4N0BA

Crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
473
structure length
468
Chain Sequence
ITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKETGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription activator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 133
structure length 468
sequence length 473
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n0bA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0bA02
4L9NA 7AATA 3QPGA 5JAYA 4QGRA 3F8BA 4TN4A 3F21A 1WKGA 1D8JA 4AIKA 4RJ0A 2HYFA 3AENB 3FQAA 1YQAA 3G8MA 1OYWA 1N2TA 1B6AA 2WK7A 1O3RA 5E4ZA 2W7MA 2VXZA 1J0RA 2AY8A 4E1OA 2DPDA 4ESFA 4R2NA 4XSXF 3R0AA 3VOEA 5LLQA 4W8IA 3DRDA 1EH8A 3WTTC 3KFWX 4MSOA 3RBFA 3VK2A 3GFMA 2AY2A 2R5CA 3TATA 3GBXA 4A2UA 3K7YA 1Y0UA 3UWCA 4N9IA 1GXQA 3ABTA 3NEUA 2E54A 2EZ1A 3BC8A 1ZN2A 5JVTA 1TQPA 1QZ9A 1TNSA 4FFCA 1TQIA 3QI6A 2QLRA 1W7PB 4EQQA 1LS3A 1IX6A 2D2WA 4K2EA 3E5XA 4EU1A 1WYTA 1IJIA 1L3LA 3B8XA 4WYAA 2Z3YA 4O5VA 2ZKZA 3WTWC 2MLGA 4PGHA 2KIUA 4CGZA 1IX8A 2GMSA 3F8FA 2ZCWA 1OYYA 1LNWA 1OHVA 3JAMK 2BBYA 3MAJA 3GETA 1BJNA 3PQJA 4JF0A 1YG2A 1C7NA 3M8EA 1S07A 2PJPA 3E6MA 3MBBA 3HRUA 1GC3A 3IC7A 3E2ZB 1SMYF 3PD6B 4A0YA 2YX7A 3W6KB 3VAXA 4KIFA 2MA3A 2YHKA 4QLCU 1ASLA 3V8JA 3HTSB 4EJWA 1A04A 1WQ2A 3GF2A 4FT8A 2BV6A 2NNYA 3W1HA 3FMQA 1TW2A 3HOSA 3LV2A 1FP2A 5ILVA 1EJIA 3KGWA 1CGPA 1PP8F 3WE2A 1BJOA 3BP8A 1O57A 4PGGA 5IT9Z 4AO9A 2JJGA 3WGHA 2YRRA 1ZG3A 2RGVA 3FTBA 3I4JA 3HIFA 3WTZA 3K0LA 5IWQA 2YKVA 1R1VA 4HV5A 4EJOA 2DPUA 1R00A 3NU8A 2GZWA 2IT0A 3TOAA 1BS0A 2HUIA 3QHXA 5KK1A 1QGPA 2W7KA 2BIAA 4JEZA 4L18B 3T1BA 3LSTA 1ASCA 2E1CA 2JPCA 5K5RA 4R79A 1ZRCA 4OU0A 3P9CA 4HQMA 1S7OA 4HOBA 1P4XA 4I0AA 3J80Z 4UVAA 1GXPA 2A5YB 1N31A 3JW9A 4OOIA 3IRRA 2Z33A 2DKJA 4MTEA 4GRXA 1KU2A 1ZODA 3HOTA 2CY8A 4P7YA 3WU1B 2VBZA 4PFFA 3WTYC 2RV8A 2JISA 4WCGA 2DTRA 4GE9A 2BI1A 1GCKA 3COAC 5FT4A 1GC2A 3I59A 3KZYA 3L2CA 2BYLA 2ZSLA 3N5MA 3ZN1A 3NTJA 3MC6A 2GQQA 1I48A 4P9FA 2PB0A 1K6OA 1WYVA 2C44A 5ICCA 3Q9VA 4KAMA 1BIBA 3KP6A 1W3UA 3WGBA 1PFFA 4YFXF 3P1TA 2LF7A 3CUQA 3ZP5A 4DBCA 5L3DA 2K4JA 3L09A 5D4SA 1VEFA 4DQ6A 3P7NA 3PD6A 1IBJA 2ZMEA 4EGZA 1TOKA 3BV0A 3BY6A 2PG4A 1M0PA 1YIZA 3NUBA 4JE5D 3AOVA 2QUFA 1AIAA 4EB7A 1W7MA 4EMYA 4MY5A 1IXCA 4WF2A 2Z5UA 2VGUA 2RNJA 3D0SA 5FFZA 3RUYA 5CLSA 2RC4A 4RS8A 2R0TA 4ZDPA 1Z05A 1LEBA 4BQ0A 2M87A 4HF0A 2FQ3A 4W1VA 4WYCA 3V8LA 4RJYA 1HQCA 5IT9K 1D2FA 4WWCA 2M30A 1SFFA 2WV0A 1Z91A 5FT8A 1B59A 1TTYA 1YW7A 2M1BA 1MDXA 1YJYA 4XJOA 3NNKA 4AD9A 4ZZLA 1U5TA 1QJ3A 4XJMA 4GDYA 4XLPF 3RJPA 1I43A 2PBIA 5BS6A 1AMSA 2VMYA 4UHNA 4CDGA 2W7LA 1JS3A 4KIGA 4OMYA 3PPLA 2UZKA 2D45A 5ICFA 4A0XA 2STTA 3QRFF 4JE5A 5G2QA 4HX8A 5A2QZ 1AICA 4MGRA 3HTUA 1BBYA 4P5OA 1U78A 1R58A 2HP1A 4I7HA 2JGTA 4RB0A 1ZLKA 1Z6RA 2IW5A 4ZYHA 2QMAA 4WYGA 1B5PA 4ZYEA 3ZMDA 1ULYA 3WGGA 3ZRQA 3E2YA 3JZLA 5EAAA 2VGWA 1W7PA 1S3JA 5L3FA 1IVRA 4ZM3A 4EM2A 3CUQB 3FQ8A 4KNYA 1V4RA 1FBUA 3T0YA 5EUNA 5FLXK 1CS1A 1ORDA 2ZUKA 4R8HA 3V8KA 1R1UA 3JW4A 1P4AA 3KEOA 1KL2A 3ACZA 4W1WA 2XIGA 4LNLA 3E6DA 2BYVE 2BE5F 1Z9CA 4EGYA 3FQ7A 3I59B 2GA1A 5AIPA 5DDGA 1T38A 1TARA 4CXFA 1FSHA 1M32A 4B8XA 2X4HA 2F5CA 1ARHA 3PQKA 2YCNA 4RLGA 3ZMTA 3LQRA 2EV6A 2PI0A 3RTRA 2AY6A 3L9FA 3I5TA 1SFEA 1DJUA 4BA4A 2IA2A 2D65A 4I09A 5L3BA 4ITXA 3BPXA 4YG2F 5LGNA 3AEPA 1FBSA 4U7DA 4RKCA 1HBXG 3KE3A 5AONA 4JF1A 4CZZA 2FBHA 4UXNA 1P2FA 4S04A 1PG8A 4Y15A 2ELHA 5D6FA 3F0HA 4GE7A 2B0LA 4A0RA 1LC5A 4ZAHA 3L44A 2AY5A 1QGNA 1GDEA 2PQ8A 2FXAA 1R36A 2UWMA 5E8GA 2OGAA 1FC4A 5DUKA 1L0OC 3EI6A 4A0FA 5LEJA 1R7JA 4Z2YA 5DUIA 3LA3A 2YKUA 4AIJA 2XAJA 1SD6A 4N0BA 4ETSA 3NYTA 2OKKA 4OYTA 1IXRC 4OTLA 4FX4A 1OATA 4IXZA 2VT3A 3B46A 5CVJA 2V1XA 4IJAA 3JTHA 2DGMA 2VMTA 5K5OA 3KE2A 4ZYDA 1H0CA 3MC6C 2XRNA 4WB0A 1BJ4A 2QM3A 1JE8A 1S09A 2HZPA 3LA7A 3E5UA 3ECOA 4CBRA 3EUCA 4BHCA 1I29A 2GB3A 3EI7A 2HS5A 2OBPA 1SVVA 2WK8A 3L00A 1DFOA 1UFMA 2ADUA 1YO5C 3ZMUA 1B8GA 1GVJA 1XCBA 2MD5A 3FXRA 2H09A 1V2EA 4XBFA 4ITGA 4L0YB 3E6CC 3NX3A 4RB1A 1YYVA 1J5YA 1JHFA 1AWCA 4XSZF 1C0NA 1KMJA 4ZWVA 2QBYA 4WXHA 4PFNA 3CUOA 1AMAA 3A2BA 4WB0B 2CSTA 4CHUA 2XASA 3I54A 1EH7A 4AZKA 4BYYA 3WTXC 4HX4A 1XSVA 4MTDA 2BWNA 4JEXA 1QJ5A 1E5EA 5D4RA 4P55A 5D95A 1H9TA 2R5EA 2BHXA 4ENMA 2R5CB 3F8MA 5FD6A 3NDNA 3FKDA 1IZ1A 4Q31A 4LD5A 2V6CA 1B4XA 1XEYA 2K7LA 5EUEA 1IN4A 1O69A 4EFFA 3KGXA 4WYDA 4N9HA 4UVCA 4IX8A 1ON2A 1P4WA 4UHOA 2BWOA 4KA4A 4HVKA 3OKSA 5IT3A 4ASNA 4JEYA 3NUIA 2HKXA 2OD5A 2P7CB 2NYXA 4EMSA 1V72A 3MQ0A 2HFHA 2EB7A 2HP2A 3FVSA 2A6EF 5CVRA 2ACJA 4AH3A 3AEMC 2XGXA 2QQBA 4Q5SF 3L7WA 4KUMA 4G94A 4Y0DA 2M8EA 1SF2A 2D1HA 5FB2A 3KCCA 2W8UA 2OA4A 2QB2A 5LBQA 3GZDA 2J5OA 4P3MA 1MLYA 2WC2A 4EJTA 2O7CA 1MAPA 2H94A 1AIBA 2DQLA 2F8JA 3GW2A 2VMWA 5E5IA 1ZYRF 3WZFA 2D7ZA 1PP7U 2LF8A 5J8FA 2MH9A 4A12A 4IF4A 4JEWA 2DI3A 2W7GA 1J32A 4WYEA 4WXFA 2EO5A 2QBTA 1O7FA 2BI5A 3MADA 1T2KA 3RCHB 2JRTA 3AEOA 4RGXA 2CW0F 1ASMA 1LEAA 2W24A 1YIYA 2EFQA 1C7GA 5DCMA 1J04A 4DGTA 1G4DA 4GSAA 1E17A 1SZUA 3MZHA 2DOUA 2VGTA 3KLOA 5LGUA 3BCBA 1IN6A 4UHMA 3DU4A 4MQPA 3U9GA 4O6ZA 3KP4A 1IXSB 4MQQA 4KMUX 1XMKA 2XKPA 1TASA 1J75A 3EI8A 1DJEA 3EUHA 2VI9A 1AHYA 1CZEA 2OU2A 5JI6A 1TPLA 4G7HF 1S7AA 4RGUA 2DO7A 2X0LA 2PFBA 3G3ZA 3W6JB 2CJGA 3BOQA 1DP7P 2E7WA 3O2PE 4A72A 2Y48A 5E1ZB 3EQLF 3DODA 4MQVA 1I6XA 1NHAA 2EPJA 3JTGA 1X3UA 5CYVA 3LAPA 2X5DA 4ZASA 4CBSA 4L5JA 1IF1A 3F8CA 2CSOA 5J8QA 2KJBA 2BIGA 3E9KA 2DK5A 4MQ9F 4BH9A 3RKYA 2VMQA 2VIAA 3EETA 4KN4X 3SQNA 3DXVA 3CO7C 2EZ2A 5M4DA 3WGCA 1KQ9A 9AATA 2WTEA 2COMA 4L9TA 4J5UA 4ESJA 4JEVA 3E97A 2VMVA 1BM9A 2AY1A 2DW4A 2EWNA 2HWVA 3F22A 3ERED 4ZDLA 3TKYA 5M46A 1FNNA 2VBWA 2XAFA 1FYMA 4UUVA 3BB8A 2A61A 2VMSA 3RYPA 1YFHA 3BWNC 5E1WA 4NQWA 3IL2A 3FM5A 1USTA 2FNPA 4BNCA 2Z1YA 1DPRA 1HW2A 3T32A 3NRAA 4HDUA 4JQFA 2KKOA 3BPVA 3LVJA 4U88A 4HQEA 2VBXA 2K02A 1R23A 3E6BA 5DX5A 2MLKA 3V7RA 3F6TA 2FSWA 2XAQA 2Z9OA 1B9MA 2Q7WA 4GCVA 2PLYA 4UOYA 1U6GA 1AOYA 3EZSA 3S2WA 4HW0A 5AIQA 2LSOA 2GSAA 5G4JA 1UHMA 4A0GA 2W7DA 4PVFA 2TPLA 1SD5A 2DAOA 2W85A 4I01A 2ZC0A 1LVAA 2A69F 1E5FA 3AAFA 3RCHA 2ZMEB 2JPBA 2JSCA 5E17F 1AHGA 1U8RA 1MZBA 1U2WA 1GHCA 1FSEA 1MJ9A 3MAFA 3WU0A 3II0A 3F8NA 3GVAA 1QIRA 3FZ8A 4K2MA 3C1DA 4KYOA 1B1BA 1ECXA 1B9HA 5LH9A 2JJFA 1W5TA 2FNUA 1G7WA 3DC1A 3GR9A 3HT4A 2ZP7A 5D8LB 3LVMA 2CB1A 5G0AA 5HS8A 1BT4A 1QBJA 1RVYA 1QZYA 2F5FA 1S06A 1TBXA 4Y13A 1X28A 3FRKA 2HTJA 1ASDA 1BI1A 2ZYJA 2Q8KA 1MDZA 4L5IA 2P4WA 5HLIA 2C6YA 2GXBA 2HOXA 4XAUA 4WXDA 1ARIA 3ULQB 1YTYA 2K4BA 4MNUA 3QBOA 4WP0A 3FX3A 4G7ZF 3HBXA 2WKAA 2YCPA 4WXCA 2CQKA 5D5SA 2D61A 1D3YA 2ZO4A 1WWXA 2EFNA 1ZOBA 1G4XA 1FPQA 3B02A 3LWSA 3IWFA 2X3LA 3HL2A 1G3SA 3DYDA 2CGPA 4YIFA 3QPTA 3K28A 2BEOA 3E77A 1ARSA 2GQNA 3FXUA 4I8AA 1BQDA 5G4IA 4QWQA 3DP7A 1GEYA 2W7HA 1TATA 2CFXA 3F3XA 3ABUA 1BI3A 2W7EA 3RQ1A 1KU9A 4M9ZA 3FHZA 3DQVC 4A6DA 2V79A 2QLZA 4OBVA 1TLHB 1IX7A 4MEXF 1BJOB 1QITA 2O6GE 2ZJ2A 3COGA 3WX9A 2Y75A 2DKBA 2JJHA 4BHDA 2DFIA 2DGKA 3U1DA 2IP2A 5D5VB 4NB5A 1F4KA 1IRGA 2VIBA 2L02A 2VODA 3HSFA 1YJZA 4Y0IA 4XLNF 4LB5A 1YAAA 2D64A 4I2OA 2ZXJA 1O7LA 4CO8A 3PDBB 3BROA 3IHUA 2W57A 1HKQA 5LRSA 5FGMA 1Z7DA 1ASGA 3T8RA 3FSLA 1OXOA 4ATQA 3GFIA 1XGOA 3OP7A 2VLFA 2L4AA 1IN5A 4ON0A 3R9AA 2KJCA 3LWFA 4LMYA 4U0WA 4RB3C 4IYOB 1M0QA 2V1UA 3MAUA 2D5YA 1BQAA 4F4EA 4RAEA 4R1HA 1G6NA 2J5PA 1ZRDA 5AX8A 3TO7A 5BPDA 1I1SA 3GWZA 4Q76A 1CZCA 4OINF 1V2DA 1LQ1A 1RVUA 3N4MA 4BAYA 4OIOF 2LKPA 3EZ1A 3K1NA 3F6VA 3MFKA 3GLXA 5DJ1A 2R7FA 2KIMA 4M2MA 5KVRA 1TOJA 3USFA 3I53A 3OV8A 5TJJA 4IRHA 2A3SA 3F72A 3DXWA 3J81Z 2DK8A 2EV5A 4Q4ZF 1FY7A 4A6EA 3BN1A 3KP5A 3WLXA 4E3RA 1FG3A 3DR7A 2HR3A 3AEJA 1M0NA 3TO9A 4A5MA 3RYRA 2F5EA 1J9IA 2RQPA 4A6UA 4CXRA 3TO6A 2ZJGA 3IRQA 2OATA 2F5DA 1Z3ZA 5DD4A 2JT1A 3F9TA 2VMUA 4EVIA 3CTAA 1OR7A 2VMRA 3WG9A 3BWOA 1M4NA 2YSRA 3VEPA 1RV4A 4A0HA 4ZZDA 3V7CA 2VOPA 3TFUA 1V3FA 1OHWA 1XI9A 4E77A 1CQ8A 2XKOA 1RZ4A 1WKHA 1EG5A 3DR4A 1ZH5A 4AWXB 1JXSA 3PA9A 1WYUA 3HVYA 4RM1A 3R0JA 4UQVA 2HEOA 1BKGA 1RIOH 3T5XA 4I02A 1ZRFA 4F5MA 5D8KB 4AZJA 4IXAA 3DPLC 3HSEA 1WI9A 4ZH4F 3PDXA 3HRTA 2E1NA 1S29A 3IWZA 1AJSB 3ECHA 4FHTA 4IW7A 1JS6A 2ZSMA 4LG0A 4HF1A 3GZ5A 3CQ5A 3CDHA 4OIRF 4U2HA 2L3DA 2OQGA 1T0FA 5LRRA 1AY4A 2RKHA 2DR1A 2UXNA 1LDDA 1LW4A 3WKRA 1XN7A 1K78A 2STWA 2PB2A 1HW1A 3RDIA 3CO6C 4KN7X 2EH6A 4PDKA 4IRGA 5DB5A 3WCNA 1U5TB 4JBAA 3R4TA 1IW7F 3FWEA 3R4KA 3IKTA 4EM0B 1W23A 3AOWA 4OBUA 5CVIA 1ONVA 1IAWA 2OKJA 5JR3A 2ISZA 1KU3A 3FF5A 1RNLA 2MC3A 1D7RA 4PIWA 1WKMA 5F6FA 3VB2A 2EA2A 3B73A 2PMHA 2C0RA 2W8JA 3M1EA 4R5FA 3AV7A 1D8KA 1FYLA 3LG0A 2VE9A 2IRFG 4LNMA 3IF2A 1HW5A 1UU0A 2P7VB 4A5NA 2CTZA 5J8CA 1SMTA 3CJNA 3NYSA 2P6SA 3GFJA 2VC0A 3M8FA 1ASNA 1O3SA 1DUXC 1SAXA 2FF4A 2CANA 2YRIA 4CICA 2L01A 1VJOA 4A6TA 1K7AA 1O61A 1B4AA 2EJRA 1UU1A 2FOKA 5HDMA 1FX7A 3FMRA 3SXYA 2HQNA 2VMNA 2CO5A 3RI4A 4ENKA 1CJ0A 1SD4A 2YPRA 3KEQA 3Q8NA 2FU4A 3FZ7A 2DLLA 1UHWA 4M73A 1AHXA 2QQAA 2VMZA 2DBBA 2IA0A 2L54A 2FRHA 1T39A 3HSRA 2ETHA 3FM3A 2JZYA 3TGNA 3WODF 2H6CA 3Q9SA 3MAFB 3AEMA 1IN7A 3RPUA 1ARTA 1MJAA 1QQIA 4AIHA 1GEWA 2H6BA 5FO5A 1DPUA 4HF2A 1WYVB 2OQXA 1EQBA 2Z61A 1WSUA 5LHAA 4G7OF 2PO3A 2PEXA 3WCOA 3JAMZ 4IHTA 4ISYA 3R60A 3VODA 4LNJA 3LAJA 3GSBA 1SD7A 4DQ2A 2EFWA 4CXQA 2BWPA 1HXDA 1MD0A 2D1VA 3WTVC 2AATA 4HF8A 2E7XA 2QBYB 1WSTA 4YFNF 1P6RA 5J6XA 2AEUA 1AAMA 3HMUA 1LB2A 4MQRA 4IRIA 2HTSA 3HLMA 1B9NA 1DTYA 2IVMA 3J81K 2K27A 1ELQA 1DDNA 3EYYA 4M71A 2HGCA 3LQQA 3FXQA 3K69A 2AXLA 1GD9A 1UKJA 1GC4A 3NYUA 1AHFA 5EAVA 4L9VA 3G0TA 4F5HA 1XDUA 5F8VA 5FFXA 2IJLA 1SZSA 3JSOA 1D7SA 2BI9A 1ZHFA 1S08A 3UAKA 3K40A 4GXOA 1YIOA 2VI8A 2EA4A 1M6SA 1FLIA 4UNOA 1FG7A 2CH2A 3EI5A 3A9ZA 3ML6A 2ZBKA 2GXGA 4D0PA 5E3KA 2X8UA 2AEVA 2HORA 2CJHA 4RAZA 1GC0A 3VK4A 3FFHA 3RPQA 5HOOA 2V0YA 3LFKA 2Z67A 3DV8A 2CINA 5H6RA 1C7OA 4G9YA 1GBNA 1JG8A 1YW9A 5DCFA 1C4KA 2UXXA 1QPMA 2W7JA 3J80K 1UU2A 1SFXA 1QZZA 3RIRA 3CQ6A 5F9SA 3TOBA 1OXPA 3M7GA 4O6JA 1KYWA 2QZ8A 4U0YA 3R6SA 3HDOA 4UV8A 5E8IA 3KKIA 2AY9A 4RKDA 1R5HA 3C7JA 3WTUC 4B98A 1USSA 5F1RA 1KQ0A 2VOOA 1G7XA 5DCMB 1C0WA 3IKVA 5L3CA 1BJWA 3GJUA 2VN2A 2Z1ZA 4P96A 2P5LC 3NQOA 5HLHA 3N75A 4UHTA 3E2FA 5HVQC 3NU7A 3BJOA 4M2JA 1LDKB 2D63A 2BI3A 4MKKA 3GZCA 2KRFA 1W7NA 5FD5A 1B5OA 4F5FA 2VMPA 2YKYA 2LNBA 1REPC 1WYUB 1QNTA 3L8AA 2VC1A 4WBTA 2CWEA 4LK1F 3EI9A 3FFRA 4EM1A 4KDPA 3ELPA 3LVKA 3SFZA 2YKXA 3FZ6A 1TOEA 5DD8A 5HHYA 1MKMA 2M5WA 1P92A 3J7AO 5ICGA 2KIFA 1U3EM 3AELA 3A9YA 3DXJF 4HA8A 3ROUA 4M74A 4LG0B 4ADBA 1XSXA 5DV5A 3AENA 3NRVA 5E20A 1RI7A 4GEBA 3DPTA 3JU7A 3I4PA 1ASEA 1AY5A 5FT5A 5HXXA 4ENJA 5K8BA 1BW0A 3D5LA 4RAYA 3EYIA 2O1BA 2QVOA 3AEJC 2PMUA 1TNTA 2WK9A 1LC7A 3K1PA 3A9XA 5L3EA 1W4MA 1KYZA 3JWBA 3H7FA 3RKXA 2OZUA 2JTVA 3GYHX 4MEYF 5H20A 4HX7A 5HS9A 1XD7A 2HYGD 2EV0A 4IYOA 1IUGA 3PJ0A 2NS0A 4BHBA 3K1MA 1H1CA 3WTSC 5D5WB 4HV6A 3I16A 3K2ZA 1O4SA 3HUGA 3B1EA 3PIUA 1LW5A 3LA2A 4KICA 2QYOA 4H0EA 4PZJA 2O61A 5D5UB 2XHKA 1EH6A 2Q0OA 4XJLA 1JF9A 3FD0A 2P8TA 1B9IA 1AMRA 1BI2A 2AS5F 1FZPB 4FX0A 4BQAA 2O0YA 3JWAA 5LEKA 2A6HF 3MWMA 3QOPA 1HKSA 4EJUA 4MHGA 1OMIA 4YIIA 3WGIA 2OZ6A 2VE8A 3FZVA 3MEBA 3TQNA 4UV9A 1M7YA 2C7TA 2FNIA 1DGDA 2IA1A 3O3KA 4IHSA 1AX4A 1R5GA 1KA8A 2FBIA 3N0LA 2HOEA 5M49A 1T6SA 4M2KA 5LHGA 1O3QA 2FNAA 3M9AA 2GA2A 3TDUC 1S8NA 2E7UA 4WK8F 2FA5A 2OAZA 4Q48A 3GZDC 5CVVA 4LLLA 3WE3A 2W8WA 2VYCA 4TMRA 4ZM4A 2H27A 3HYIA 3ZMSA 1LC8A 4Q47A 5G2PA 4HDVA 4I0BA 4OIQF 3HRSA 3MKJA 2W8TA 4B9BA 4IVNA 4RB2C 4TV7A 2WWYA 2HDCA 4WLHA 1AKAA 4ADCA 1FOKA 4CYDA 1XCVA 4KT5C 2HUUA 3EIBA 3P9IA 4GGGA 3QP6A 1F9NA 3T8TA 3ZRRA 3RKWA 3I0TA 3QU6A 2C81A 2O0RA 1S0AA 4F5LA 1F1ZA 2O03A 1KU7A 1F5TA 4I98B 2EGYA 3ECDA 3ISPA 2GMUA 1YS7A 1PMMA 1DGEA 1KGSA 2RN7A 3KLNA 1FWZA 2FYFA 3B1CA 1Z1DA 5BQTA 1ZGAA 2PN6A 5K5QA 3CLOA 5BPIA 4LK0F 4ESBA 1G4VA 3PDBA 2FM1A 2NAZA 1H0MA 1TW3A 2XVCA 4W91A 1XGSA 4E3QA 3KP2A 3GZ6A 1RV3A 3GO5A 1QISA 1ASAA 5HDKA 1X2AA 2OGEA 1OYIA 1SPAA 2A68F 1IRFA 3EDPA 4HBLA 1FP1D 1AJSA 4K2BA 2FN6A 3TCMA 1I27A 4IXSA 5EEGA 1I5ZA 1XGMA 5HLGA 5BMZA 1BJAA 3ZMZA 3TFTA 2XV4S 5LGTA 3DFGA 4WX9A 3ISLA 4B09A 2YCTA 5E1XA 3GFLA 4ZSWA 4GYIA 2ZNYA 5FLXZ 3GWPA 5M4BA 5H6QA 3ELEA 2GIVA 1CF7A 2ORDA 1SZKA 1MGVA 1J7KA 4ZDOA 5LHHA 1O3TA 3VP6A 4XQ2A 1QO0D 2HKOA 2O3FA 5G09A 1K79A 3U2RA 2XUBA 5HS7A 4M72A 3QGUA 1AMQA 3CAIA 1FC3A 2MH2A 2VT2A 2W84A 3H14A 2FQ6A 5LHIA 1ELUA 2VGZA 3QN6A 4R8DA 1MLZA 1ASBA 1IUYA 2ZFWA 2QWWA 4OCAA 4K2IA 2V9VA 5DJ9A 4PCQA 4LW4A 4ZLVA 3V7SA 3FVUA 1D5VA 3H92A 2CG4A 4G6DA 3MCZA 4BXUA 2HOYA 1CL2A 3A8UX 5C6UA 4U1TA 2XROA 4A00A 2VLHA 5JFRA 1ZLJA 3DEUA 2P5VA 3DKWA 2Z9VA 4EJVA 2VONA 1TOGA 3O6BB 2FMLA 5I92A 3C18A 3HQTA 2LDUA 1ODDA 5EUDA 1T3IA 1BIAA 3FCRA 2VMXA 4E70A 2QENA 3GEZA 1PMOA 3VFZA 1IAYA 2NMPA 4HYEA 4AOAA 4BMKA 3DZZA 1MJBA 1BC7C 2VMOA 4L0OA 2RFVA 4RITA 1HKTA 2CH1A 3BZ6A 5HDNA 3FVXA 4AO4A 5BJ4A 1XGNA 4F5IA 4LGWA 4JK1X 1EV7A 3H3UA 1KQ8A 2Z9UA 4XRFA 5ILUA 1YJSA 1HSJA 3ASAA 6PAXA 3PGYA 5BOXA 3BCAA 3OOPA 2JJEA 2A07F 2BYJA 1IN8A 3CBFA 3QAHA 5ED4A 3IHJA 1S6LA 2QB3A 3FDBA 2HOZA 5TF5A 4DNCA 2ESHA 2TDXA 1AHEA 4L0ZB 3TQXA 3JSPA 3KP3A 4GYGA 1RUOA 1MDMB 4Y0HA 1VP4A 3ZN0A 1RUNA 3QPHA 1Q1HA 4IPAA 4RGRA 2NRAC 3I58A 2BIEA 1ZARA 4IY7A 4O3MA 3JTXA 5HDGA 1DKAA 3D6KA 4HAMA 3BS8A 3SHFA 2QQ9A 4FL0A 1R22A 2EFPA 2FEZA 2VGSA 1MDMA 2R3SA 2V1PA 3QU3A 3H3ZA 2D7YA 5EEHA 4W5KA 4XEWA 1J2XA 4WD2A 5A2QK 4KYWA 3GX4X 3ATHA 5CJ9A 2XH1A 1YLFA 1V2FA 4J8LA 1W5SA 3GXOA 1XB4A 3E2ZA 2CYYA 2DU9A 2P5KA 5EIGA 3I5UA 1J59A 1G3TA 1ZG1A 4MKJA 1N8PA 4WXBA 3BDDA 5FT6A 1UCRA 1G3YA 1XDSA 1XMAA 5ICEA 4LJZF 1ZC9A 1ARGA 5JHUA 2XAGA 3VK3A 4G6QA 1AKBA 3LY1A 4KMFA 4NHJA 4S05A 2VBYA 1H9GA 5CVUA 4HLXA 2XBNA 3ZMVA 4YFKF 4BA5A 4M9XA 2QA3A 2FBKA 2E7IA 2M45A 4OMZA 1XSDA 4ADEA 2EFOA 3P6KA 3HHHA 3KZZA 3BWGA 5L3GA 2AY7A 2YOBA 3M5UA 3PAAA 1WRJA 4M9SA 1MGTA 3KP7A 2P6TA 3WY7A 1STZA 3R61A 1AKCA 3KETA 3MZYA 1U08A 1D7VA 1LDJA 4L9JA 2GAUA 1I1GA 3GUDA 1X29A 1Z6TA 4EB5A 1O62A 4IXOA 1LJ9A 3I64A 2G9WA 4OT8A 1LK9A 4NOGA 4F7ZA 4LLNA 5DEQA 1MAQA 2DT5A 1PUEE 1KKJA 1I41A 2R2NA 3BCXA 3WKSA 1ZG5A 2R7DA 2EK5A 4WYFA 3F6OA 1AAWA 5K1YA 1W7PD 3B1DA 3UE8A 3I71A 1HSTA 1M0OA 2K86A 2E7JA 2AY3A 1FT9A 1K78B 5EQCA 1BOAA 3BWNA 3ZZKA 4RIZA 1AY8A 4H51A 1SFUA 3TDZC 3RI6A 2YR2A 4LB6B 4P9UA 2MBFA 1DJ9A 5ILSA 2OQRA 3HRMA 1W7LA 2L4MA 2Q2EA 3E3VA 4XJPA 4U7BA 4ENNA 3ZRPA 5F64A 2XAHA 2ESNA 1KL1A 2W25A 3AATA 1TQMA 5D5XB 1WYTB 5E18F 1BN5A 4R5ZA 4W1XA 3ZPLA 2O8XA 2Z9XA 2X5FA 1YS6A 1E2XA 1FYKA 4ZWMA 4GO1A 3V4GA 1G3WA 4KFCA 4ATPA 1PDNC 2Y0MA 3SZPA 3DF8A 4F5JA 1IAXA 2CJDA 1YOOA 1BI0A 3REOA 1AJRA 3G73A 2DGLA 4OIPF 1FBQA 1TOIA 5DYMA 3F23A 1CQ7A 2V1DA 5TRDA 3ASBA 1ASFA 2RDPA 2YU3A 3ZQ7A 4LLGF 2CFBA 3CQ4A 1KMKA 4CVQA 2Z99A 2JG2A 2RVCA 2G7UA 4LC3A 3FMSA 3SZTA 1OKRA 3MEXA 2YX4A 3ZZJA 2BGCA 1JGSA 1YNUA 2NNNA 3HHGA 5EFSA 2ZNZA 1U5TC 3C3WA 1BC8C 3K9TA 1ZAOA 2BI2A 4HZFA 2W7FA 1OPCA 2Z9WA 4AVPA 1YW8A 4M6YA 3QP5A 3RBLA 1T98A 5D6EA 3VOMA 2GWRA 1Y4IA 4ZSYA 2Z20A 3BJAA 4A6RA 2ISYA 3Q5FA 3E6GA 3EIAA 1P3WA 2BKWA 3E5QA 2FMYA 4G8XA 4WXGA 2HQRA 4GE4A 4U0VA 4Y17A 4Q75A 4UVBA 4RGSA 4OC9A 4WLJA 4ADDA 1JHHA 1Z7UA 4OMAA 1UB9A 2VGVA 3QM2A 4F5GA 3P9KA 2AY4A 5ERIA 4LFUA 1CF7B 1ZGJA 1MDOA 1ON1A 3G7QA 4Q6RA 1D7UA 1X0MA 2G6WA 1C9CA 5BJ3A 4KIBA 4EV0A 1R1TA 2HUFA 2F2EA 3CUQC 1VTNC 3ELKA 3BJ6A 2IPQX 2FE3A 4A0ZA 4LW2A 4M6XA 1GEXA 3W1IA 2HZTA 3N97A 3PFIA 4BHPA 5EIGB 2DQRA 4F5KA 2W8VA 1ZREA 3LVLB 1CL1A 4KXKA 2G7HA 8AATA 1KKPA 1OHYA 2W7IA 4ZYGA 3W1JA 4HLYA 1CQ6A 2D66A 4XK1A 1LKCA 4N0WA
chains in the Genus database with same CATH superfamily
4L9NA 3M1CA 4X6AJ 3QPGA 7AATA 5JAYA 3D5RC 3F8BA 4F3QA 4QGRA 4TN4A 4CH7A 3F21A 4H4KC 1WKGA 1D8JA 4AIKA 4RJ0A 2HYFA 3AENB 3MMYB 3FQAA 1YQAA 4RA2A 3G8MA 1OYWA 2LD5A 1N2TA 1B6AA 2WK7A 1O3RA 5E4ZA 2W7MA 3ABKH 2VXZA 1J0RA 1XTAA 4NBQA 2DPDA 2AY8A 4ESFA 4E1OA 4R2NA 2DOFA 1PUFA 4XSXF 2PMZA 3R0AA 2R5YB 3VOEA 5J3LA 5LLQA 4W8IA 1QHGA 3DRDA 2FX0A 4UY8I 1UHSA 1EH8A 3WTTC 3KFWX 4MSOA 4FASD 4BEHB 3RBFA 3GFMA 1FMVA 2AY2A 2R5CA 3VK2A 2KIQA 3TATA 3GBXA 2JA7J 2KP6A 4A2UA 2LOOA 3K7YA 1Y0UA 2DJIA 3UWCA 4N9IA 1U9NA 1IV6A 1B8IB 3H36A 2IGNA 1GXQA 2XGCA 3ABTA 3NEUA 2E54A 2EZ1A 3BC8A 1ZN2A 5JVTA 1W36D 1TQPA 3K4KA 1QZ9A 1TNSA 1YOVB 3OS0A 4FFCA 1TQIA 4PFOA 3QI6A 2QLRA 1W7PB 4EQQA 2K9LA 5FKNA 1IX6A 2D2WA 4K2EA 1LS3A 1A6IA 3E5XA 5IYCJ 4EU1A 1WYTA 1IJIA 1L3LA 3GTMJ 3B8XA 2NS7A 1LKCA 4WYAA 3HOXJ 2Z3YA 4O5VA 2ZKZA 3D1NI 5IP7J 2Q2EB 3WTWC 2MLGA 4PGHA 4RAGA 2KIUA 4CGZA 1OQYA 1IX8A 2GMSA 3F8FA 5TGTA 2ZCWA 1OYYA 1X1PA 1LNWA 3SEQA 1OHVA 1TC3C 3JAMK 1UZCA 2BBYA 3MAJA 1U0JA 2X6YA 3CMEI 2XC7A 1EJ9A 3GETA 2COBA 4IHWA 3MKLA 1IJWC 2JA8J 1BJNA 2W1OA 2M0MA 3RPUD 3L2UA 3B6CA 3WG7H 2CJJA 3PQJA 4JF0A 1YG2A 1BR2A 3CCVI 3M8EA 3OYDA 1C7NA 1S07A 1LE8B 1TWFJ 2EZIA 2R5ZA 2PJPA 3E6MA 3MBBA 3HRUA 1GC3A 3G2BA 3IC7A 2HOAA 2IS1A 1SMYF 3E2ZB 3PD6B 4J00A 1TT0A 3CMMA 3AKZA 4A0YA 2YX7A 2F4IA 3W6KB 3OYJA 3VAXA 4KIFA 1V5EA 2MA3A 2YHKA 2PMZN 4PJNA 2PJRB 4QLCU 4PJLA 1ASLA 3V8JA 3HTSB 4EJWA 1A04A 1WQ2A 2X48A 3GF2A 4FT8A 2BV6A 1S5LC 2XPUA 3FMQA 4XORA 3TW6A 2CFOA 1TW2A 2NNYA 3HOSA 1ZR4A 2R93J 3CC2I 3LV2A 1TL8A 2F4OB 3H9JA 1FP2A 4F92B 5ILVA 1EJIA 5KNLA 3KGWA 1CGPA 1PP8F 2JUGA 3WE2A 1BJOA 3BP8A 2WB1N 5J40A 4A3IJ 1O57A 3OR1C 4PGGA 5IT9Z 2JJGA 4AO9A 2Y9YA 3OOUA 3WGHA 2YRRA 4NC6A 1ZG3A 2RGVA 3CC4I 3FTBA 3I4JA 3HIFA 3WTZA 3K0LA 3L2QA 5M3FJ 5IWQA 2YKVA 4CCNA 5F04A 1R1VA 1JTXA 3KZIC 3RKQA 1OCRH 3HJEA 4HV5A 1IC8A 4EJOA 3HPGA 4BY1J 2DPUA 1R00A 1I50J 3NU8A 2GZWA 1VFCA 2IT0A 3GCMA 3TOAA 1BS0A 2CUFA 2HUIA 3QHXA 5KK1A 1QGPA 3SFIA 2W7KA 5DM7F 2BIAA 5E3OA 1VNDA 3Q8NA 4L18B 4JEZA 4BQNA 3T1BA 2Y9ZA 3LSTA 1ASCA 2E1CA 1BR4A 2CUJA 2JPCA 5K5RA 4R79A 4A3EJ 4OU0A 1ZRCA 1AKHA 1HF0A 3P9CA 4HQMA 1S7OA 4HOBA 1P4XA 4I0AA 2XF5A 2MD0A 3LSGA 4NC7A 4UVAA 4BBRJ 3J80Z 3LSRA 3JRIA 1GXPA 2A5YB 2LVSA 1W0TA 1N31A 3JW9A 4OOIA 3IRRA 2Z33A 2DKJA 4MTEA 4GRXA 1KU2A 2E5ZA 1YRNA 3FK6A 2IGMA 1ZODA 3HOTA 2CY8A 4P7YA 3WU1B 1Y39A 2VBZA 4PFFA 3I55I 3WTYC 3HOWJ 2RV8A 5FROA 2JISA 4WCGA 2DTRA 4GE9A 2L9SA 4IZZA 2BI1A 1GCKA 3COAC 5FT4A 4I76A 1GC2A 3I59A 3KZYA 3L2CA 4XONA 2BYLA 5K7FA 4IQ4A 3ZN1A 4AVZA 2ZSLA 3NTJA 1MMAA 2R7SA 3MC6A 2GQQA 2HXOA 1I48A 4P9FA 1S72I 2PB0A 1DGRM 1K6OA 5J1RA 1WYVA 2BVLA 1UJ8A 2VJIA 3LSHA 3Q9VA 5ICCA 3CD6I 1BIBA 1BA5A 2QSFX 3KP6A 2EIJH 1W3UA 3HBLA 3WGBA 3SJMA 2GIZA 2QKMB 4YFXF 1PFFA 3P1TA 1LVKA 2LF7A 3CUQA 4II2A 3ZP5A 5L3DA 2K4JA 4DBCA 3L09A 5D4SA 1VEFA 4DQ6A 3P7NA 3PD6A 4L5EA 1IBJA 2VB6A 3CF2A 4I6ZA 2ZMEC 2ZMEA 3A2KA 4EGZA 3I4NJ 2X6XA 1TOKA 3BV0A 3BY6A 3PO2J 2PG4A 1M0PA 5B3SH 1YIZA 3NUBA 4JE5D 2XF7A 2QUFA 5EZHA 3AOVA 1AIAA 4EB7A 2Z16A 1W7MA 4EMYA 4MY5A 5FKKA 1IXCA 4WF2A 2Z5UA 3VYTB 2VGUA 4ABZA 5CPRB 4B43A 2RNJA 3D0SA 5FFZA 1H88C 3RUYA 5CLSA 4BU2A 4XKWA 4IX7A 2OF7A 2RC4A 1LUJB 4RS8A 2R0TA 3IUOA 1Z05A 4ZDPA 1LEBA 2P81A 4BQ0A 2M87A 4HF0A 3CMYA 2FQ3A 2HQ5A 4W1VA 3FXKA 4WYCA 3V8LA 4RJYA 1HQCA 5IT9K 1D2FA 4WWCA 2M30A 1WVRA 1SFFA 2WV0A 1Z91A 3LSJA 5FT8A 1B59A 1TTYA 1YW7A 2M1BA 1MDXA 4LOCA 1YJYA 4F55A 3CQZJ 4XJOA 3NNKA 1T8IA 4AD9A 2DMNA 4ZZLA 1U5TA 1X3WB 1QJ3A 4XJMA 2GXAA 4GDYA 3I9V2 4XLPF 3RJPA 1I43A 2PBIA 5BS6A 1AMSA 2VMYA 4UHNA 4CDGA 2W7LA 1JS3A 4KIGA 5CQGA 4OMYA 3PPLA 2UZKA 2D45A 5ICFA 4A0XA 3HDDA 1S9HA 2HYJA 2STTA 3QRFF 4JP0A 4JE5A 5G2QA 4HX8A 1HA8A 3DBLB 1SFOJ 2KDOA 5A2QZ 1MBFA 1AICA 3RQIA 4MGRA 1FTZA 2DJNA 1RETA 3E1SA 3DWLE 3HTUA 1BBYA 4P5OA 1U78A 1R58A 2CQQA 2HP1A 4I7HA 4A3JJ 4RB0A 1ZLKA 2JGTA 1Z6RA 2IW5A 4ZYHA 1WJBA 2QMAA 4WYGA 2DA5A 3QOEA 1B5PA 4ZYEA 3ZMDA 1ULYA 3WGGA 3ZRQA 2WY8Q 3E2YA 3JZLA 5EAAA 2VGWA 1W7PA 3CCRI 1S3JA 5L3FA 1H89C 1IVRA 4ZM3A 3D5SC 3CUQB 4EM2A 4KNYA 1A6QA 3K4NA 1V4RA 3FQ8A 1FBUA 4DOZA 3T0YA 5EUNA 5FLXK 1CS1A 1ORDA 2ZUKA 1GVDA 4R8HA 3V8KA 1R1UA 1PJRA 3JW4A 3PFYA 1P4AA 3KEOA 4HNVA 1Z3YA 1KL2A 3ACZA 4W1WA 2XIGA 4LNLA 3E6DA 1X2MA 3PUBA 2BYVE 2BE5F 2VKVA 1Z9CA 4EGYA 3FQ7A 3I59B 2JRMA 2GA1A 5AIPA 5DDGA 1T38A 1TARA 4AUXA 4CXFA 1FSHA 1M32A 1OCPA 2LG4A 2X4HA 4B8XA 2F5CA 3DEWA 2R5YA 1ARHA 3PQKA 2DT7B 4DIQA 3MD2A 2YCNA 3HOUJ 4RLGA 4XN3A 1WJCA 3ZMTA 2CS3A 3LQRA 1I3QJ 3J7ZI 2EV6A 4XKVA 3RTRA 2PI0A 2AY6A 3L9FA 4JX5A 5C4XJ 1SFEA 3I5TA 4BEHA 2CW7A 1DJUA 1SC7A 4BA4A 2IA2A 2D65A 4I09A 5L3BA 5LD2C 4ITXA 1U9OA 4CCJA 3BPXA 4BJTA 4YG2F 2WAFA 5LGNA 3ZXSA 1EA3A 1JT6A 3K10A 4QIWN 1FBSA 2IS2A 3AEPA 1NK2P 4U7DA 3S3NA 4RKCA 3A01A 1HBXG 3KE3A 5AONA 4JF1A 4CZZA 2FBHA 4G12A 1V5FA 3BG7A 3AL0B 1XC5A 2LC2A 4UXNA 1P2FA 4S04A 1PG8A 4Y15A 2ELHA 1ZKGA 5D6FA 3F0HA 3HGGA 4GE7A 2B0LA 2DMQA 2EPFA 1LC5A 4A0RA 4ZAHA 3L44A 2AY5A 1QGNA 1GDEA 2PQ8A 2FXAA 1R36A 1PVEA 2UWMA 5E8GA 2OGAA 1FC4A 5DUKA 3J7YJ 4NNJA 1YX3A 3A01B 2DMUA 1L0OC 3EI6A 4A0FA 3K2AA 5LEJA 1R7JA 4Z2YA 5DUIA 3LA3A 2YKUA 4AIJA 2XAJA 1SD6A 4N0BA 3U1KA 3H35A 2VQHA 4ETSA 3NYTA 2LYCA 2DA6A 2OKKA 3KYCB 4OYTA 1IXRC 3X2QH 4OTLA 3SYTA 4FX4A 1OATA 1MMNA 1ZK8A 3CCUI 1EF4A 2VT3A 4IXZA 3L2RA 3B46A 5CVJA 1NK3P 2V1XA 4IJAA 3VDXA 3JTHA 2DGMA 5F0FA 2VMTA 5K5OA 3KE2A 4ZYDA 1H0CA 3IAM2 3MC6C 2L2OA 2XRNA 1WJDA 2F5VA 1ETOA 3DKYA 2JSPA 2E2JJ 1BJ4A 2QM3A 1JE8A 1S09A 5GAGJ 1N25A 2HZPA 1ETWA 2OC6A 3F0CA 1IV8A 2LBFA 2WA0A 3BZCA 2ZJPF 3LA7A 3E5UA 1W36C 3ECOA 4CBRA 2M7BA 4EEFG 4B47A 3EUCA 4BHCA 3IH3A 1I29A 2GB3A 3EI7A 2HS5A 2OBPA 1SVVA 2WK8A 3L00A 1DFOA 1UFMA 2ADUA 2L9VA 4FE7A 3ZMUA 1YO5C 1GVJA 1K4SA 1XCBA 2MD5A 3FXRA 2H09A 3CJRB 1V2EA 1JJ8C 3H9GA 4CYCB 4G6TB 3QYEA 1UG0A 2JJ7A 5TISC 4XBFA 4ITGA 1YX5A 2E1MC 4UUSA 3E6CC 4L0YB 3HGYA 3NX3A 4RB1A 1YYVA 4V19K 1J5YA 4AYBA 4DBQA 1JHFA 5J4VA 1AWCA 2E5NA 1RKWA 4XSZF 2LBFB 1A35A 1C0NA 1KMJA 1A36A 4ZWVA 2QBYA 2UUZA 4WXHA 2GOMA 3CUOA 2UV1A 3TP0A 1AMAA 3A2BA 4PFNA 4WB0B 2CSTA 2CV2A 4CHUA 2XASA 3MN2A 3I54A 1EH7A 4BY7J 2X6OA 4AZKA 3HB9A 4BYYA 3WTXC 4HX4A 1XSVA 4MTDA 2TRTA 2BWNA 4JEXA 2KZGA 3S93A 1QJ5A 1BOBA 1E5EA 1HDDC 5D4RA 4P55A 5D95A 1ZR2A 3M07A 1H9TA 2R5EA 2BHXA 4NUBA 4ENMA 2R5CB 3F8MA 5FD6A 3NDNA 2YS9A 3FKDA 1IZ1A 1X2NA 2KDZA 5HLTA 4Q31A 4LD5A 2V6CA 1B4XA 2HPIA 1X1CA 1XEYA 2K7LA 5EUEA 1IN4A 1O69A 4EFFA 2ECCA 3KGXA 4WYDA 1YJNI 3W6VA 4N9HA 3PUFA 4UVCA 1ON2A 1P4WA 3PIPF 4IX8A 4UHOA 3SEZA 2BWOA 4E7SA 4KA4A 4HVKA 1N77A 3OKSA 2A5WA 2CQ7A 5IT3A 4DW6A 4ASNA 4JEYA 3TP3A 3CLQA 3NUIA 2HKXA 2OD5A 2P7CB 2NYXA 4EMSA 1V72A 3MQ0A 2HFHA 2EB7A 4DYRA 3OSGA 2DXIA 2HP2A 3FVSA 1TT5B 2M8GX 2E19A 2A6EF 5CVRA 2CQNA 2ACJA 4AH3A 3AEMC 1MBEA 2M4GA 2W00A 2XGXA 5M5YJ 2QQBA 4Q5SF 3L7WA 4KUMA 4G94A 1JJ6C 4CCKA 4Y0DA 1OJLA 1WJEA 1E3PA 3OIOA 2M8EA 2VUMJ 3LSMA 1SF2A 1R4NB 2D1HA 5FB2A 3ZOBA 3KCCA 3NWSA 2W8UA 2HQAA 2OA4A 2LKSA 4HG2A 4E7IA 5LBQA 2QB2A 2D5VA 2J5OA 3GZDA 4P3MA 1MLYA 3UNGC 2WC2A 5KAFC 3BR0A 4EJTA 4V2FA 2O7CA 2L7FP 2PB2A 1E3HA 2H94A 1MAPA 1AIBA 2DQLA 2F8JA 3GW2A 2DODA 2VMWA 4IEJA 3ERMA 5E5IA 4UUTA 4ZYAA 1ZYRF 3WZFA 3DU5A 1PP7U 2D7ZA 2LF8A 5J8FA 2MH9A 4A12A 4IF4A 4JEWA 1FOYA 1QVTA 2DI3A 3S1QJ 2W7GA 1J32A 1Z0XA 4WYEA 4WXFA 2EO5A 2QBTA 2ELJA 3OR2C 1O7FA 2BI5A 3OYLA 3A0BC 3MADA 1T2KA 3W3CA 1JGGA 5M5WJ 2B9SA 2XRLA 3RCHB 2JRTA 3AEOA 4RGXA 2CW0F 1ASMA 1LEAA 2W24A 1YIYA 2EFQA 3AG4H 1C7GA 5DCMA 1J04A 4DGTA 1G4DA 5EGOA 4GSAA 2EZLA 3G1MA 1YJ9I 1E17A 3JRBA 3S8PA 1SZUA 5BNGA 3MZHA 2DOUA 2VGTA 3KLOA 3BCBA 5LGUA 1IN6A 1FOWA 4UHMA 2ZJRF 3DU4A 3V42A 3ASNH 4BQQA 2JA6J 4MQPA 1JKRC 3U9GA 2AQFA 4O6ZA 4M3DA 3KP4A 1MBGA 1IXSB 3SDGA 4MQQA 2DDBA 1ITYA 4KMUX 3AL0C 1XMKA 2XKPA 1TASA 2DA4A 1J75A 1DJEA 1SANA 3EUHA 3EI8A 4A3MJ 4ITVA 2VI9A 3VSLA 4C3JJ 1AHYA 2WAQA 1CZEA 2OU2A 5JI6A 2I10A 4DJAA 1B8GA 3LMMA 4G7HF 1TPLA 1S7AA 4RGUA 2QCOA 1MNEA 2DO7A 3DTIA 3E7LA 4J01A 2X0LA 4BDZA 2PFBA 1W1WE 2CRGA 3G3ZA 3W6JB 2K3FA 2CJGA 4KJZA 3BOQA 1DP7P 2E7WA 2LP0A 2MW8A 4KT6A 1XMXA 3O2PE 2ME6A 2Y48A 5E1ZB 3EQLF 5B1BH 4A72A 3DODA 2Q1ZB 4MQVA 5J4YA 1MBHA 1JTYA 1I6XA 3LNQA 1NHAA 3MKWB 2EPJA 5KCMA 4GRIA 3JTGA 1X3UA 4PJ0C 5CYVA 3LAPA 2X5DA 2DOAA 4ZASA 4RBOA 4CBSA 3FKJA 4L5JA 1IF1A 3F8CA 2CSOA 5J8QA 2KJBA 5JVGF 5K7ZA 2BIGA 3E9KA 1X1AA 2HU9A 2DK5A 3CJTB 3B6AA 4MQ9F 3RKYA 4BH9A 3PL8A 2VMQA 2VIAA 4A3LJ 3EETA 4KN4X 4MFEA 3SQNA 3DXVA 5FLVA 3CO7C 2EZ2A 5M4DA 1JKQC 3ASOH 4NQWB 4BE1A 3WGCA 1KQ9A 9AATA 3BTCA 2IXSA 1ETQA 3BG5A 2WTEA 2COMA 4L9TA 4J5UA 4A3KJ 2MC4A 2DOEA 1ZELA 4ESJA 4JEVA 3E97A 2VMVA 1BM9A 3JREA 2AY1A 1TWAJ 2DW4A 1T33A 5GTIC 3MKZA 2EWNA 2JA2A 2NOGA 2BY1A 2HWVA 3F22A 4ZDLA 3ERED 3TKYA 5M46A 1M1EB 1FNNA 4OAYA 2VBWA 2R7ZJ 2XAFA 1FYMA 4UUVA 3VYRB 4CSWA 3BB8A 2A61A 4JYKA 3TBIA 2IS6A 2VMSA 3RYPA 1YFHA 4C3IJ 3BWNC 5FJ8J 2KZVA 5E1WA 4NQWA 1K4TA 3IL2A 3FM5A 1USTA 2FNPA 4BNCA 2Z1YA 1DPRA 1HW2A 3T32A 4NC8A 3NRAA 2O5RA 2OCCH 3CZ6A 4JQFA 2KKOA 4HDUA 3BPVA 2BVMA 3LVJA 4U88A 4HQEA 2VBXA 2K02A 1R23A 3E6BA 5DX5A 2MLKA 4FQGA 3V7RA 3FXMA 3W2WA 5E3MA 5F0HA 3F6TA 2FSWA 2XAQA 2Z9OA 4MO7A 3OYGA 1B9MA 2Q7WA 4GCVA 1SEUA 2NVUB 2PLYA 1Y8QB 1WJ5A 4UOYA 1MW7A 1U6GA 4RLQA 1AOYA 5LFAA 3EZSA 4YELA 3S2WA 4HW0A 2DA2A 5AIQA 2LSOA 1IRZA 1IUFA 1K6YA 2GSAA 1UHMA 3KYDB 5G4JA 3WHCA 4A0GA 2W7DA 4PVFA 4FCYA 2TPLA 4BJ5C 1SD5A 2DAOA 2W85A 2Y0SN 4I01A 3JRGA 2ZC0A 2N8GA 3FBIB 1LVAA 2A69F 1E5FA 3AAFA 3RCHA 3CESA 3W2VA 3HUGB 2ZMEB 2JPBA 3HKZN 2JSCA 5E17F 1AHGA 1IDZA 1U8RA 1MZBA 1U2WA 4WB0A 1GHCA 1FSEA 1MJ9A 2C44A 3MAFA 3WU0A 1CQTA 3II0A 4XR6A 3F8NA 3GVAA 1QIRA 3FZ8A 4K2MA 3C1DA 1QPIA 4KYOA 1B1BA 1ECXA 1B9HA 2O8KA 2JJFA 1W5TA 2FNUA 2VI6A 3H0GJ 1G7WA 3DC1A 2ZP7A 1OFCX 4CCLA 3GR9A 4C2TA 5D8LB 4AC0A 3LVMA 2CB1A 5G0AA 2VKDA 2ZFUA 5HS8A 1BT4A 1QBJA 1RVYA 1QZYA 2F5FA 3CP2A 1TBXA 4Y13A 5IOZA 1S06A 1X28A 3FRKA 2HTJA 1ASDA 1BI1A 2CH0A 1VQ9I 2ZYJA 1IO2A 4E7ZA 2Q8KA 1MDZA 3M4OJ 4L5IA 2P4WA 5HLIA 2L9NA 2C6YA 2GXBA 2HOXA 4XAUA 2A6TA 4WXDA 1ARIA 1E3OC 2BOLA 3ULQB 5JHFA 1YTYA 2K4BA 4MNUA 3QBOA 4WP0A 3FX3A 5GPAA 1ETXA 4G7ZF 2Z2SB 1JKOC 3A4CA 1B72A 2E71A 4A3DJ 3HBXA 2WB1A 2WKAA 2YCPA 2L7MP 4WXCA 2CQKA 5D5SA 2D61A 2E1MB 1D3YA 2QSGX 2ZO4A 1WWXA 2EFNA 2MG4A 1XPXA 1ZOBA 1G4XA 1X19A 1FPQA 1RR8C 3B02A 3LWSA 3UR3C 4XLCA 3BG3A 2HVRA 3IWFA 2X3LA 3HL2A 1T0FC 1G3SA 3DYDA 3A1YA 2CGPA 4YIFA 3QPTA 3K28A 4IL6C 2BEOA 3E77A 1ARSA 2GQNA 4X0GA 3FXUA 4D5CA 4I8AA 1ORKA 1BQDA 5G4IA 3PSFA 1KZHA 3S14J 4QWQA 3DP7A 1GEYA 2W7HA 1VQKI 1TATA 2CFXA 3F3XA 3ABUA 3LSIA 1YJWI 2E35A 3H5AA 4M3FA 1BI3A 2W7EA 3RQ1A 1KU9A 4M9ZA 5GAHJ 4XKCA 3FHZA 1ENHA 1YE9A 3DQVC 4A6DA 2V79A 2QLZA 4GDFA 2CMPA 4OBVA 1TLHB 1IX7A 4MEXF 2XSJC 1BJOB 1QITA 2O6GE 2ZJ2A 2O7OA 4C9YA 3OL4A 2HDWA 2GBYA 3COGA 1P7IA 3WX9A 2Y75A 2DKBA 2JJHA 4BHDA 2DFIA 2DGKA 3U1DA 2IP2A 5D5VB 4NB5A 1F4KA 2FJ1A 5IY5H 1IRGA 4IKFA 2VIBA 3QYBA 2HPMA 1DU6A 2R7VA 2K9SA 4IHXA 2L02A 2VODA 2K5CA 3CMAI 3HSFA 1YJZA 4Y0IA 3IAS2 4XLNF 4LB5A 2DYRH 1YAAA 2D64A 4I2OA 2ZXJA 1O7LA 4CO8A 1D0ZA 3PDBB 3BROA 1X4OA 3IHUA 4RLFA 2W57A 3ZQHA 2KFDA 5F1JA 1HKQA 4LITA 5LRSA 5FGMA 3QPLA 1Z7DA 1ASGA 4M3GA 3T8RA 3FSLA 1OXOA 4ATQA 3N5MA 3GFIA 1XGOA 3OP7A 4DYCA 2VLFA 2L4AA 1IN5A 4ON0A 1FIPA 3R9AA 2KJCA 3A0HC 3LWFA 4LMYA 4U0WA 2DCEA 4RB3C 4IHVA 2V1UA 1M0QA 4IYOB 3MAUA 2D5YA 2F6CA 1BQAA 4F4EA 2QA4I 1YI2I 4RAEA 2JN6A 2X1EA 3KX2A 1XX5A 1G6NA 1WFXA 3ABMH 4R1HA 2J5PA 5IYBJ 2M9HA 1ZRDA 5AX8A 3TO7A 2H1KA 5BPDA 1VQ4I 1I1SA 3GWZA 4Q76A 2HXIA 1CZCA 3H5NA 2X6WA 4HPQA 5C4JJ 4OINF 1V2DA 1LQ1A 1X3ZB 1RVUA 1Z77A 4BBSJ 3N4MA 4BAYA 4OIOF 4XRSA 3K4BA 1V5GA 2LKPA 1B8IA 2ZC2A 5CKTA 3EZ1A 3K1NA 4XNFA 3F6VA 3MFKA 3GLXA 5DJ1A 5F27A 2R7FA 1MSFC 2KIMA 4M2MA 5KVRA 1TOJA 3QPSA 3USFA 3I53A 3OV8A 5TJJA 4IRHA 1ZQ3P 2A3SA 3F72A 3DXWA 3J81Z 2DK8A 3BR3A 3S32A 3PM1A 4F91B 2EV5A 2DDAA 1FY7A 4U87A 4Q4ZF 2RQQA 4A6EA 3BN1A 3KP5A 3WLXA 4E3RA 1FG3A 3J7AY 4YEJA 3DR7A 2HR3A 3AEJA 4B3XA 3U21A 1M0NA 3PNTA 2E36A 3HOYJ 3TO9A 4A5MA 3RYRA 1EKEA 2F5EA 3ZQLA 1J9IA 2RQPA 4A6UA 4CXRA 2QSHX 3TO6A 2ZJGA 3IRQA 2YUSA 1FTTA 2OATA 2F5DA 2M3AA 1Z3ZA 5DD4A 2JT1A 2E60A 3F9TA 4BS9A 2VMUA 1QZEA 3CTAA 3WHBA 4B48A 4EVIA 1OR7A 1IG7A 3LSPA 2VMRA 3WG9A 3BWOA 1M4NA 2YSRA 3VEPA 1RV4A 2MYSA 4A0HA 2Y69H 4ZZDA 3V7CA 2VOPA 3TFUA 1V3FA 1OHWA 3GTPJ 1QU3A 1XI9A 3GMEA 2QEXI 4E77A 4M3BA 1CQ8A 2XKOA 2H8RA 1RZ4A 1WKHA 2RREA 1EG5A 3DR4A 1ZH5A 4AWXB 1JXSA 3DTEA 3H0DA 3CCSI 1WYUA 3PA9A 3HVYA 4RM1A 3R0JA 3AFHA 4UQVA 2HEOA 1BKGA 2LKXA 2LY2A 1RIOH 1I6HJ 3HG9A 5DTDA 3T5XA 4FISA 4I02A 3JRAA 3EUAA 2H1LA 2K3PA 1ZRFA 2EIMH 4F5MA 5D8KB 4AZJA 4IXAA 3DPLC 3HSEA 1WI9A 4ZH4F 3PDXA 2PX9A 3HRTA 2E1NA 1S29A 1TP4A 2TCTA 3H9QA 3IWZA 3ECHA 4FHTA 4II3A 1AJSB 4IW7A 1JS6A 2ZSMA 2EILH 3KYLA 1UAAA 4LG0A 3CCLI 4HF1A 3GZ5A 2I5UA 1FOXA 3CQ5A 3CDHA 1ETYA 4OIRF 4U2HA 2L3DA 3S3OA 2OQGA 1TZLA 1V54H 1GV5A 1T0FA 3VPRA 2R4GA 5LRRA 1AY4A 2RKHA 4HNTA 2UXNA 1LDDA 4RDUA 3OYEA 1LW4A 2DR1A 4XOPA 3WKRA 4BKXA 3W1HA 1XN7A 1K78A 2STWA 2IEKA 1HW1A 3RDIA 4CA0A 3UKGA 3CO6C 1D1CA 4KN7X 2DMPA 2EH6A 4PDKA 4IRGA 4XLAA 2M2EA 5DB5A 3WCNA 1U5TB 4JBAA 3R4TA 1IW7F 3FWEA 3R4KA 3IKTA 1GV2A 4EM0B 1W23A 2WV1A 3AOWA 4OBUA 5CVIA 2L7KA 1ONVA 1IAWA 2OKJA 2MFZA 5JR3A 1ETVA 3Q3SA 2ISZA 3L2VA 1KU3A 2JA5J 1VQ8I 3FF5A 1RNLA 1R49A 1ACIA 2MC3A 2V1NA 1AHDP 2ID6A 1D7RA 4PIWA 1WKMA 2AQEA 5F6FA 3VB2A 2R7UA 2EA2A 2L5QA 3B73A 2PMHA 2C0RA 2W8JA 2HNHA 3M1EA 4R5FA 3AV7A 2ME0A 3S1RJ 4HEA2 1D8KA 3OYNA 1FYLA 2ECBA 3LG0A 2ICWG 5C3EJ 3S1NJ 2VE9A 2IRFG 1G8XA 3IF2A 4LNMA 1MNDA 1HOMA 1HW5A 1UU0A 2P7VB 4A5NA 2CTZA 1N75A 5J8CA 1SMTA 3O8HA 3CJNA 3NYSA 2P6SA 1YRNB 2VL8A 3GFJA 5IPAA 2VC0A 4N4NB 3M8FA 1NTCA 2XPVA 1ASNA 4Y7NJ 2KHMA 1O3SA 2EBIA 1DUXC 4ZJZA 1SAXA 2FF4A 2CANA 2YRIA 4CICA 2L01A 1VJOA 4KISA 4PK4A 4A6TA 1K7AA 1O61A 1B4AA 2EJRA 2R7RA 1MH4A 1UU1A 2FOKA 5HDMA 4QSHA 1FX7A 4XICA 3FMRA 4CCOA 3L2WA 3SXYA 2HQNA 2VMNA 3OYAA 4C30A 2BY3A 2CO5A 2ZSHB 1POGA 1LFUP 2GM4A 2X51A 3I3LA 3RI4A 4ENKA 2CQXA 1CJ0A 1SD4A 1Y8RB 2YPRA 3KEQA 2FU4A 3PNVA 3Q0UA 5M3MJ 3CCMI 3FZ7A 1N78A 3CJQB 3Q0WA 2DLLA 1UHWA 4M73A 1AHXA 2DMTA 2QQAA 2XGDA 5C44J 2VMZA 2DBBA 2XGEA 2IA0A 2L54A 2FRHA 3RZOJ 3RCOA 2WAEA 3FISA 1T39A 3HSRA 3VYSB 4ZTFA 2ETHA 4BACA 3FM3A 2JZYA 3TGNA 3WODF 2H6CA 3Q9SA 3MAFB 2KT0A 3AEMA 2Y31A 4IHYA 1SFKA 2EIKH 3OYFA 1IN7A 1RR7A 4PUSA 3RPUA 1ARTA 1MJAA 1QQIA 1OR7C 4MLOA 4AIHA 1GEWA 2H6BA 5FO5A 1DPUA 4NDLA 4HF2A 4Y3OA 1LKXA 3H1CA 1WYVB 2K85A 3K7AJ 2OQXA 1EQBA 2Z61A 4OWRB 1WSUA 5KHDA 5LHAA 2GOXB 3AG1H 1ZGWA 4G7OF 2PO3A 2PEXA 4D1QA 2HOSA 3WCOA 1VQNI 5J47A 3NWTA 3JAMZ 2K9QA 4IHTA 3R60A 1QVUA 3VODA 1E0EA 4D5FA 3LAJA 3GSBA 4ISYA 4LNJA 1SD7A 1HC8A 4DQ2A 3OYHA 3PSIA 2EFWA 4CXQA 2BWPA 3IV5A 1HXDA 1MD0A 2D1VA 2X9DA 3WTVC 2HDDA 2AATA 1TWCJ 2E7XA 4AU7A 4HF8A 3FXLA 3OS2A 2QBYB 1WSTA 2W48A 4YFNF 1P6RA 5J6XA 3NAUA 1AAMA 3BT9A 2AEUA 3S17J 2VPRA 1MIJA 3KIOA 3HMUA 1Z7LA 1LB2A 4MQRA 4IRIA 2HTSA 3HLMA 3HEFA 1B9NA 4D9JA 1DTYA 2IVMA 3J81K 2K27A 3OS1A 2BHZA 2Y30A 1BW5A 1ELQA 2LTPA 2DN0A 3EYYA 1DDNA 3HOVJ 4M71A 2HGCA 1RESA 3LQQA 2VQLA 3FXQA 3K69A 2AXLA 4DYQA 1GD9A 1UKJA 3GTKJ 3W2AA 1GC4A 3NYUA 1AHFA 5EAVA 4L9VA 4JOMA 3G0TA 4F5HA 1XDUA 1O4XA 5F8VA 2R7TA 3O8GA 5FFXA 2OCEA 2IJLA 1SZSA 3JSOA 1D7SA 2BI9A 1ZHFA 1S08A 3UAKA 4BDYA 2CV0A 3K40A 2XDVA 4GXOA 1YIOA 3N05A 2VI8A 2EA4A 2YU9J 3QODA 1M6SA 2VLAA 1FLIA 3LOCA 4UNOA 1FG7A 2E1OA 2CH2A 3EI5A 3A9ZA 3ML6A 2ZBKA 3EUKL 2GXGA 4D0PA 5E3KA 2X8UA 1WH7A 2AEVA 2HORA 2CJHA 4RAZA 1W0UA 1GC0A 1F43A 3VK4A 3CCJI 4XIDA 2F4MB 2K9NA 2V9KA 4JX4A 3TL4X 3BLYA 3FFHA 3IP4B 3RPQA 5HOOA 2MGQA 4P1WA 4XKBA 2V0YA 3LFKA 4Y52J 3DPUA 2Z67A 3DV8A 2ELKA 2CINA 5H6RA 1C7OA 4G9YA 2PJRA 4F93B 1GBNA 2DFFA 2QKLB 1FJLA 1JG8A 1YW9A 5DCFA 1C4KA 3HOZJ 2UXXA 3JR9A 1QPMA 3DKXA 2BY2A 3J80K 1UU2A 2W7JA 1SFXA 4HSRA 1QZZA 3K4JA 3RIRA 3CQ6A 5F9SA 5IOYA 1X1DA 2W4SA 3TOBA 1OXPA 2JWTA 3M7GA 4O6JA 1KYWA 2QZ8A 4U0YA 4AM3A 1MMGA 2VJ5A 3R6SA 3HDOA 4UV8A 5E8IA 4J19A 3KKIA 2AY9A 4RKDA 1R5HA 2ID3A 1F36A 3C7JA 3WTUC 4B98A 3FBNB 2IAIA 1USSA 5F1RA 1KQ0A 2VOOA 1G7XA 3HT4A 5DCMB 1C0WA 3IKVA 3QWLA 2DTZA 5L3CA 1BJWA 2DA3A 3GJUA 1GUUA 2VN2A 2Z1ZA 4P96A 2P5LC 1R71A 1WPKA 4FE4A 3NQOA 5HLHA 3N75A 4UHTA 3E2FA 5HVQC 1D5YA 3BJOA 3NU7A 4M2JA 2WBMA 1ERDA 4Y4RA 3ESWB 3P5JA 4RM3A 1LDKB 2M0CA 2D63A 2BI3A 4MKKA 3GZCA 2KRFA 1W7NA 5FD5A 5EJCA 1B5OA 2R5ZB 4F5FA 2VMPA 2YKYA 2LNBA 1REPC 1WYUB 3OL3A 1GT0C 1RRJA 1QNTA 3L8AA 2VC1A 1IDYA 3GLLA 4XN0A 4WBTA 3KEYA 2CWEA 4LK1F 3EI9A 3FFRA 4EM1A 5IYDJ 2RAEA 1ZTRA 4KDPA 3ELPA 4D7NA 3LVKA 3SFZA 2YKXA 3ZQFA 4E4HA 1H8AC 3FZ6A 1TOEA 5DD8A 5HHYA 1MKMA 2EQRA 3GTLJ 2BXZA 3GTGJ 1Y0NA 2M5WA 5EG0A 1P92A 3OWTA 5ICGA 3FDYA 2KIFA 3J7AO 3SZGA 4PFPA 1U3EM 3AELA 3A9YA 4BJ6C 3DXJF 4HA8A 4DGWB 1B72B 4ZTJA 3ROUA 4M74A 1MSEC 4LG0B 4ADBA 1X58A 3RQ4A 1XSXA 3ZRGA 5DV5A 3AENA 3NRVA 5E20A 1RI7A 5DS9A 4GEBA 2Z9XA 3DPTA 1VI0A 3Q0VA 3JU7A 2IBDA 3I4PA 1ASEA 1AY5A 5FT5A 5HXXA 4ENJA 1YHQI 3FXJA 2DFEA 4BL0B 2LLKA 5K8BA 1JUPA 1BW0A 3D5LA 4RAYA 1OCZH 3EYIA 2O1BA 2QVOA 1VQ5I 2AO9A 3AEJC 2PMUA 1TNTA 2WK9A 1LC7A 3K1PA 3A9XA 5L3EA 5EDNA 1W4MA 1WI3A 1KYZA 2ZXHA 3DBRB 2IGOA 3G1LA 4I99C 3H7FA 3RKXA 3JWBA 1OLTA 3BTIA 4BUPA 2OZUA 2JTVA 4QTRA 4BXFA 3GYHX 4MEYF 5H20A 3OSFA 1U8BA 3CP8A 4HX7A 5HS9A 4A93J 1XD7A 2HYGD 2EV0A 4XLFA 4IYOA 2JUCA 1IUGA 3PJ0A 2NS0A 2R0QC 4BHBA 3K1MA 1H1CA 3WTSC 5D5WB 1G2HA 4HV6A 3I16A 3K2ZA 1O4SA 3HUGA 3B1EA 3PIUA 1LW5A 3LA2A 3HC7A 2QYOA 4KICA 4PZJA 4H0EA 2O61A 4ANJA 2XHKA 1EH6A 5D5UB 2Q0OA 1UELB 4XJLA 1JF9A 4XRMA 3FD0A 4JX6A 2P8TA 1B9IA 1AMRA 1BI2A 3JRFA 1Y1WJ 2AS5F 1FZPB 4FX0A 4LIUA 1MH3A 3ZCOA 4BQAA 1AU7A 3HZJA 3TEDA 1BL0A 2O0YA 3JWAA 5LEKA 3S1MJ 4BE0A 2A6HF 3MWMA 3PNYA 3QOPA 1HKSA 3MKYB 4EJUA 4MHGA 4E7KA 1OMIA 3HM5A 1WGXA 4YIIA 3GZNB 2OZ6A 2VE8A 2VQGA 1FIAA 3WGIA 3FZVA 3MEBA 3TQNA 4UV9A 1M7YA 4B44A 3M3YJ 2C7TA 3OIQA 1WJFA 1D0XA 2FNIA 1DGDA 2IA1A 3O3KA 3DLAA 4IHSA 3JRHA 4D7MA 1AX4A 1YIJI 1VZ0A 1R5GA 1PYVA 1KA8A 2FBIA 3QYFA 2HOEA 3N0LA 5M49A 1T6SA 4M2KA 5LHGA 1O3QA 2FNAA 3M9AA 2GA2A 4PSWA 3TDUC 1S8NA 2E7UA 4WK8F 1T08B 2FA5A 2OAZA 4Q48A 1J09A 3GZDC 2Y2ZA 5CVVA 4LLLA 3WE3A 2W8WA 3FKIJ 2NVYJ 3K70D 2VYCA 2LMDA 4TMRA 4ZM4A 4M6VA 2H27A 3HYIA 3K4MA 3ZMSA 1LC8A 4Q47A 5G2PA 2WY7Q 2KPMA 4HDVA 1XG1A 3BG6A 3DBHB 4I0BA 4XL9A 3FK7A 3DTKA 2AHQA 2Y0SA 2HVQA 4OIQF 3HRSA 3MKJA 2W8TA 4B9BA 4E7HA 4IVNA 4RB2C 2VXDA 2LR8A 4TV7A 2ZSIB 5JLXA 2BHYA 1WZ2A 2WWYA 2HDCA 4WLHA 4HSTA 3GTJJ 1AKAA 4ADCA 1I39A 1FOKA 4CYDA 3DLLF 1RKTA 1W5CC 3F9KA 2KMUA 1XCVA 4KT5C 2HUUA 1VQOI 3EIBA 3P9IA 4GGGA 3QP6A 1F9NA 3T8TA 3ZRRA 3RKWA 3I0TA 1KONA 4B3AA 3QU6A 2C81A 5H2FC 2O0RA 1S0AA 3S3MA 4F5LA 2KQRA 3CCYA 1F1ZA 2O03A 1KU7A 1F5TA 4I98B 2EGYA 3ECDA 3K4CA 3A02A 3ISPA 2GMUA 1YS7A 1HDPA 2XB0X 2I8DA 1VQPI 1PMMA 2DT6A 3RZDJ 1DGEA 3OMYA 1KGSA 2RN7A 3KLNA 1FWZA 2FYFA 3B1CA 1LFBA 1Z1DA 5BQTA 1ZGAA 2L7ZA 2PN6A 5K5QA 3CLOA 4FETA 3LFUA 5BPIA 4CZCA 4HNUA 4LK0F 4ESBA 2WAQN 1G4VA 4UB6C 2HVSA 3GTQJ 2JVGA 3PDBA 2FM1A 1Z21A 2NAZA 1H0MA 1TW3A 2XVCA 2FQ4A 4W91A 1XGSA 3LL7A 4XLEA 4E3QA 3KP2A 3GZ6A 1RV3A 3GO5A 5GAEJ 3ZR8X 1QISA 1ASAA 5HDKA 1X2AA 4V2GA 2OGEA 1OYIA 1SPAA 2A68F 1IRFA 3VSKA 3EDPA 4HBLA 1FP1D 4PJMA 1AJSA 4K2BA 2FN6A 3TCMA 1TWHJ 2DYSH 1I27A 2M34A 4IXSA 2LY9A 5EEGA 1A5JA 5DM6F 1I5ZA 1XGMA 5HLGA 5BMZA 2NXNB 5JLWA 1BJAA 3ZMZA 1K83J 5GP9A 1AKHB 3MZ8A 3TFTA 2XV4S 2VKEA 2FUG2 3DFGA 5LGTA 4WX9A 3I4MJ 4B09A 3ISLA 1OCTC 2YCTA 5E1XA 3BG9A 3GFLA 4GYIA 2ZNYA 5FLXZ 3GWPA 4ZSWA 5LH9A 5M4BA 2BY0A 5H6QA 3ELEA 2GIVA 1CF7A 2ORDA 3BR1A 1SZKA 1MGVA 5J1UA 1J7KA 4ZDOA 5LHHA 2QF7A 1O3TA 3VP6A 4XQ2A 1QO0D 2HKOA 2VQCA 2BXYA 4RAFA 2O3FA 2NVXJ 5G09A 1K79A 3U2RA 3GTOJ 2XUBA 4MIMA 5HS7A 2RNGA 2IS4A 3S15J 4M72A 3QGUA 1AMQA 3CAIA 3ZQCA 1FC3A 2MH2A 2VT2A 1VQMI 2W84A 3TMOA 3OYKA 3H14A 2FQ6A 5LHIA 1ELUA 2VGZA 3QN6A 1DP3A 2LFBA 2KRCA 3OY9A 4R8DA 1VF9A 3ZQGA 1MLZA 3OYBA 1ASBA 1IUYA 2ZFWA 2QWWA 4OCAA 4K2IA 2V9VA 2VJ4A 5DJ9A 3EPZA 4PCQA 2GLOA 4LW4A 4ZLVA 4QPOA 1VQ7I 3V7SA 3FVUA 1K61A 1D5VA 1IRXA 3G6EI 3H92A 2CG4A 3ZQIA 4G6DA 3MCZA 4BXUA 2HOYA 5FLMJ 1CL2A 5F08A 3A8UX 5C6UA 4U1TA 2XROA 4A00A 2VLHA 5JFRA 2BW3B 2P0WA 2K40A 2X1DA 1ZLJA 2OUMA 3DEUA 1X1BA 2P5VA 3DKWA 2Z9VA 2L9RA 4EJVA 2VONA 1TOGA 1SVOA 3O6BB 2FMLA 5I92A 3OIPA 4UB8C 4GFBA 4Z6YA 3C18A 3G71I 3HQTA 2LDUA 1ODDA 1TWGJ 1S7EA 1NG7A 5EUDA 2OTJI 1T3IA 1BIAA 3FCRA 2VMXA 4E70A 2QENA 3GEZA 1PMOA 4C3HJ 3VFZA 1D1AA 4XLHA 1IAYA 5M5XJ 3KPHA 4HYEA 2NMPA 3RSNA 4AOAA 4BMKA 1MBJA 2X85A 1MJBA 3DZZA 1BC7C 2VASA 2VMOA 1P7JA 3S2DJ 4L0OA 3ONQA 2RFVA 2F48A 2G0EA 4RITA 3JRDA 1HKTA 2CH1A 3L1PA 2CW8A 3BZ6A 1PUFB 5HDNA 3FVXA 2R92J 4AO4A 5BJ4A 1XGNA 1RPWA 4LGWA 3JRCA 4F5IA 2VJJA 4JK1X 1EV7A 3H3UA 2CV1A 1KQ8A 4QPQA 4XRFA 5ILUA 2Z9UA 1YJSA 1HSJA 2FD5A 3BR2A 4FTHA 5B66C 6PAXA 3ASAA 3PGYA 4B4CA 5BOXA 3BCAA 3OOPA 2JJEA 2A07F 2BYJA 1IN8A 3CBFA 3QAHA 5ED4A 3IHJA 1S6LA 2QB3A 5K7HA 3FDBA 5B1AH 2KLOA 3DU6A 2HOZA 5TF5A 4DNCA 2ESHA 2EZHA 2TDXA 1AHEA 4L0ZB 4RM2A 3OYIA 3TQXA 3JSPA 5FRNA 1APLC 3IH2A 3BR6A 2W7NA 4KITB 3K6GA 3KP3A 4GYGA 1RUOA 1MDMB 2LRDA 4Y0HA 1VP4A 3ZN0A 2EINH 1RUNA 3BQZA 2LY1A 1V55H 3QPHA 1Q1HA 4PJJA 4IPAA 2B63J 4RGRA 2NRAC 3I58A 4Y33A 1DQUA 2M7AA 4A3CJ 2BIEA 3HXLA 4B1RA 5E3LA 1ZARA 3CC7I 1DU0A 4IY7A 4O3MA 3JTXA 5HDGA 1DKAA 3MVPA 4X1EA 3D6KA 4HAMA 3BS8A 3SHFA 3FHNA 2QQ9A 2HOTA 2LREA 4FL0A 1R22A 3PO3J 2EFPA 1DGWY 1OISA 2FEZA 2R7OA 4XRSG 2VGSA 1MDMA 2R3SA 4AYBN 2V1PA 3QU3A 3H3ZA 3SDBA 5EEHA 2D7YA 4W5KA 4XEWA 1QA6A 1HLVA 3PIOF 3IH4A 1J2XA 4WD2A 5A2QK 1FMWA 4KYWA 2HI3A 3GX4X 1IGNA 2R7XA 3ATHA 4YIRX 5CJ9A 2NOJB 2XF6A 2XH1A 4A69C 1YLFA 2DFHA 1V2FA 1W5SA 4J8LA 1Y1VJ 3GXOA 1Q1VA 4MFDA 5EZGA 1R5ID 1UG2A 1XB4A 3E2ZA 2CYYA 2DU9A 2P5KA 3JCUC 5EIGA 1BJZA 3I5UA 5EEAA 1J59A 2CU7A 1BR1A 1G3TA 1ZG1A 4MKJA 1N8PA 4WXBA 3BDDA 5FT6A 1UCRA 1G3YA 1XDSA 1XMAA 2BW3A 4LJZF 5ICEA 1ZC9A 5KAIC 1MBKA 1ARGA 5JHUA 3OYCA 2XAGA 3BTJA 4DZJA 2V6EA 3VK3A 2Z1DA 1Y56A 3CDIA 4G6QA 4C2MJ 1AKBA 5CQEA 1MMSA 3LY1A 4KMFA 4NHJA 3S2HJ 3HKZA 4S05A 2VBYA 4PSXA 5IP9J 1H9GA 4N4OB 5CVUA 4HLXA 2VKHA 4EATA 3ZMVA 2XBNA 3WU2C 4OAZA 4YFKF 4BA5A 5FKOA 3K70C 4W1UA 3DCFA 4M9XA 4XMYA 4BE2A 2E2HJ 3VWBA 2FBKA 2QA3A 3FXOA 2E7IA 5FKMA 2M45A 2JQ7A 4OMZA 1XSDA 1BW6A 4ADEA 2EFOA 2AXTC 4AIDA 3HHHA 3KZZA 3P6KA 3BWGA 5L3GA 2AY7A 1Z3XA 2XAUA 2YOBA 2QQ8A 1I3AA 3ABLH 5HNFA 3PJRA 4E7LA 3M5UA 1SVLA 1YITI 2K9MA 3PAAA 1WRJA 4M9SA 3VYUB 1MGTA 5IP6A 3KP7A 2M4KA 3QQAA 2IGKA 1WJAA 2P6TA 4XK4A 3WY7A 1STZA 2VIXA 3R61A 3KETA 1AKCA 3BR5A 1X4PA 3MZYA 1QHHD 1MNMC 1U08A 4IQJA 1D7VA 4ZWMA 1JI8A 1LDJA 4L9JA 2GAUA 2MABA 4A3BJ 1I1GA 3GUDA 3TW7A 5FRMA 1X29A 1Z6TA 3CDLA 1O62A 4EB5A 4IXOA 1RC9A 1LE8A 1LJ9A 4DZPA 2LK2A 3I64A 1XS9A 1Z67A 2G9WA 5B5EC 4OT8A 1LK9A 4NOGA 2ZJQF 4F7ZA 4LLNA 5DEQA 1OCCH 1MAQA 2DT5A 1PUEE 1KKJA 2OJED 1I41A 2R2NA 3AG3H 3BCXA 3WKSA 1ZG5A 2R7DA 5F0CA 2EK5A 4WYFA 3F6OA 4IO9F 4N0WA 1P9QC 1AAWA 5K1YA 2JMWA 2V26A 2E34A 1W7PD 3B1DA 3AG2H 3UE8A 3I71A 1D1BA 1HSTA 1M0OA 2K86A 2E7JA 2AY3A 1FT9A 1K78B 5EQCA 1BOAA 1VQ6I 2CUZA 5GADJ 2CUEA 3I56I 3BWNA 3ZZKA 4RIZA 4BGDA 2BZTA 1D0YA 4CYCA 1AY8A 4H51A 1SFUA 5FKLA 3TDZC 2NVTJ 3RI6A 2YR2A 1JUSA 4LB6B 4P9UA 2MBFA 1DJ9A 5ILSA 2OQRA 2KISA 3HRMA 4W97A 4CUGA 4BQOA 1W7LA 3FIWA 2L4MA 2Q2EA 3C2HA 3E3VA 1A31A 2KL4A 4XJPA 3C2BA 4U7BA 4ENNA 3ZRPA 5F64A 5E3NA 2XAHA 2ESNA 1KL1A 2W25A 2OTLI 3AATA 1UMQA 1TQMA 1SVMA 5D5XB 1WYTB 5E18F 1BN5A 4IOCF 4R5ZA 4W1XA 2O9LA 3ZPLA 3C2GA 2B7EA 2O8XA 4XQFA 3NARA 1YS6A 1E2XA 2XSDC 1FYKA 2X5FA 4GO1A 3V4GA 1G3WA 5EF6A 5EG0B 4KFCA 4ATPA 1PDNC 2Y0MA 4XM3A 2L0KA 3DF8A 3SZPA 2LH9A 4F5JA 5GTHC 1IAXA 2CJDA 1YOOA 1BI0A 2FOWA 3REOA 1AJRA 3G73A 2DGLA 4OIPF 4E6KG 3CCQI 1FBQA 1T56A 2DA7A 1FEXA 1AA7A 1TOIA 5DYMA 3F23A 1JT0A 1CQ7A 1LPQA 1VQLI 2V1DA 5TRDA 1R9TJ 1ASFA 2RDPA 2YU3A 3CF5F 3ASBA 3BQYA 3A03A 3ZQ7A 2ZXIA 4LLGF 2CFBA 3CQ4A 1KMKA 3G4SI 2WADA 5EYRA 3S16J 4CVQA 2Z99A 2JG2A 2RVCA 2G7UA 3H3VK 4LC3A 3G1OA 2ZB9A 3FMSA 3SZTA 1OKRA 3MEXA 2YX4A 3ZZJA 2BGCA 1JGSA 5HODA 1YNUA 2EH3A 4ZC3A 1R6RA 2NNNA 1G59A 3HHGA 5HNHA 1JKPC 5EFSA 2ZNZA 1U5TC 1MMDA 4YRVA 3C3WA 1BC8C 1SAUA 3K9TA 1ZAOA 2BI2A 4HZFA 4UUSB 2W7FA 1OPCA 1GLNA 1T95A 3K4LA 1WH5A 2Z9WA 3LSKA 5J1YA 4AVPA 4XOTA 1YW8A 4M6YA 3QP5A 2R7WA 3RBLA 2KRHA 1T98A 5D6EA 4RMNA 3VOMA 2GWRA 1Y4IA 4ZSYA 2Z20A 3BJAA 4A6RA 3CCEI 2ISYA 3Q5FA 3E6GA 3EIAA 3DEEA 1P3WA 5EGOB 2BKWA 1JUMA 3E5QA 4S0HB 2FMYA 4G8XA 4WXGA 2HQRA 4GE4A 4U0VA 4Y17A 4IOAF 1R4MB 4Q75A 4UVBA 4RGSA 4OC9A 4WLJA 4ADDA 4M3EA 1JHHA 1Z7UA 4OMAA 1UB9A 2VGVA 4LIVA 3QM2A 1WCMJ 4F5GA 1Y6IA 3P9KA 3H5RA 3M8JA 2AY4A 5ERIA 4LFUA 2X1CA 1CF7B 1ZGJA 1MDOA 1ON1A 1WHUA 3BZKA 3OYMA 3G7QA 3HPHA 4Q6RA 1D7UA 2QGUA 1X0MA 1HCRA 2G6WA 1C9CA 5BJ3A 4KIBA 4EV0A 1R1TA 2NVQJ 2HUFA 2V7FA 2F2EA 4BXXJ 2JVHA 9ANTA 4DBRA 2ZXWH 3CUQC 4KAMA 1VTNC 3ELKA 1NH3A 3BJ6A 2IPQX 2FE3A 4CCMA 4A0ZA 2MSYA 2VPLA 2EZKA 4LG3A 4C2UA 4LW2A 4M6XA 1GEXA 3W1IA 2W82A 3BTLA 2HZTA 2DA1A 2JK3A 3N97A 3PFIA 2A05A 4BHPA 4A3GJ 5EIGB 1OCOH 2H8WA 2OPTA 2DQRA 2E2IJ 2XPWA 4F5KA 2W8VA 2R7QA 1ZREA 4F52A 2XB5A 5E79C 3ZQQA 4E7JA 3GBGA 3LVLB 3ZGKA 1CL1A 4KXKA 2G7HA 2V9PA 2NS8A 3E0JB 1QRYA 2V4JC 8AATA 4HRIA 1KKPA 1OHYA 5GPCA 2W7IA 3EUHC 1GDTA 4A3FJ 4ZYGA 3W1JA 2OV7A 4HLYA 1LFPA 2HZDA 1CQ6A 2D66A 4XK1A 1ETKA 1NG6A
chains in the Genus database with same CATH