IXSA 4RAYA 4TMRA 5G4IA 2XAFA 3W3CA 2FF4A 4KISA 4IXSA 3G1OA 1VQOI 3HPHA 1XG1A 2DMQA 3WU1B 1K6OA 1JJ8C 5ILVA 2STTA 2R7VA 1BJWA 2ME6A 2X6OA 4ZDLA 3HYIA 1PFFA 4B8XA 3HOTA 2KZGA 3VK3A 5K7FA 3R0AA 3ML6A 2CW7A 1ENHA 1TBXA 3V8JA 4BS9A 3LFKA 1KU3A 3HM5A 3G6EI 1AHGA 2COBA 3CUOA 1S8NA 3DXJF 1AWCA 4IHVA 3AENB 3TCMA 3W6VA 2CWEA 1HC8A 1KQ8A 2EV5A 2V9VA 4EVIA 1YJ9I 1W5SA 2D5YA 3E97A 2EZ2A 5D5VB 3W1HA 3I56I 4UV9A 4BEHB 1ZYRF 2LNBA 3GXOA 1YW9A 4M2KA 1LEAA 3EPZA 4ZZLA 1GHCA 2OCCH 3F0CA 3MKLA 4N0BA 5LEKA 4HF2A 1YITI 3I4JA 4C9YA 3OYCA 4JYKA 3ABUA 3QPTA 2EB7A 2GXGA 3FXJA 4LW4A 2RVCA 3HTSB 3FVXA 2E7IA 4OIQF 2MLKA 4MTDA 2DOAA 1Y39A 2FOWA 1KMJA 2HXIA 2EIJH 1X1DA 2DOEA 2KRCA 1QRYA 5K1YA 1PP8F 2HEOA 2JA8J 3BCAA 2JGTA 5CQGA 2PB2A 1BBYA 3RPUD 3EUCA 2E35A 1RESA 3OL3A 4OAZA 1HKQA 1JTYA 1ELQA 2H6BA 1HW5A 5D6EA 4OIRF 5JFRA 2HZPA 4KIFA 3ZN0A 3V8LA 2JT1A 1XCBA 2K9SA 3ZQFA 4A3JJ 3ASBA 4JX6A 5E8IA 5LGTA 4S05A 1OISA 1EF4A 1AAMA 4DIQA 2EGYA 3WTYC 2DKJA 1R5HA 1WPKA 2RN7A 5JR3A 3FF5A 5IPAA 3CF5F 1K83J 2QA4I 4LG0A 1ZRDA 3RZDJ 4HVKA 1VNDA 1GLNA 2VASA 4QIWN 3I71A 1AU7A 3MWMA 2FMYA 2EH6A 4JK1X 1BM9A 1R49A 2W8JA 5FFXA 2F4IA 3BZCA 2OGEA 3VSKA 2CANA 3V7CA 1FG3A 3I0TA 1WI3A 1BJOA 2ZMEA 1P4AA 4F5LA 3RIRA 2Z1DA 1AOYA 2ZNYA 5ILUA 1OR7A 4HYEA 1BS0A 1AIAA 2BY1A 3K7YA 3JR9A 3SEQA 2ZXIA 5HS7A 5TGTA 2E34A 1YS6A 4XKCA 1T0FC 3GYHX 3OYIA 3K2AA 3WODF 2A69F 4G7ZF 2L3DA 1D7VA 2K9LA 1S9HA 4J8LA 4F5MA 1DJ9A 3BJAA 3HUGB 4B43A 2IS6A 4EJTA 2E1OA 1F5TA 1I1GA 1RR8C 2D1HA 2HUFA 3F8CA 1Y6IA 4X6AJ 5AX8A 3HGGA 5J6XA 2BZTA 2YSRA 4A3LJ 1TQMA 1VQNI 2ELKA 1P4XA 1T08B 3ASAA 3PQJA 4BJ5C 1D0YA 2Y30A 2RKHA 1N8PA 2RGVA 2HVQA 2FRHA 2WA0A 4NBQA 1SPAA 3GTOJ 4DYQA 3HBXA 1VQ9I 3WY7A 2LTPA 1IUGA 2CFBA 4F3QA 4BY1J 1PJRA 2K9QA 4G94A 3KP4A 1T6SA 5GADJ 3DV8A 4A3EJ 1SFOJ 4FQGA 3OYFA 3G2BA 2EWNA 5JHFA 2AY1A 2L7ZA 1FYKA 2XV4S 3J80K 2XF5A 4KDPA 5ICCA 3GTGJ 4B44A 4PVFA 3EQLF 2P7CB 2R7XA 1D1BA 1ETVA 2O5RA 1ASDA 1X1BA 2CJDA 2WY8Q 4C3HJ 3LVMA 4ENNA 1Y8RB 5JHUA 4F7ZA 3HSRA 2OKKA 2CH0A 3CJQB 1AKAA 2LLKA 5DEQA 4IRIA 1OXPA 1IN4A 5BJ4A 4G7OF 4EB7A 2HXOA 2BBYA 4L9VA 5IWQA 3HOWJ 5F8VA 4F55A 2LY9A 2X0LA 4CZZA 1D0ZA 1DP3A 2EJRA 3DC1A 1P92A 1QPIA 3TL4X 2CG4A 3OYDA 2JSPA 2EFPA 3CQZJ 2Q1ZB 2N8GA 5A2QK 2TDXA 4BACA 4CBSA 3MN2A 4XRFA 5D6FA 4L5EA 3O2PE 2HOSA 1EKEA 4BH9A 2VIAA 3FBIB 3I53A 4A00A 3OYHA 3PNTA 2R92J 4NUBA 3IRQA 2Q2EB 2V1UA 3OYKA 2E71A 4KT5C 5FKOA 3TOBA 3K28A 5E1WA 2OTLI 4A0FA 3ASOH 5DM7F 3CBFA 1YHQI 2M4KA 3H14A 2O8XA 3CJTB 2MC3A 2HYFA 1P6RA 3FZVA 2Y48A 1WJFA 4YFNF 3MBBA 1ASMA 3RSNA 4WXCA 1BC8C 3A01A 4XKVA 4D0PA 3VSLA 2GXAA 1XMXA 3PIOF 3B73A 4KXKA 1FBUA 3RJPA 4LK0F 2OQXA 4BA5A 1DFOA 3IHJA 3FXLA 4NC6A 3TEDA 2BI3A 3S17J 3EI7A 1GT0C 3BR0A 2M2EA 2QBTA 1FSEA 1AMSA 2DI3A 2QUFA 1BIAA 3E6DA 2W7KA 2YU9J 2D7ZA 3L8AA 1MIJA 3KX2A 4KA4A 2BI1A 5J8CA 4DBQA 2X6WA 4Q48A 4R79A 3A2KA 3KEQA 3HT4A 3WKRA 2A5WA 3BWNC 2WC2A 2HU9A 1XN7A 4HSRA 5AIQA 1AIBA 2ZSMA 3MD2A 1SAXA 4M74A 2PFBA 3FQ8A 3S3NA 4FX4A 2XBNA 1I50J 1OXOA 3QBOA 3KP2A 4PZJA 4LNMA 2VT3A 1R6RA 1JS3A 3FFHA 2VGSA 1TOKA 2IW5A 4XM3A 2VQHA 3LY1A 2FQ6A 1HKSA 2E5NA 4XOPA 3ZMSA 5DB5A 5FT4A 3U1KA 2FBIA 5J47A 5F64A 2VOOA 3E77A 3TDZC 2EPJA 5EUEA 4A5MA 4B1RA 2VMUA 3HRUA 2ECCA 4M9ZA 3ROUA 4OTLA 4DW6A 2JUCA 4ZC3A 4ZYGA 1ODDA 4UUSB 3OYNA 2K3PA 4Y17A 2Z67A 3KEYA 2M1BA 2QQAA 1LPQA 4AD9A 5J4VA 1RUOA 3AEOA 3QAHA 5E1XA 4UB6C 2VMOA 5EG0A 4IXAA 2RAEA 1X2NA 3CP8A 3NTJA 1EH6A 3J80Z 2VKHA 5K7HA 4LB5A 1WCMJ 5HLHA 1BW6A 5LD2C 1F43A 2Z2SB 1A35A 1B72B 4LLGF 3SDBA 4G7HF 4HRIA 2X1EA 1W7LA 1SFEA 4EJWA 4ATPA 2M7BA 3HC7A 1IDZA 2BW3B 3LFUA 4S0HB 1IVRA 3HHHA 3CMYA 1Y1WJ 3M8EA 1S29A 1WH7A 3A02A 4RBOA 1IRXA 2F6CA 2PJRB 3FK7A 2GWRA 4L0ZB 4P9UA 4XLEA 4BE1A 3BP8A 4FHTA 2FX0A 3QPLA 1Z7DA 5FJ8J 5FT8A 2F4MB 1MJAA 4EMYA 4OU0A 4KIGA 1QBJA 2K4BA 2EBIA 5IT3A 4DGTA 1BW5A 3B1CA 2DU9A 2HKOA 2HYGD 1HKTA 4WK8F 4E7LA 4ISYA 3KE2A 3NQOA 1ASGA 1D5YA 3HQTA 1J59A 4GE7A 2ZSIB 4HF0A 2Z99A 4BXXJ 3NYUA 3RQ1A 1B5OA 1JUPA 4OAYA 2HVRA 3PPLA 1OYIA 4D5CA 5HDNA 1K78A 3F6TA 1W3UA 3K9TA 1YFHA 3EUAA 2VGVA 2GAUA 2A6EF 2P6SA 4F52A 3LA2A 1DPRA 1LVKA 2W7NA 2YCNA 1MJBA 3AATA 4UHMA 3HZJA 5HNFA 2CY8A 3DBLB 5LRSA 4RGXA 2D65A 2Y0MA 1IAXA 4UHOA 5EFSA 2VQGA 5BJ3A 4XLNF 3ACZA 4PFPA 5IYDJ 1BR4A 4PDKA 2RQQA 1KQ0A 4XEWA 3IV5A 5J4YA 2HTSA 1N77A 2W82A 4CICA 5HDKA 3OP7A 3BROA 1BJAA 4B48A 1SFUA 4A0ZA 2LBFA 4OCAA 3VK2A 3ECDA 2Z9OA 5DUKA 5EIGB 1H88C 5ED4A 1ZG5A 2KL4A 2A3SA 3NU7A 4WXBA 2ZFWA 2DYSH 2ZFUA 3JTHA 3FXRA 4JQFA 2RV8A 2OTJI 1YX5A 1U5TB 2YRIA 5K5OA 2Y75A 1NK2P 1Y0UA 2DFIA 5HVQC 2WK7A 2LP0A 2V1DA 3CLOA 5IOYA 2FU4A 1QVTA 4FFCA 5F6FA 1I48A 1T33A 1FBSA 1VQMI 3GBXA 4A0YA 1DGWY 3DPTA 1EA3A 3WGBA 5E3KA 1KONA 3CQ4A 3IF2A 4BDYA 4HA8A 1P7IA 3R60A 2WAQN 3FXQA 2V4JC 2JRMA 2DPUA 5FLMJ 2R5ZB 3S15J 4E7JA 2M4GA 3SFZA 3FZ6A 2WK8A 2H1LA 2DA3A 4WWCA 4ZJZA 3U1DA 3SHFA 2H27A 4IHSA 1C7OA 1MSEC 1BR1A 1TT0A 1X2AA 1TLHB 4AH3A 1U5TC 2R7DA 3FISA 1WQ2A 5CVIA 4G12A 1YJSA 4CA0A 4MQQA 3O3KA 3B1EA 5K8BA 2VMQA 5LHHA 1ON2A 3H35A 3Q0VA 3CO7C 1E5FA 5FKMA 2E2HJ 1O62A 2R7QA 3IWFA 3KP3A 3D1NI 1XEYA 1Z3ZA 1O57A 1P3WA 2A6TA 2XPWA 3GWZA 3EYIA 4Y15A 4XNFA 2DXIA 2RQPA 3RI6A 2A05A 1F4KA 1DP7P 2AS5F 3WZFA 4G6DA 5B1BH 1K79A 3CQ5A 3G4SI 2CFXA 4XKBA 2LF8A 4U88A 4ITXA 1FNNA 1TNTA 2E5ZA 2XDVA 4PJMA 2DODA 4YG2F 4BNCA 1CL2A 1FTTA 4YFXF 4XJMA 4XL9A 3CESA 4D9JA 3S1RJ 1CF7A 2GB3A 2DK5A 1G8XA 1R36A 4KITB 2JN6A 1IAWA 4NB5A 2V1XA 1JS6A 4I7HA 4ZZDA 1FIPA 4M73A 3BPVA 2CQKA 3ISPA 5FFZA 3I58A 3II0A 2ZJRF 1WYUA 5EEHA 4GYIA 4BL0B 3F9KA 3LSPA 1PUFB 5HLIA 2YKYA 4QTRA 2QBYA 5BS6A 1ETYA 2GOMA 4IY7A 4C3JJ 1IZ1A 2DT7B 2M0CA 4B09A 4IHTA 1XD7A 2MABA 3GFLA 3DFGA 1DKAA 2QZ8A 4Y0HA 4BE2A 4BQNA 2F4OB 1LFBA 4C2MJ 1ETQA 4A3BJ 5FLXK 3BTIA 2CH2A 5I92A 3BG7A 5LGUA 4UQVA 4IHWA 4ZDPA 1OCTC 3DEUA 3HRTA 3TO7A 3GZ5A 2HFHA 4GO1A 1TWGJ 3V42A 1DU6A 4UVCA 4JE5A 1A31A 2XPVA 2E19A 5FD6A 3BG9A 1KQ9A 2WAFA 1CQTA 1TC3C 4XJLA 2OV7A 3JRIA 1GXQA 2QKMB 1UZCA 4XK1A 4OYTA 4RJYA 2DAOA 3WE3A 3A9XA 3NUIA 3P6KA 8AATA 5KK1A 3O6BB 2KJBA 4CGZA 1V2EA 2ME0A 2M45A 3UAKA 1Z9CA 1DJEA 4XR6A 4UV8A 3PAAA 3HXLA 2X1CA 2AY4A 1YLFA 2JJ7A 2Z9XA 4XBFA 2DOUA 2ZYJA 1G3SA 1LNWA 4ADEA 1LC8A 3ZQCA 5BOXA 1ZG1A 2FEZA 1DTYA 1SZKA 2XGDA 2Q8KA 2O7OA 2VMPA 3AEPA 1SFFA 1S07A 4CSWA 4ANJA 1JT0A 4X0GA 1A04A 3L1PA 3DKXA 5E4ZA 4Q76A 2KP6A 2XSJC 1IDYA 1ZLKA 2QSHX 5E3NA 1AJSB 5LLQA 1QJ3A 2ZP7A 3DU5A 2NXNB 4I8AA 3HRSA 5J1UA 2VONA 4PFFA 2FOKA 3HMUA 3FQ7A 3QN6A 2R7TA 3MCZA 3LV2A 2XAUA 4HF8A 1CQ7A 2O1BA 2NOGA 4PJJA 4GRXA 5J8QA 3R0JA 2E60A 3CDIA 4GGGA 1V2FA 5LRRA 3X2QH 2R5YA 3RPQA 3FIWA 3GBGA 2Z33A 4O3MA 4BQAA 1QGPA 2FD5A 2OAZA 4XSXF 2L4MA 5B5EC 1MMSA 1USTA 1C7GA 4Y0IA 4CBRA 3VFZA 2W7GA 3FMRA 5G4JA 4YIIA 1U08A 2VBXA 1N31A 1IX7A 1YRNB 1LFPA 1G4VA 3UKGA 1ASCA 4UHNA 1OQYA 4A3FJ 2KISA 3TW7A 4HDVA 3BPXA 4AC0A 4GDFA 1QZZA 2Q7WA 5B3SH 1ASAA 3N05A 1TASA 4A3DJ 1T8IA 4OOIA 2L02A 2BI5A 4LMYA 3K40A 3K4MA 5CVRA 4FISA 4MEYF 4F5IA 5CVVA 5C6UA 3PDBB 1XGNA 3BG5A 1X58A 3QYFA 4M9XA 1T38A 2VMYA 2VYCA 2BYLA 2EZIA 1TW3A 4OBVA 3NUBA 5EGOA 1Q1VA 5EYRA 2DFFA 5FKLA 1NG6A 4A93J 2I10A 1PDNC 4G6QA 2KDZA 5E20A 2WV1A 4EFFA 4AIJA 1P2FA 4PGGA 2M0MA 2L2OA 2CB1A 3TQNA 2GQQA 2L0KA 2ZXHA 4HQMA 3J7ZI 3FHNA 3I54A 5D5UB 3SZPA 3DU4A 3ZRGA 1KYZA 5KAIC 4RLGA 4K2MA 1VFCA 1WRJA 4Q75A 2HDDA 2CSOA 3A2BA 3SJMA 2VMTA 2OATA 5FLXZ 1H89C 1XS9A 1P9QC 4LLLA 2VI8A 5C3EJ 1E3HA 2TPLA 3L2VA 2EZLA 9AATA 4MEXF 5E3LA 2W00A 5L3EA 4MIMA 4B9BA 1Z1DA 1X0MA 4EMSA 2PB0A 4OMAA 1RR7A 5EEAA 2EZ1A 1S09A 3HOVJ 1D0XA 1IGNA 1W7PB 1VQ6I 1FG7A 4OMYA 3JTGA 2K86A 1OYYA 1S6LA 2G0EA 2IA1A 5M4BA 2XROA 4PSXA 4AUXA 4A3GJ 1BKGA 1QZ9A 4LC3A 2JA7J 1PP7U 1JHHA 2O0RA 1GUUA 2KIMA 5ICGA 4KMFA 3KE3A 4W97A 5FB2A 1D3YA 4RAZA 2DMUA 1BL0A 3MMYB 5GP9A 1RETA 1X4OA 3EUHA 1IUYA 1KKJA 3H9GA 2DQRA 2XAHA 3GLLA 2X51A 1K6YA 4HOBA 3S8PA 3OYBA 4OC9A 3HOZJ 1VQ8I 4D5FA 4WLHA 4LIUA 1MBKA 1QZEA 4I01A 1ARSA 4ETSA 3QODA 1MGVA 5KNLA 2NYXA 2JK3A 2NVUB 2IS1A 1GEWA 4WYDA 2VPLA 1A36A 4JEXA 1R00A 2WADA 1D1CA 3PQKA 4BQ0A 3R6SA 2E2JJ 1V5EA 4ZDOA 1SF2A 1WGXA 1KKPA 2HOZA 2XAGA 2J5PA 2AY3A 3ZOBA 5DDGA 3HDDA 2DA2A 2E7XA 1CZCA 3AEJA 3UNGC 3PFIA 4ITVA 2JWTA 4A6DA 4WXGA 2DW4A 4N4OB 5EUNA 3ERMA 1YQAA 3JRAA 5BMZA 2IBDA 4A6EA 1RUNA 2AXLA 4IX8A 5LHGA 3L2CA 2BYVE 2H09A 3F0HA 4WYCA 2O7CA 4FX0A 1Y8QB 1JUMA 2M8GX 2MYSA 2W24A 3DR4A 2CYYA 3ECHA 5D5WB 1B8GA 5L3GA 3RCHA 1BOBA 2VJ5A 2FNPA 4KUMA 2Z9WA 3PM1A 4IQ4A 4XIDA 2R7WA 1O3RA 5EJCA 1T98A 2EIMH 2IS4A 5G09A 2L7KA 2G9WA 3EI9A 3EZ1A 2BWPA 1WHUA 3I5UA 2FE3A 3IH2A 4GRIA 1E0EA 4XSZF 4MSOA 4EM2A 3MAJA 3W2AA 1WKHA 2AY8A 3FTBA 3ZMZA 4M6XA 1I1SA 1YIYA 2PLYA 2KHMA 1LKXA 4KYWA 1B5PA 3WGHA 3S32A 3EZSA 2O0YA 4HX7A 1M6SA 2X3LA 2VE9A 3ZQ7A 2PMZN 2DMNA 2ZJ2A 1UMQA 4XN0A 1B8IB 2ZJPF 3CDLA 4CDGA 2VI6A 1YW7A 1FPQA 4O6ZA 4W5KA 1X3WB 4PGHA 1TL8A 3F6VA 1JKRC 4U0WA 3IUOA 1AX4A 3CCLI 1M4NA 5CVJA 3GTMJ 2C7TA 3NDNA 1G3WA 1PYVA 2WAQA 3L2UA 1LDDA 2Z20A 2QKLB 4HZFA 3P1TA 4M2JA 2CH1A 2VT2A 2Q0OA 2PBIA 4M72A 1QVUA 3CC2I 1LW5A 4MNUA 3MADA 5M49A 3QI6A 1ASLA 5M3FJ 2K27A 5HNHA 2OZ6A 5CVUA 2BYJA 1SVOA 2AY9A 3GMEA 3JU7A 3AKZA 3ZRPA 1T95A 3S3OA 4ESBA 2F48A 4JE5D 3HKZN 1U8RA 2CJGA 4ASNA 1C9CA 3KEOA 3KCCA 2CJHA 4EB5A 2GSAA 1AHXA 3LA3A 5D8LB 4CYDA 3LSHA 4AVPA 1MJ9A 2LDUA 2BY0A 2ZNZA 4MFDA 2DR1A 4P7YA 3AOVA 1AY5A 4AOAA 4WB0B 1Z77A 2R7OA 1SANA 3LWFA 2H6CA 4EEFG 4RB0A 5BQTA 1LB2A 2IA2A 2XGCA 2YS9A 1WJAA 2P8TA 3PSIA 4CH7A 2HNHA 1G2HA 1O7FA 3E6MA 1HBXG 1AMQA 3TFTA 3ELEA 2CQ7A 4PUSA 2XKPA 4JX4A 2QB3A 3COGA 3FXUA 4CVQA 4GXOA 3M7GA 4WYFA 3Q0UA 1ZR4A 3ABMH 3ASNH 2PJPA 1REPC 1QNTA 1JXSA 1MMDA 4A0XA 1G59A 1AICA 4JF1A 3H5NA 3F21A 3JZLA 3KETA 3QP6A 1RZ4A 3OSGA 3EI6A 2GMUA 3DQVC 1AMRA 1E3PA 5DJ1A 1H9TA 3H9JA 2FYFA 1GV5A 1BIBA 5EAAA 1EJ9A 2R7ZJ 4IHYA 4MFEA 4ZSWA 3BTCA 2I5UA 1B9HA 1CS1A
chains in the Genus database with same