4N0BA

Crystal structure of bacillus subtilis gabr, an autorepressor and transcriptional activator of gabt
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
473
structure length
468
Chain Sequence
b'ITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKETGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription activator
total genus 133
structure length 468
sequence length 473
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4n0bA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4n0bA02
2HKOA 3FF5A 3FVXA 3NUBA 4ENNA 2ESHA 1AIBA 2VYCA 4W1VA 2XASA 5BS6A 1PMMA 4E3RA 1FZPB 1KMKA 2ZUKA 4ATPA 3FQ7A 5LHAA 2XUBA 4F4EA 1F1ZA 2KIMA 3KCCA 2JJGA 2BEOA 3EI5A 1CS1A 1X28A 2PMUA 4KMFA 4LLLA 1VTNC 2KJBA 5LHHA 3EI8A 2UXNA 5K5QA 1T39A 2D1HA 1S8NA 1IBJA 1TOGA 2HUIA 3JZLA 2L02A 5HXXA 2J5PA 3ZMDA 4IPAA 1ON1A 1TNTA 4ZSYA 1GCKA 3NYSA 3WGCA 1FYKA 2M8EA 2GXGA 3RKXA 2P6TA 3E6DA 1MGVA 4L9NA 5HDGA 5TJJA 2CJDA 3QM2A 4HDVA 4UV8A 3O2PE 2D65A 4ADDA 3KETA 5D5VB 2K4BA 2L4AA 3R0JA 3DKWA 4HZFA 1WYTA 5ICCA 1S3JA 1D7SA 2AY1A 4ZYHA 3SHFA 4BAYA 2M30A 4AD9A 2UWMA 4ITXA 3FCRA 2BI9A 5G2PA 1TOIA 1FPQA 1SD6A 3F9TA 1WWXA 2GMUA 3E6MA 3KP6A 3DODA 3HSRA 1IRGA 4I02A 3WGGA 2EFPA 3ZRPA 3DXWA 1AICA 1RV4A 5ED4A 3E2ZA 5I92A 1J2XA 4UUVA 2PO3A 2F5CA 2EFNA 2ZMEB 3R61A 3K40A 2O3FA 2DKBA 4F5IA 2XBNA 4GXOA 4XJLA 1F9NA 4ZDPA 2R5CB 4WK8F 3KGWA 4WB0B 5HDMA 2A3SA 2HORA 3QBOA 2CFBA 3K2ZA 5A2QK 4Z2YA 1SD4A 3KP2A 3ML6A 2E7JA 2FXAA 5F6FA 5TF5A 2FNPA 2XV4S 2BWOA 3F6OA 1XDSA 4AIKA 1GEYA 3CUQB 3CDHA 2VODA 1GC2A 2F8JA 3DXJF 1GXQA 5JR3A 1TOKA 1FT9A 2MLGA 1AMAA 2R2NA 3SXYA 3QPGA 2R7FA 2YSRA 1DPRA 1XSVA 1I41A 1JS3A 2BIGA 3WLXA 5JHUA 2QMAA 4BHPA 3CO6C 2X5FA 2P5VA 2FBIA 3JSOA 3MEBA 4M2KA 5ICFA 4R8DA 1LDKB 2VGWA 1EV7A 3GF2A 2ADUA 1TW2A 1NHAA 1RUNA 2YOBA 2YKVA 3L9FA 1SVVA 1AHYA 2FMLA 2NNYA 4BYYA 4A6RA 1TOJA 1ZN2A 1K7AA 2YR2A 5DV5A 4MKJA 5CVIA 1ZHFA 3KE3A 3R9AA 3IWZA 4EB7A 2CH1A 3ABTA 3GR9A 4EB5A 3AEPA 2PEXA 4Y0DA 3IF2A 1WKGA 3TO6A 4RS8A 3AENB 2UZKA 1DFOA 4A2UA 3ZP5A 4I01A 2VXZA 4KT5C 2L4MA 2ZJGA 3EUHA 2VBXA 2EZ2A 5LRSA 3LVKA 4PIWA 1UHWA 3E6BA 5HDKA 3BZ6A 1DJEA 3NU7A 3KEOA 3Q9VA 4MTEA 3SZTA 4LG0B 1CQ7A 3WGBA 4BHBA 3GW2A 3I54A 3FM5A 4EGYA 3BCAA 3AV7A 2DK8A 2OU2A 1T0FA 4UHOA 1DJ9A 1QIRA 3MBBA 3I16A 4PFFA 3I4PA 2VMNA 1OHWA 4AIHA 4OMAA 4R1HA 5G09A 1E2XA 1K78A 1BS0A 4NHJA 5L3CA 1ZLJA 4MQQA 2QBYB 5FT4A 4GE4A 1WKMA 4A6UA 3LFKA 2YX4A 1LW4A 5F1RA 2JJEA 4I2OA 3ABUA 5AIQA 3G73A 1MLZA 1LC7A 4UHTA 5FD6A 1MGTA 4KYOA 4ZYGA 4L0OA 2OA4A 4ESJA 1C0WA 1P4AA 3T8RA 4OCAA 3K0LA 2ZSLA 4EJWA 1OR7A 4RAEA 4LLGF 3ZQ7A 2FBHA 2ZC0A 4IXSA 4M71A 5FLXK 3GBXA 5HS8A 4JEXA 2EV0A 4IF4A 3GZDC 3RJPA 4E77A 1YJSA 1YIYA 4RGXA 1U5TC 1P3WA 4RKDA 1AMQA 4IRHA 5HLGA 2AY9A 3OKSA 2CYYA 5JI6A 4WXFA 4ZASA 3LA3A 3M5UA 5KVRA 4GYIA 3HMUA 1LNWA 1WYUB 2ZJ2A 3PDXA 1BOAA 3E2YA 1WYVB 4HYEA 1BBYA 3FZ6A 3P6KA 2AXLA 1AJRA 1S29A 4M2MA 1FBSA 3GX4X 4HLXA 4KIFA 2EPJA 2C0RA 2RQPA 1SMTA 5E8IA 3NYTA 3VP6A 3I4JA 1RUOA 3WX9A 5HLIA 1X2AA 1BJAA 3HTSB 2RVCA 5FFXA 1CL1A 4E70A 3PQJA 3QRFF 3WTYC 1LK9A 3GLXA 3ECDA 3RI4A 1YQAA 1BJNA 2H6BA 1JG8A 5HS9A 2R5EA 4AO9A 3LAPA 2PG4A 2BI1A 3MAUA 2DOUA 2YCTA 4A72A 3LA7A 3NRVA 1FP1D 2RN7A 3BPXA 5D4SA 1Z6TA 1UU1A 4ZZLA 3KKIA 3R0AA 4WP0A 5L3BA 2W84A 5JVTA 4E1OA 3MCZA 2D7ZA 1AOYA 4N9IA 4L0YB 4Q76A 1P6RA 2W57A 4U7BA 3CO7C 3D6KA 1XDUA 1I1SA 4KXKA 3I53A 4IY7A 3HIFA 2HOZA 1DTYA 1MJAA 2QENA 1W5SA 3KP4A 1IRFA 3KZYA 3WTUC 1YFHA 4U0WA 4PCQA 3LSTA 1R7JA 4WYDA 2AEUA 3PDBA 3QGUA 3C1DA 2OQXA 2VLHA 4RITA 1W7PB 3ISLA 1EH7A 4KICA 4HAMA 1R23A 4L9VA 3BC8A 3DU4A 2F5FA 2ZSMA 1M0OA 4W8IA 5G2QA 1CF7A 4J5UA 1TLHB 4HV6A 1ARIA 2F5DA 4QWQA 3I71A 4RGUA 2FU4A 4W5KA 1AJSA 2W7HA 1XGOA 3IC7A 1X29A 2YX7A 2DPDA 3RIRA 1IAXA 4MQRA 2HOEA 3CTAA 3LAJA 4A0HA 3ERED 1H9GA 2OQGA 4OMZA 1XSDA 2QYOA 4I0AA 1XMKA 2O8XA 2IA2A 1R1VA 2VGSA 4FT8A 5IT9K 4F5GA 1H1CA 1Z05A 2PN6A 2HP1A 3LV2A 3KLNA 3GWPA 3FZVA 3OOPA 1S6LA 2D1VA 4ADBA 5BJ4A 1KGSA 2BKWA 4ENJA 1BN5A 3ZRQA 3J81K 1C7OA 4K2BA 2ESNA 1LDDA 2FN6A 5EQCA 1OHVA 4EVIA 1B6AA 4BA5A 5EAAA 3IHUA 1GD9A 4BHCA 2Z1ZA 4B9BA 3UWCA 1XGSA 1PDNC 1BI0A 4LK1F 3W6JB 4IW7A 4RB0A 5LGNA 4GEBA 5DD8A 1X3UA 2O0YA 3RQ1A 1ZG5A 3HOTA 3GFMA 1TPLA 5FGMA 3WODF 2Z9VA 2BWPA 1BJ4A 3LVMA 4QLCU 5LEJA 3O3KA 4UXNA 3A9XA 5JAYA 1CL2A 2A07F 2QQAA 1L3LA 4O3MA 1QZZA 3FXQA 3WTSC 2Y75A 1T6SA 4LLNA 3TGNA 2VMSA 3F6TA 3TO9A 2OKKA 4UHMA 5LEKA 4HX8A 1D2FA 2R0TA 5H6QA 3FFHA 2C7TA 2DKJA 1FC3A 5DJ1A 2ISYA 1REPC 3BWOA 1IXCA 1FLIA 1DJUA 4IXZA 3VK4A 2X5DA 2QA3A 3TQXA 2HKXA 1Z6RA 2W8WA 1YIZA 3VAXA 1I43A 4UVCA 2W8VA 2WV0A 3U2RA 3G3ZA 4A0ZA 4G7ZF 4OIQF 4OBUA 1SZKA 4W91A 2ELHA 3WZFA 2MA3A 2E1NA 2ISZA 7AATA 1G4XA 1SMYF 3AATA 1N8PA 1ELQA 4TV7A 2AATA 2JRTA 1IN4A 3ZMUA 3E9KA 1G3YA 3GZDA 3AAFA 4CZZA 3B1DA 3E2ZB 5EUEA 4WXCA 3DV8A 4RB1A 4A6EA 1ZREA 1ASMA 4IX8A 1U5TA 2DPUA 4G6DA 3DEUA 2OAZA 1R1TA 3HYIA 1BI3A 2IVMA 2Z9WA 2VMVA 2Z3YA 3FFRA 1QPMA 4OINF 1Z7DA 1ASBA 1KMJA 3F6VA 2XH1A 3QPTA 4Q75A 3JTXA 2L3DA 4KN4X 1QJ3A 3BS8A 2NAZA 4M9XA 3CQ5A 1UB9A 3BP8A 5D95A 1ASCA 3HHHA 3SZPA 1X0MA 3QI6A 3IWFA 5E20A 3U9GA 2Y48A 3PQKA 3I5UA 1GC4A 4JE5A 1HXDA 5A2QZ 1R1UA 3E2FA 4UQVA 4BA4A 3N75A 4TMRA 4ADEA 1S0AA 3F0HA 2W7DA 3GZCA 1D7RA 2ZKZA 4WXBA 3EZSA 2BYJA 3RUYA 1AY8A 2GSAA 2CB1A 2Q8KA 3EYYA 1Z3ZA 2K7LA 4FFCA 2ZO4A 4LNMA 3QN6A 2MH9A 4BQ0A 1UFMA 2JZYA 3NNKA 2KRFA 1MDOA 4KIGA 3PJ0A 1I6XA 1O7FA 5FT8A 5E3KA 1UCRA 4DNCA 1TOEA 2DAOA 2H94A 3RYPA 4F5JA 4WXDA 2CANA 4A12A 3DZZA 2NRAC 2PJPA 4UVAA 4CXFA 3BJAA 1W5TA 4O5VA 4NB5A 1VP4A 5KK1A 5HDNA 4PZJA 1G7WA 2XVCA 3H7FA 3DRDA 3QP6A 1KYZA 4JEZA 1DDNA 2COMA 2D64A 3JTGA 2G6WA 2VMWA 3Q9SA 3V8LA 2MC3A 3FMQA 3L00A 1TARA 4KFCA 4DQ6A 5BJ3A 4CBRA 2EV5A 2HTSA 1V3FA 3T0YA 1SAXA 2VOOA 3CAIA 2XKOA 1PG8A 4LMYA 5ICGA 1BJOA 1XGMA 1S07A 3HHGA 3V7SA 2Z1YA 5D5WB 4A6TA 2IP2A 1G7XA 4WX9A 2G9WA 2HUFA 4JK1X 4XJMA 1K78B 2D66A 4AH3A 2GAUA 2VBYA 2HYGD 2LF7A 2VMZA 1T2KA 1XCVA 5K8BA 4HF1A 4L9TA 4BQAA 2D7YA 1AY4A 4ATQA 4YFNF 2VC1A 1XB4A 3ULQB 1IAYA 2JTVA 3IRQA 3N0LA 3V8JA 1YS6A 1BC7C 1HKTA 1LS3A 3D0SA 2BE5F 2HQNA 4GDYA 2RNJA 2FBKA 3PIUA 1ZAOA 2Q7WA 3RTRA 2DK5A 1RVYA 2HZTA 3FZ8A 2FQ6A 1O3TA 1OXOA 4Y17A 1CQ6A 3M7GA 4AWXB 4IHSA 3COGA 1W7PD 3WE2A 5H20A 2XAHA 2V79A 2JPCA 3EDPA 1LKCA 3KGXA 3FXRA 5HVQC 4U0VA 4PGGA 3NU8A 3WGHA 3R60A 1SPAA 5JFRA 5ERIA 3DFGA 4WYAA 4OIOF 5FLXZ 1KKPA 1YJYA 2JT1A 2RDPA 3MEXA 2X4HA 1L0OC 1JS6A 3N5MA 2DGKA 3TFTA 3VK3A 1MJ9A 1ZLKA 1USTA 3ELEA 3K7YA 2D61A 3EIBA 3WTVC 2DT5A 3AEJA 4Q31A 4H51A 3F8NA 4RLGA 3GZ5A 4I0BA 3LY1A 1B8GA 1BI1A 4KN7X 1WSUA 1KKJA 2WWYA 3PD6A 2W7MA 1OYYA 3FXUA 4WYCA 1G3SA 3MZHA 1FY7A 1YS7A 5EEHA 3ZN1A 1FBQA 3ZPLA 3BJOA 1BIAA 4M6YA 1MAPA 2C81A 4EU1A 2CH2A 1JHHA 3NX3A 3FVSA 3F8FA 3GYHX 2FNUA 4ZYDA 1VJOA 4G9YA 4DBCA 2AY2A 1SF2A 4IJAA 4XAUA 1GXPA 4MEXF 4QGRA 2VMYA 3TQNA 4WYEA 5J8FA 4WXHA 3K9TA 2A68F 3GUDA 4KUMA 4F5MA 5LLQA 1B9NA 1EQBA 4HLYA 1J5YA 1MZBA 2K86A 3J80K 2YKYA 3VEPA 3IHJA 1FX7A 4ZM3A 3RPQA 2H6CA 4KMUX 3DXVA 4HF8A 2L01A 1FSHA 5AIPA 1ZOBA 1B4XA 3COAC 1GHCA 2O6GE 2W8JA 5ILSA 5AX8A 4ON0A 2VI8A 1EJIA 1M6SA 1CF7B 2JGTA 1AHEA 3W1HA 4A0GA 4OT8A 3R4TA 3ZRRA 1PP8F 4FX0A 4ZZDA 2P6SA 4LNJA 1QZ9A 1RI7A 2ACJA 5DCMA 5DYMA 3JTHA 1DPUA 2CJHA 3E5XA 5D6FA 2VMRA 2CQKA 3QU6A 3TDZC 4IYOB 3KP5A 4EJOA 4Q47A 2HFHA 1FNNA 1JGSA 5CVRA 3QAHA 1MDMB 3HSEA 5CYVA 2ZXJA 1ASDA 2EFQA 2FE3A 1AAWA 4ZDLA 2FQ3A 1MJBA 5M49A 4LW2A 5BMZA 4FL0A 2KKOA 2EFOA 2QWWA 2HOYA 3GO5A 1SD7A 5CVJA 1ARHA 5DJ9A 3LVJA 1CZCA 4K2IA 4WCGA 1FC4A 3B8XA 1J59A 4HX7A 1ECXA 5IWQA 5IT9Z 3KFWX 4G8XA 2Z9UA 5G4JA 1TNSA 2EWNA 3VOEA 3CQ4A 2DQLA 2Q2EA 2BBYA 4GSAA 1B9IA 1JF9A 3J81Z 3GJUA 1H0MA 5L3GA 1K6OA 2OZUA 3RI6A 2Q0OA 4M6XA 3PGYA 2RV8A 3LA2A 3EI6A 1BW0A 4S05A 4E3QA 2XAQA 2ZMEA 2IT0A 1QGPA 1KL1A 2E7XA 1HQCA 1Z9CA 5EUDA 3FKDA 2M87A 3QOPA 2R5CA 3TOAA 2E1CA 1FG7A 4WB0A 1HSTA 2WK7A 1AWCA 1W23A 3KP3A 2DQRA 1Z7UA 1G4DA 3B46A 3UAKA 2GIVA 3GETA 4EM2A 5L3DA 3FM3A 3HBXA 4BMKA 2F5EA 3K69A 5D8LB 4F5HA 2FF4A 1LEAA 3T5XA 4EQQA 4U7DA 2ZNZA 1AY5A 5EIGA 1BIBA 2RFVA 2V1UA 1O3SA 3W1IA 1O69A 1SZUA 5L3FA 4ASNA 3GEZA 3LG0A 1QQIA 3NUIA 4RM1A 1FYLA 2VGZA 2AS5F 4CXQA 1FSEA 3L2CA 5C6UA 2GWRA 5ILVA 4IRIA 1T38A 4F7ZA 3NRAA 4DGTA 2XAFA 2VE8A 2L54A 1ASAA 1GEWA 5D5SA 1WRJA 4O6JA 4R2NA 5CJ9A 3WY7A 2GB3A 2BV6A 1V2DA 2QBTA 5K5OA 1AHFA 1LJ9A 3I59A 1I5ZA 1G4VA 1HKSA 2W7FA 4RGSA 4XRFA 1ZG3A 5FT6A 2DTRA 3P1TA 1AMSA 4L5IA 3C3WA 1YJZA 5D5UB 1RVUA 1U5TB 3ATHA 4UHNA 4LJZF 4P96A 2HDCA 1S7AA 4HV5A 3GFJA 4JBAA 1F4KA 2CTZA 1LVAA 2HR3A 1IN8A 1KQ0A 1IN6A 2A61A 3BN1A 2BYVE 2Z33A 1I27A 4HOBA 2LF8A 4OC9A 1S06A 5HS7A 3FX3A 5LBQA 2HEOA 4LB5A 2W25A 4P55A 8AATA 3MAFA 4YG2F 2VIBA 2X3LA 5G0AA 1OKRA 1BT4A 4F5FA 3QPHA 1ELUA 2ZFWA 5HOOA 2RGVA 3JWAA 4M73A 1KL2A 3G0TA 2FOKA 1V72A 3BJ6A 4GYGA 4R8HA 4P3MA 4M9ZA 4AZKA 5ILUA 2VONA 1M0PA 4MSOA 2IA1A 4PFNA 3DR4A 1W3UA 5AONA 2QBYA 1O7LA 1ZODA 2HZPA 1YTYA 1LC5A 2RKHA 2VMQA 3A2BA 3TOBA 3WG9A 4YIIA 2OZ6A 1IUYA 5L3EA 4Q48A 2YU3A 2YRRA 3ZZJA 3Q8NA 4AVPA 5DDGA 1HW1A 1GVJA 4K2EA 2Z5UA 4ZLVA 1WQ2A 4WWCA 4UVBA 4K2MA 4OMYA 4JEWA 3HVYA 5HLHA 1FOKA 1YW8A 2YCNA 2CGPA 2C6YA 3HOSA 3WCOA 3AEMA 3L44A 3ZMSA 4UNOA 1GDEA 5J8QA 3B1EA 1Q1HA 1QGNA 3ZMZA 3UE8A 4GCVA 5M4BA 3AEJC 3A8UX 1JHFA 1AKCA 2O0RA 3ACZA 5FO5A 3SQNA 3MADA 1UHMA 1MLYA 2BWNA 1WYUA 2PLYA 3G8MA 4ZM4A 4U2HA 1UU2A 3RCHA 2NS0A 4L5JA 1O3QA 3ZN0A 1ZH5A 2O03A 3C7JA 3MAJA 4A00A 1D8JA 1XI9A 1BJOB 3DQVC 1FWZA 1S08A 5LHIA 4IRGA 2YRIA 2HQRA 2IRFG 2DI3A 4XSXF 2BYLA 4N0WA 1ON2A 4Q4ZF 2QUFA 3BV0A 1WYTB 3FWEA 4I98B 3T32A 4LW4A 2EJRA 4RAZA 1KU9A 2VLFA 2MD5A 3IRRA 3VB2A 2HWVA 2V0YA 4CXRA 4RIZA 5K5RA 3T1BA 4GRXA 3B73A 4ETSA 3HRSA 1YIOA 2VOPA 1YOOA 3A9YA 1HKQA 2QM3A 3L7WA 1XSXA 2A69F 3GFIA 5BPDA 2QLZA 2K02A 1J9IA 3IKVA 3WKRA 1GC3A 2D63A 1ORDA 1DP7P 3DPLC 4CHUA 4U1TA 4HBLA 1YAAA 3H3ZA 4BXUA 2M45A 5E1ZB 3RPUA 4A0RA 2GA1A 2EO5A 5DUKA 4OBVA 1BQDA 4KDPA 1JE8A 2LSOA 2OGEA 1LC8A 4XJOA 2CSTA 4I7HA 1MAQA 1ASGA 5FFZA 1TTYA 4HQEA 3DR7A 4M2JA 2QVOA 3NDNA 2CWEA 4Q5SF 5EUNA 4L0ZB 1LB2A 4YFKF 2DO7A 3CUOA 4EMYA 5DB5A 2FA5A 1ZG1A 1W7PA 4O6ZA 4CO8A 3LQRA 3BCBA 3EI9A 2OQRA 2JJHA 4CYDA 4EJUA 4L18B 2FSWA 1R5HA 2CINA 4WYFA 3AOWA 2Z9OA 4A0FA 5J8CA 1WI9A 3PD6B 1ONVA 1P2FA 1AMRA 1RV3A 2CFXA 1J04A 1T98A 3P9CA 2D45A 3EYIA 1P4XA 4P9UA 1IW7F 3N4MA 3F8CA 2MLKA 2KJCA 5H6RA 2VMOA 3AEOA 4GO1A 4HVKA 1M0QA 2CW0F 1IN5A 1YW9A 1SFEA 2EA2A 4M74A 1U8RA 2STTA 5F64A 5D4RA 1B4AA 1IX8A 1DUXC 1IF1A 2A5YB 5BPIA 1SZSA 4KAMA 1TATA 5DUIA 4WLHA 3I64A 5BQTA 3MKJA 3RBLA 2Z9XA 2CG4A 1AAMA 4ESBA 2WKAA 1J0RA 3FQ8A 3HRMA 2XAJA 5CLSA 1C4KA 1DKAA 1R5GA 3K28A 2ZP7A 3QP5A 5IT3A 1U2WA 3B02A 2W24A 1AIAA 2E7WA 1GEXA 1PFFA 3FZ7A 5E1XA 2WK8A 4MQPA 1BI2A 4HF0A 4MHGA 3CUQC 1T3IA 1M7YA 1XN7A 2XAGA 3J80Z 1MKMA 2P7VB 1C7NA 2W8UA 2DFIA 2X0LA 2PBIA 3K1NA 2AY5A 3WKSA 5DCMB 1R58A 4FX4A 2LDUA 3MC6A 1AKBA 1TQPA 4M72A 3F3XA 1I48A 4ISYA 1J7KA 3H14A 1YW7A 1E5EA 2HUUA 4XBFA 2LNBA 1O3RA 3ZMVA 5LGUA 3ECHA 4OIPF 3F23A 3L09A 5D6EA 2AY8A 2G7HA 2CSOA 2TDXA 2VMTA 3MQ0A 5ICEA 3HQTA 1N2TA 4AO4A 4LFUA 3G7QA 4JEYA 3JAMK 1M4NA 4YIFA 1KA8A 2P7CB 4LGWA 2GA2A 1HW2A 1KU3A 2CJGA 1G6NA 5CVUA 3WE3A 3RBFA 1D3YA 2XROA 4AIJA 1O61A 4P9FA 1IJIA 1F5TA 4WLJA 1U78A 2D2WA 3II0A 3REOA 5FB2A 4MGRA 1ZRCA 2VBWA 3ASBA 4XLNF 3FMRA 3V7CA 3RYRA 3E3VA 5J6XA 1D7VA 1KQ8A 4ZYEA 1RNLA 1Y0UA 3MZYA 2GQNA 1O62A 1IX7A 5FD5A 1S09A 3AOVA 1G3TA 4PDKA 2E7UA 3H3UA 2X8UA 1QZYA 2W8TA 1B5OA 4IHTA 5TRDA 5LHGA 3L8AA 3BWNC 5D8KB 6PAXA 4RJYA 3PFIA 2VIAA 1R36A 2IA0A 2JSCA 4JE5D 2PB2A 3AELA 1KU2A 4CDGA 2VC0A 3CJNA 1RZ4A 2G7UA 5DEQA 4BNCA 2FNIA 3NEUA 5EIGB 1OPCA 2QQ9A 1MDXA 2AY4A 3EZ1A 1SFFA 2DR1A 2W85A 4A6DA 2BI2A 2IW5A 3JWBA 2F2EA 2AEVA 4RJ0A 1SFXA 1YO5C 2STWA 1J32A 4LNLA 1AHGA 1VEFA 3BWGA 2VN2A 1FG3A 3CQ6A 3ELPA 4G7HF 2AY7A 3OP7A 3ROUA 4ENMA 1QBJA 3WGIA 1Z1DA 3I59B 3AEMC 4F5LA 4ZWVA 3NTJA 4MKKA 3HSFA 3OV8A 5E5IA 2CO5A 2W7KA 5K1YA 1FBUA 4P7YA 3C18A 3E77A 4G7OF 3PDBB 2R7DA 3S2WA 4YFXF 3GSBA 4OIRF 1ZGAA 1BC8C 1ASLA 2VGUA 4CICA 1ZRDA 1IZ1A 4F5KA 1U08A 3CLOA 3HL2A 4JQFA 4RB2C 2V6CA 2DBBA 2QZ8A 3RKWA 1AJSB 2YHKA 3W6KB 2E7IA 5HHYA 3DF8A 3FRKA 1QO0D 1TQIA 3BY6A 1J75A 4RGRA 1ZARA 3MAFB 2ZCWA 1I29A 1V4RA 1DGEA 4GGGA 4Y0HA 4EFFA 1CGPA 1M32A 1H9TA 4XJPA 3PPLA 1BJWA 2ZNYA 2DW4A 5E1WA 4EV0A 1ARTA 4HQMA 1YG2A 2A6EF 3MWMA 4B98A 4RKCA 2VMUA 4ENKA 1ASFA 1CQ8A 5D5XB 4A0YA 4PVFA 2OGAA 4WXGA 2XGXA 3O6BB 1U3EM 4M9SA 3LQQA 2P5LC 1WKHA 4N0BA 2FEZA 3FQAA 1XEYA 1W7MA 2BHXA 3E6GA 2UXXA 2QQBA 4EMSA 1BM9A 1MD0A 2HP2A 2JISA 1AX4A 2HGCA 1OYIA 3TO7A 4EM1A 1QJ5A 4JEVA 1D8KA 2TPLA 1OATA 3EUCA 1EH6A 4L9JA 4D0PA 3RDIA 2AY3A 1EH8A 1OMIA 4ZSWA 3QU3A 1IAWA 2FYFA 1STZA 1LEBA 5FT5A 3F72A 4WYGA 4EGZA 2HYFA 3PAAA 3EI7A 1W4MA 1XMAA 3JU7A 1TQMA 3QHXA 2XIGA 3F8BA 3RCHB 2WTEA 5DX5A 1XGNA 2W7GA 2ZBKA 3CUQA 2YCPA 3EQLF 1USSA 5DD4A 1O57A 3FD0A 2KIFA 2OATA 2V1XA 3B1CA 3E97A 4IVNA 3HRUA 4HDUA 4EJTA 1ARSA 3JW4A 1UU0A 3BDDA 2MBFA 2AY6A 4A5MA 1FYMA 2JJFA 1YLFA 2B0LA 4ITGA 5F8VA 5M46A 2Z67A 4OU0A 1E5FA 2OKJA 2NNNA 3I58A 2XKPA 3BROA 5E4ZA 1SFUA 1AHXA 3USFA 5BOXA 3DPTA 4HA8A 4JF0A 2VGTA 3E5QA 2FRHA 1HSJA 3WU1B 1ZC9A 1KYWA 3F8MA 3Q5FA 1B1BA 1N31A 2BIAA 1TASA 3LWSA 1PMOA 1P92A 3P7NA 4XSZF 4KIBA 2PMHA 4LC3A 3HUGA 4CGZA 4B09A 2VT2A 3GZ6A 1B5PA 5EEGA 2R3SA 4HF2A 3K1PA 2GXBA 1D5VA 1ODDA 3H92A 3R4KA 2MH2A 4BH9A 3TDUC 3SFZA 3AENA 4N9HA 3M8FA 3DC1A 2E54A 4MQ9F 2JG2A 1ZRFA 1ULYA 3NQOA 1IUGA 4ADCA 3ELKA 2V1PA 4OTLA 1E17A 4R79A 1FP2A 2VE9A 5E18F 4NQWA 1PUEE 3WTXC 3BWNA 1YYVA 3MC6C 2H27A 3FDBA 2DGLA 4I8AA 4DQ2A 4PGHA 2EGYA 4R5ZA 1JXSA 1C0NA 3VOMA 1TBXA 4LG0A 3HTUA 3VFZA 1AKAA 3MFKA 2VT3A 3ZZKA 4MQVA 4J8LA 2GQQA 3HDOA 3GXOA 9AATA 4EM0B 1LQ1A 1XD7A 2NMPA 1V2FA 3F22A 3TKYA 2XRNA 3W1JA 4WF2A 4G94A 2P5KA 1OHYA 2D5YA 4AZJA 3HLMA 4KNYA 4IYOA 4MY5A 1GBNA 4XK1A 4WD2A 1B9HA 2ORDA 3T8TA 3ASAA 1MDMA 3NYUA 4IXOA 2QLRA 2YKXA 3EETA 3VODA 4MTDA 1QISA 2LKPA 4GE9A 2XHKA 3FHZA 4R5FA 2HS5A 1KQ9A 1IXSB 1C7GA 1LW5A 5DCFA 1R22A 2DU9A 1PP7U 3VK2A 4U0YA 2J5OA 1EG5A 3JSPA 1BKGA 2OD5A 1ASNA 2BI5A 3ISPA 4U88A 3V7RA 4Y15A 3ZMTA 1ASEA 4ZH4F 1OXPA 2EV6A 3E6CC 4RB3C 4ESFA 2DLLA 2O61A 1XCBA 3P9KA 1U6GA 2EK5A 4UOYA 2C44A 1OYWA 3BPVA 1WYVA 5E17F 2HTJA 5G4IA 3BOQA 3R6SA 3N97A 3K1MA 3HT4A 1ZYRF 4ZAHA 2V1DA 3FVUA 4FHTA 5EFSA 2W7IA 2GZWA 2EH6A 2PQ8A 4KYWA 2OBPA 2DGMA 2FMYA 3KE2A 3M9AA 2PFBA 2Z61A 2BIEA 2Z20A 2K27A 2M1BA 1H0CA 4GE7A 1BQAA 3A9ZA 2FNAA 3GFLA 3FMSA 1Y4IA 2VGVA 4W1WA 1K79A 2P8TA 1RIOH 1ZGJA 1C9CA 3U1DA 3LVLB 3TCMA 3P9IA 4LD5A 1I1GA 5LGTA 3KP7A 2YKUA 2Z99A 3IL2A 4MNUA 4I09A 3KLOA 1CZEA 2W7EA 1HW5A 1P4WA 2VMXA 4Y0IA 1B59A 2V9VA 2QB2A 1TW3A 1IX6A 1YNUA 4JF1A 3HRTA 3EIAA 2ZYJA 1GC0A 1O4SA 4NOGA 2KIUA 1A04A 2M5WA 4G6QA 4XQ2A 2K4JA 4EJVA 3D5LA 3ECOA 3WCNA 4HW0A 4W1XA 2W7JA 2H09A 4ZDOA 4OOIA 3CBFA 4A5NA 3JAMZ 1M0NA 1W7NA 1G3WA 2VBZA 1WSTA 4MEYF 1D7UA 2EFWA 2BGCA 3RKYA 1MDZA 4CVQA 4LK0F 4HX4A 1S7OA 2A6HF 4IXAA 2IPQX 5EAVA 3GWZA 5LRRA 4Y13A 1Z91A 3I0TA 4P5OA 3E5UA 2PI0A 2HOXA 2Y0MA 5CVVA 5E8GA 2QB3A 4Q6RA 3I5TA 4XLPF 3F21A 3V4GA 2JPBA 3IKTA 5M4DA 4CBSA 2VI9A 4S04A 3WTTC 3FSLA 3WU0A 2RC4A 1SD5A 3DYDA 4XEWA 4TN4A 2WC2A 4ZWMA 4BHDA 3DP7A 2O1BA 1V2EA 1IN7A 2BI3A 3J7AO 3JW9A 2PB0A 4H0EA 3WTZA 5F9SA 1QNTA 2P4WA 3FTBA 1IVRA 2IJLA 4LB6B 1W7LA 3M8EA 3V8KA 3TATA 4B8XA 3LWFA 2WK9A 1LDJA 2FM1A 1HBXG 2VMPA 1UKJA 3KZZA 1DGDA 1B9MA 1QITA 1CJ0A 1IXRC 3BCXA 3BB8A 2EA4A 1ARGA 4KA4A 4WBTA 4AOAA 2ETHA 3GVAA 5LH9A 3TFUA 2NYXA 1R00A 4UV9A 2EB7A 2O7CA 2YPRA 4RAYA 2EZ1A 4A0XA 3KEQA 3PA9A 2W7LA 4OYTA 3M1EA 2GMSA 2CY8A 3WTWC 1KU7A
chains in the Genus database with same CATH superfamily
2HKOA 3FF5A 3HJEA 3FVXA 3ZQHA 4FE4A 4ENNA 3NUBA 2ESHA 1AIBA 2VYCA 4W1VA 2XASA 5BS6A 1PMMA 3OIOA 4BBRJ 1MBFA 4E3RA 1FZPB 1KMKA 2ZUKA 4ATPA 3FQ7A 4XKVA 5LHAA 2XUBA 2OJED 4F4EA 1F1ZA 2KIMA 3KCCA 2JJGA 2BEOA 3BLYA 3EI5A 3I3LA 3H9QA 1CS1A 2PMUA 1X28A 4KMFA 5GADJ 4LLLA 1VTNC 2KJBA 4IHWA 5LHHA 2E1OA 3EI8A 2UXNA 5K5QA 1T39A 2D1HA 4IOAF 1S8NA 1IBJA 1TOGA 2HUIA 3JZLA 3QYBA 2L02A 5HXXA 3CCLI 2J5PA 3ZMDA 2BVMA 4IPAA 2TRTA 1ON1A 1TNTA 3AG2H 2DXIA 2WA0A 3W3CA 5K7FA 4ZSYA 1GLNA 1GCKA 3NYSA 3WGCA 2ELJA 1YHQI 1YRNB 1FYKA 2AY6A 3PM1A 1OCPA 2H8WA 2M8EA 2GXGA 3HPGA 3RKXA 3CZ6A 2P6TA 3E6DA 3QYFA 5M46A 2IEKA 3OMYA 1MGVA 4OAZA 4L9NA 5K7ZA 5HDGA 1R6RA 5TJJA 2CJDA 3QM2A 5J1YA 4HDVA 4UV8A 1EA3A 3O2PE 2D65A 3KETA 4ADDA 3C2BA 2K4BA 2L4AA 5D5VB 1WJ5A 3DKXA 2XF7A 3DKWA 3R0JA 2GBYA 4HZFA 4PJMA 4CCKA 1WYTA 5ICCA 1S3JA 5FRMA 3QYEA 1D7SA 2AY1A 4ZYHA 3K7AJ 3H5NA 3SHFA 4BAYA 3W2AA 2M30A 1T33A 1B8IA 2EPFA 4RBOA 4AD9A 1PVEA 3BR0A 1VQ4I 2UWMA 4ITXA 1WFXA 3FCRA 3OYMA 5LFAA 2BI9A 3HG9A 5G2PA 1TOIA 1FPQA 1SD6A 3F9TA 2GM4A 1WWXA 2RQQA 2X1CA 2GMUA 2JMWA 3E6MA 3KP6A 3DODA 3DCFA 3HSRA 3L2UA 1IRGA 4I02A 3WGGA 2EFPA 4C3JJ 2GOMA 3BG6A 3S2HJ 3ZRPA 1VQNI 2M4KA 3OYDA 3LSJA 3DXWA 1AICA 1RV4A 5ED4A 3E2ZA 5I92A 1J2XA 4UUVA 2PO3A 2F5CA 2EFNA 2ZMEB 3PIPF 1B72A 2E1MB 3R61A 2O3FA 2DFHA 2DKBA 3K40A 4F5IA 1WJFA 2XBNA 2FQ4A 3HZJA 4GXOA 4XJLA 1WVRA 1F9NA 1YX3A 2DA6A 4QPOA 1UG2A 4ZDPA 5HLTA 4WK8F 2R5CB 3KGWA 4WB0B 5HDMA 2A3SA 3HOYJ 1QRYA 2VKHA 2HORA 3QBOA 2CFBA 3K2ZA 4S0HB 1ITYA 5A2QK 4Z2YA 1SD4A 3KP2A 3ML6A 1TWHJ 2FXAA 2E7JA 2ID6A 5F6FA 5TF5A 1OCCH 1LE8A 2OPTA 2FNPA 4BBSJ 2XV4S 2BWOA 2KPMA 2VUMJ 4J19A 3F6OA 1XDSA 4AIKA 1GEYA 4CSWA 3CUQB 2Y0SA 3HB9A 3CDHA 2VODA 1GC2A 2F8JA 3DXJF 1GXQA 5JR3A 1ZR2A 1TOKA 1FT9A 2MLGA 1AMAA 2R2NA 3SXYA 3QPGA 2R7FA 2YSRA 1DPRA 3FKJA 1XSVA 1I41A 1JS3A 2BIGA 3WLXA 1PJRA 5JHUA 1IG7A 2QMAA 1TT5B 2VI6A 4B3AA 4BHPA 3CO6C 2P5VA 2FBIA 3JSOA 2X5FA 3MEBA 4M2KA 3D5SC 5ICFA 3ZQCA 4UY8I 1LDKB 3K4JA 1IV8A 4B3XA 2VGWA 4R8DA 4PUSA 1EV7A 3GF2A 2ADUA 3OYJA 1TW2A 5B66C 1NHAA 1RUNA 2QKLB 2YKVA 2YOBA 3L9FA 4BEHB 3BTJA 1SVVA 2UV1A 2BY0A 4XK4A 1AHYA 2FMLA 2NNYA 4BYYA 4A6RA 1TOJA 1ZN2A 1K7AA 4A3JJ 2Y2ZA 2YR2A 5DV5A 2HDDA 3IAS2 5CVIA 4MKJA 1ZHFA 1KONA 3KE3A 3R9AA 3IWZA 4EB7A 3NWTA 1FMVA 4XQFA 2CH1A 2HQAA 3I4MJ 3ABTA 3RZOJ 3GR9A 2R92J 4F92B 1JJ8C 1GVDA 3OL4A 3ZQQA 4EB5A 3AEPA 2PEXA 4Y0DA 5HNHA 3IF2A 1WKGA 3TO6A 4RS8A 3AENB 2UZKA 1DFOA 4A2UA 3ZP5A 1RKTA 4I01A 2R7UA 2VXZA 4KT5C 3W2VA 4IX7A 4A3MJ 4BY1J 2L4MA 4XONA 3RSNA 2ZJGA 3EUHA 5HNFA 4CCJA 4A69C 2O8KA 3AL0C 5CPRB 2VBXA 3BZCA 3DEWA 5LRSA 2EZ2A 3LVKA 3S1NJ 5J4YA 4PIWA 2F4OB 1UHWA 3E6BA 5HDKA 3FXOA 3BZ6A 1X1AA 3CCMI 1DJEA 3NU7A 3ZRGA 2LY9A 3KEOA 3Q9VA 4MTEA 3SZTA 4LG0B 1CQ7A 3WGBA 4BHBA 3GW2A 3I54A 3FM5A 1NTCA 4EGYA 3BCAA 3CCUI 2F6CA 3BR3A 1MNEA 3AV7A 2DK8A 2OU2A 5IYCJ 4DZPA 1T0FA 4UHOA 1DJ9A 3S16J 2KIQA 1QIRA 3I16A 3MBBA 3I4PA 2VMNA 4PFFA 4FISA 1OHWA 4AIHA 4OMAA 4R1HA 4I6ZA 2JA2A 5G09A 1E2XA 1PUFB 1K78A 4RAGA 3Q0WA 1BS0A 4NHJA 5L3CA 1ZLJA 4MQQA 2QBYB 4XLCA 5FT4A 4GE4A 1WKMA 1DQUA 4A6UA 3LFKA 1Z21A 2YX4A 2CRGA 2HI3A 1LW4A 2JUCA 3OWTA 4XM3A 5F1RA 2JJEA 3MN2A 3ABUA 5AIQA 3G73A 4I2OA 1LC7A 4UHTA 5FD6A 1MGTA 1MLZA 4KYOA 4ZYGA 4L0OA 2H8RA 2OA4A 4ESJA 1C0WA 1P4AA 3T8RA 1HLVA 4OCAA 1N75A 2HDWA 3K0LA 4D7MA 2ZSLA 4EJWA 5EJCA 1OR7A 4RAEA 4LLGF 2M4GA 3ZQ7A 1XG1A 4YEJA 2FBHA 2ZC0A 4IXSA 1K6YA 1Y8QB 3QWLA 4M71A 3FIWA 5C44J 3CMEI 1ZGWA 5HS8A 4GDFA 2EV0A 5FLXK 4IF4A 4BE1A 1W0TA 3GBXA 4JEXA 4PK4A 3GZDC 3LL7A 4II3A 3RJPA 5TISC 2AXTC 2F5VA 2K9NA 3A2KA 4E77A 1YJSA 1YIYA 4RGXA 1U5TC 3SYTA 4XNFA 1P3WA 4RKDA 1AMQA 4IRHA 2DJNA 5HLGA 4AM3A 2AY9A 3OKSA 2VPRA 4YRVA 2KISA 2CYYA 5JI6A 3K70D 3BTLA 4F52A 4WXFA 4ZASA 3LA3A 3M5UA 5KVRA 4GYIA 3HMUA 3IP4B 2LVSA 1LNWA 2HVSA 1WYUB 4V2GA 2ZJ2A 3PDXA 1BOAA 3E2YA 1WYVB 4HYEA 1BBYA 4XORA 3FZ6A 2WV1A 3P6KA 2AXLA 1AJRA 1S29A 1VQOI 4M2MA 1FBSA 2A5WA 3L2WA 3M8JA 3GX4X 4HLXA 4KIFA 2EPJA 3C2HA 5JLXA 4D9JA 2XSDC 3S1RJ 2C0RA 3RZDJ 3JRBA 2VIXA 2RQPA 1SMTA 5E8IA 3NYTA 3VP6A 3BG5A 3I4JA 2CQQA 4L5EA 1RUOA 3WX9A 5HLIA 3GZNB 3RKQA 2L0KA 1X2AA 1BJAA 3HTSB 1VQLI 2RVCA 5FFXA 2QEXI 2XB5A 1CL1A 2K5CA 4E70A 4HG2A 5KHDA 3LSPA 3PQJA 3QRFF 3WTYC 1LK9A 3LNQA 2EZHA 2BY2A 3GLXA 3ECDA 4HEA2 1VQ7I 3RI4A 1YQAA 1BJNA 1A35A 2H6BA 1JG8A 2R7QA 5HS9A 2R5EA 4AO9A 3LAPA 2PG4A 2BI1A 3MAUA 2DOUA 4DYRA 1ZTRA 2YCTA 4A72A 3LA7A 5EDNA 1S7EA 3NRVA 1FP1D 1S5LC 2RN7A 3BPXA 5D4SA 1Z6TA 1UU1A 4ZZLA 3KKIA 3R0AA 2K9MA 3IAM2 2EIMH 4WP0A 5L3BA 1JUSA 2W84A 5JVTA 4E1OA 2DT7B 3MCZA 2D7ZA 1X3WB 1AOYA 4N9IA 2NS8A 2WAQN 1U8BA 4L0YB 4Q76A 1P6RA 2W57A 2M3AA 4MFDA 4U7BA 3CO7C 3D6KA 1XDUA 2KZGA 4YELA 1I1SA 4KXKA 3I53A 5J1RA 2L9NA 3OYIA 3HIFA 3S3NA 2HOZA 4IY7A 1DTYA 2ZSHB 3K6GA 1MJAA 2QENA 1W5SA 2JQ7A 3X2QH 5EEAA 3KP4A 1NG6A 2BHYA 1X2NA 3CCSI 1IRFA 3GCMA 3KZYA 3WTUC 1YFHA 4NC7A 4U0WA 4PCQA 3LSTA 1R7JA 1S72I 3DTKA 4WYDA 2AEUA 3PDBA 3QGUA 3C1DA 2OQXA 2VLHA 4RITA 1W7PB 3ISLA 2XAUA 2DCEA 1EH7A 4KICA 4AYBA 4HAMA 1R23A 1YJ9I 2YU9J 4L9VA 3BC8A 3DU4A 2F5FA 2ZSMA 1M0OA 1MMNA 2VQGA 4W8IA 5G2QA 1CF7A 4J5UA 3CF5F 1TLHB 5E3NA 4HV6A 1X1BA 2KFDA 1ARIA 2B9SA 2F5DA 2JK3A 4QWQA 3I71A 4RGUA 2FU4A 1Z0XA 4W5KA 1AJSA 2W7HA 1XGOA 3IC7A 1X29A 2YX7A 2DPDA 3RCOA 3RIRA 4BQOA 1LVKA 1IAXA 4MQRA 2HOEA 3CTAA 3LAJA 4A0HA 2COBA 1I6HJ 3ERED 1IDZA 1H9GA 4U87A 2LKXA 5KAIC 2OQGA 4OMZA 1XSDA 2QYOA 4I0AA 1XMKA 2O8XA 2IA2A 1R1VA 1R4MB 1SAUA 2VGSA 4FT8A 3OYFA 5IT9K 4F5GA 1H1CA 1Z05A 2PN6A 2HP1A 3LV2A 2R7VA 3KLNA 3GWPA 3FZVA 3OOPA 1S6LA 2D1VA 4ADBA 1LPQA 1KGSA 2BKWA 5BJ4A 4D5CA 4ENJA 1BN5A 3ZRQA 3J81K 2HOAA 3VYTB 1C7OA 4K2BA 2ESNA 1VNDA 1F43A 1LDDA 1FOXA 2FN6A 3ERMA 5EQCA 1OHVA 4EVIA 2LLKA 2M8GX 1B6AA 4BA5A 5EAAA 4V2FA 3VWBA 2KHMA 3ASOH 1M1EB 1TWAJ 3IHUA 1GD9A 4BHCA 2Z1ZA 4QPQA 4CH7A 2QGUA 1W36D 4B9BA 3G71I 3UWCA 1XGSA 3JRAA 2VQLA 1PDNC 1BI0A 4LK1F 3W6JB 2DMNA 4IW7A 1A5JA 4RB0A 5LGNA 4GEBA 4E4HA 4PSXA 5DD8A 1X3UA 2O0YA 2Z2SB 1X58A 3RQ1A 1ZG5A 3HOTA 1D5YA 2V7FA 3GFMA 1TPLA 5FGMA 3WODF 2Z9VA 3HKZN 1TZLA 1BJ4A 3GTMJ 2BWPA 3LVMA 5FKLA 4QLCU 4RM2A 5LEJA 1APLC 4LIVA 1HDDC 1UMQA 3O3KA 5CQEA 4UXNA 2EBIA 3A9XA 4AC0A 1CL2A 5JAYA 2A07F 2QQAA 5J40A 1L3LA 4O3MA 1QZZA 4Y52J 5GAGJ 3FXQA 3QPLA 3WTSC 2Q1ZB 2Y75A 1JKOC 2DA1A 1T6SA 4LLNA 3TGNA 2VMSA 4A3FJ 3F6TA 3LSKA 3TO9A 2OKKA 4UHMA 5LEKA 4HX8A 1SC7A 2M0MA 1D2FA 2R0TA 5F0CA 5EG0A 5FKMA 4UUSB 5H6QA 3FFHA 4D7NA 2HPIA 2C7TA 2EH3A 2DKJA 3L1PA 4DYQA 1FC3A 1VI0A 3LMMA 1TC3C 2ISYA 5DJ1A 3ZZKA 4AVZA 1REPC 3BWOA 1IXCA 2Y9YA 1FLIA 1QVTA 1DJUA 2X5DA 4IXZA 3I9V2 3VK4A 2IGNA 2QA3A 2R5YA 3TQXA 2HKXA 1Z6RA 2DA4A 2W8WA 1YIZA 3ZR8X 4Y7NJ 3VAXA 1I43A 4UVCA 2W8VA 2JA5J 2WV0A 3U2RA 3G3ZA 4A0ZA 3O8HA 3OIQA 4XN3A 4IHVA 4G7ZF 4OIQF 4OBUA 1K83J 5C4JJ 1SZKA 4W91A 2ELHA 3ZQIA 3WZFA 2MA3A 2E1NA 2ISZA 7AATA 3KIOA 1G4XA 3AG3H 4Y33A 1SMYF 3AATA 1N8PA 2R7WA 1ELQA 4TV7A 1OCOH 2AATA 2JRTA 3K4CA 2XC7A 1Y39A 1IN4A 1X4OA 3ZMUA 3E9KA 1WI3A 1G3YA 3GZDA 3EUHC 3AAFA 4IZZA 3VPRA 4CZZA 3GTKJ 3B1DA 3E2ZB 1JKRC 5EUEA 4M3GA 4WXCA 3DV8A 5H2FC 4A6EA 4RB1A 4CYCA 1ZREA 1ASMA 4IX8A 3H9GA 1U5TA 3DLLF 1P9QC 2FOWA 3DEUA 4G6DA 3ZGKA 2DPUA 2OAZA 1R1TA 2IGMA 3HYIA 1BI3A 2IVMA 2OF7A 1T56A 4X0GA 2Z9WA 4UUTA 2VMVA 4D5FA 5EGOA 2Z3YA 3FFRA 2CQ7A 1QPMA 4OINF 2LH9A 4IHYA 1Z7DA 1ASBA 1SVOA 3GTJJ 1KMJA 3F6VA 2XH1A 1Y8RB 3QPTA 4Q75A 1VQKI 1WJBA 3JTXA 1TP4A 2L3DA 2DN0A 4KN4X 1QJ3A 3BS8A 2CW7A 2NAZA 4M9XA 3CQ5A 1UB9A 3BP8A 3OY9A 5D95A 3UKGA 4PJLA 1ZELA 1ASCA 1QA6A 1BR1A 2MD0A 3HHHA 1VQPI 2JJFA 1OCRH 3SZPA 5IP7J 1X0MA 3QI6A 3IWFA 4JOMA 5E20A 3U9GA 3CP2A 2JVGA 2Y48A 3PQKA 3I5UA 1GC4A 4JE5A 1HXDA 5A2QZ 1R1UA 2FJ1A 3E2FA 4UQVA 4BA4A 3N75A 4TMRA 3DTIA 4ADEA 1S0AA 3LSHA 3F0HA 4QIWN 4XRSG 2W7DA 3GZCA 1D7RA 2ZKZA 4WXBA 5BNGA 3EZSA 2BYJA 1OR7C 3BG3A 3RUYA 1AY8A 1FIAA 3J7AY 2KDOA 2GSAA 2CB1A 3KYDB 2Q8KA 3EYYA 2XRLA 2K7LA 1Z3ZA 1D1BA 4FFCA 2ZO4A 4LNMA 2WY7Q 3OR2C 3QN6A 2MH9A 4BQ0A 1UFMA 2JZYA 3NNKA 2WB1N 2KRFA 1MDOA 3S8PA 4N4OB 4C30A 4KIGA 3PJ0A 1I6XA 2TCTA 1O7FA 3QQAA 4BACA 5FT8A 5E3KA 1UCRA 2XDVA 4DNCA 1TOEA 2DAOA 2H94A 4MIMA 3RYPA 4J01A 1SEUA 4WXDA 4F5JA 4CZCA 5DM7F 3OYKA 4BE0A 2CANA 4A12A 3DZZA 2O7OA 2NRAC 2PJPA 4UVAA 4CXFA 3BJAA 1OCZH 1W5TA 4NB5A 4O5VA 4E7ZA 1VP4A 3K4KA 5KK1A 5HDNA 4PZJA 1G7WA 2XVCA 3H7FA 3DRDA 4XMYA 3H1CA 2F4IA 3QP6A 1KYZA 1P7JA 4JEZA 2R7SA 1DDNA 2COMA 2D64A 3JTGA 2G6WA 1E3PA 2VMWA 3Q9SA 3V8LA 4GFBA 2MC3A 3FMQA 3L00A 5CQGA 2NVUB 2XB0X 1TARA 4KFCA 1S9HA 4A93J 4DQ6A 1UG0A 5BJ3A 5M5YJ 2VJJA 4CBRA 2EV5A 2HTSA 1V3FA 3T0YA 1SAXA 2VOOA 3CAIA 2NOGA 2XKOA 1PG8A 4LMYA 5ICGA 1BJOA 1XGMA 1S07A 3HHGA 2W1OA 3V7SA 4G6TB 2Z1YA 5D5WB 4A6TA 2IP2A 1G7XA 5C6UA 2G9WA 2K9LA 4WX9A 4JK1X 2HUFA 3H3VK 3GBGA 4XJMA 1K78B 2D66A 3PJRA 2GAUA 2VBYA 2HYGD 4AH3A 2LF7A 2VMZA 1T2KA 1XCVA 2E5NA 4HF1A 5K8BA 4L9TA 4BQAA 3RPUD 2D7YA 1AY4A 3BQYA 4ATQA 4YFNF 4XLAA 2VC1A 1MH3A 1XB4A 3ULQB 1IAYA 1T08B 2JTVA 3IRQA 2CUEA 3MD2A 3N0LA 1MW7A 3V8JA 3JRIA 1RESA 1YS6A 1BC7C 1HKTA 1LS3A 2BXYA 3D0SA 2BE5F 2HQNA 1X1CA 4GDYA 2RNJA 2FBKA 3PIUA 1ZAOA 2Q7WA 3RTRA 2DK5A 3CC2I 1RVYA 1R71A 2HZTA 3FZ8A 2A6TA 2FQ6A 2L7KA 1O3TA 3GTLJ 1OXOA 4Y17A 5KAFC 1CQ6A 3L2RA 4BKXA 2ZSIB 3M7GA 4AWXB 4IHSA 5FKNA 2IS4A 3COGA 1W7PD 3WE2A 1VZ0A 3CP8A 5H20A 2XAHA 2V79A 2IXSA 2JPCA 3EDPA 3ABMH 1GV2A 1LKCA 3KGXA 3FXRA 2DFFA 5HVQC 3BR1A 4U0VA 4PGGA 3NU8A 5FKOA 3WGHA 2E35A 3R60A 4JX5A 3ZCOA 5JFRA 3OYNA 4HRIA 5ERIA 1SPAA 3PSIA 4A3LJ 3DFGA 4WYAA 2PJRA 4OIOF 5FLXZ 1KKPA 1JT6A 1YJYA 2JT1A 2ME0A 2RDPA 3MEXA 2X4HA 1L0OC 1JS6A 3N5MA 2AHQA 5B5EC 2DGKA 3K4BA 3TFTA 1SFKA 2L7FP 2ECBA 1MJ9A 3VK3A 1ZLKA 2VASA 1BA5A 1USTA 3QOEA 1SFOJ 3ELEA 3K7YA 1TWGJ 4BL0B 2D61A 3EIBA 3WTVC 2CU7A 3PNTA 2DT5A 3OS2A 3AEJA 2NXNB 4Q31A 4H51A 2KZVA 3F8NA 4RLGA 2CH0A 3GZ5A 3J7YJ 3EUKL 4I0BA 3ASNH 1WH7A 1WJEA 1B8GA 1MMAA 1BI1A 1JTYA 4KN7X 1WSUA 3LY1A 3S1QJ 1ETYA 4KISA 1KKJA 2WWYA 3PD6A 5DS9A 4HSRA 2EQRA 2W7MA 3FBNB 1OYYA 2K3FA 3FXUA 4WYCA 3P5JA 4W97A 1OCTC 1G3SA 3MZHA 3BR5A 4CCLA 1FY7A 1YS7A 4N4NB 2K3PA 5EEHA 3ZN1A 1FBQA 5B1AH 3ZPLA 3BJOA 1BIAA 1P7IA 4QTRA 2ZXIA 3LFUA 4M6YA 3HOZJ 2OTLI 2M0CA 1EF4A 1MAPA 2C81A 3OYEA 4EU1A 2CH2A 1D1AA 1JHHA 4XLFA 3NX3A 3FVSA 2HU9A 3F8FA 3Q3SA 3HUGB 3GYHX 2FNUA 4ZYDA 4IHXA 4OWRB 1ZQ3P 1FTZA 2DA3A 1VJOA 4G9YA 4DBCA 2AY2A 2KRCA 1SF2A 2OTJI 3A01A 2ECCA 4IJAA 4XAUA 1GXPA 4MEXF 2HOSA 4QGRA 5EF6A 3G1MA 1U9NA 1RR7A 1RETA 3TQNA 2VMYA 4LG3A 2OC6A 3SJMA 5GTHC 2W48A 1G2HA 4WYEA 4WXHA 3K9TA 2A68F 3GUDA 4KUMA 5J8FA 4F5MA 5LLQA 1B9NA 1EQBA 4HLYA 3IH4A 3S3OA 1J5YA 1MZBA 3CQZJ 2K86A 1YITI 4V19K 3J80K 2KP6A 2YKYA 1DU6A 3V42A 3VEPA 3PSFA 3BG7A 3IHJA 2VXDA 1FX7A 4ZM3A 2JJ7A 3OYAA 2NVTJ 3RPQA 2H6CA 4KMUX 3DXVA 4HF8A 1G8XA 3TP0A 4DJAA 2L01A 2JUGA 4NQWB 5AIPA 1FSHA 3M07A 1ZOBA 2V4JC 1B4XA 3COAC 1EKEA 2QSGX 3GTPJ 2CJJA 1GHCA 2WAQA 2O6GE 2W8JA 3GLLA 5ILSA 3WHCA 3F9KA 5AX8A 1JT0A 4ON0A 1QPIA 2VI8A 1EJIA 1M6SA 1CF7B 4Y3OA 2JGTA 1AHEA 2E60A 3W1HA 4A0GA 2XGCA 3HM5A 1WZ2A 2KT0A 3R4TA 1PP8F 4OT8A 3ZRRA 4FX0A 4CA0A 4ZZDA 2DOEA 2P6SA 2FD5A 4A3GJ 4LNJA 1QZ9A 2NVYJ 1RI7A 2IS2A 4RLQA 2ACJA 5DCMA 4CCOA 5DYMA 3U1KA 3JTHA 1DPUA 4LITA 2W7NA 2CJHA 3E5XA 5D6FA 2VMRA 2CQKA 3QU6A 2GLOA 3BT9A 3TDZC 4IYOB 3KP5A 4EJOA 4Q47A 2HFHA 1FNNA 1JGSA 4DGWB 4XLHA 5CVRA 3QAHA 1MDMB 3HSEA 5CYVA 1E3HA 2AQFA 4XR6A 2ZXJA 3Q0VA 2DMUA 1ASDA 4D1QA 4XOTA 2EFQA 2FE3A 2VJ5A 1AAWA 4ZDLA 2FQ3A 5F08A 2ZJRF 1MJBA 4XKBA 1W1WE 5M49A 4LW2A 2WBMA 5BMZA 1Y1WJ 2KKOA 2EFOA 2QWWA 2HOYA 4FL0A 1V5EA 2QA4I 3GO5A 1SD7A 5CVJA 1ARHA 2R7RA 5DJ9A 3LVJA 4XRMA 1CZCA 4K2IA 4WCGA 1FC4A 3B8XA 1J59A 4HX7A 2E2JJ 1ECXA 5IWQA 5IT9Z 3KFWX 2OCCH 4G8XA 2X6WA 2Z9UA 5G4JA 1TNSA 2EWNA 3VOEA 3CQ4A 2DQLA 4NBQA 2Q2EA 2BBYA 4GSAA 3DBLB 1B9IA 2V6EA 1JF9A 3J81Z 3JRGA 1H0MA 3GJUA 1VQ9I 5L3GA 1K6OA 2OZUA 3RI6A 2Q0OA 2L9RA 4M6XA 3TW7A 5EYRA 3MKLA 3PGYA 9ANTA 2RV8A 3LA2A 3E0JB 3EI6A 1BW0A 4S05A 3CJQB 4E3QA 1MMDA 2KLOA 2ZMEA 2XAQA 2IT0A 1QGPA 3H36A 1KL1A 2E7XA 1HQCA 2CUFA 2FUG2 4E7LA 1Z9CA 3AL0B 4NUBA 3FKDA 5EUDA 1Y6IA 2DDAA 2M87A 3QOPA 1BW6A 5JLWA 2R5CA 3LSGA 3TOAA 2E1CA 1FG7A 4WB0A 1HSTA 4RA2A 4OAYA 1AWCA 2WK7A 2MYSA 3KP3A 2DQRA 1Z7UA 1G4DA 5IYDJ 3S15J 1W23A 3B46A 3UAKA 2GIVA 3GETA 4EM2A 1MNMC 5L3DA 3MKWB 3FM3A 3HBXA 3E1SA 4BMKA 2F5EA 3K69A 5D8LB 3DU5A 4F5HA 2FF4A 1LEAA 3PUFA 3AG4H 3BR6A 3HKZA 3T5XA 4EQQA 4F91B 2ZNZA 4U7DA 3S14J 1AY5A 5EIGA 4A3DJ 3OIPA 2DA2A 4EATA 1BIBA 2YUSA 3GTGJ 2RFVA 2V1UA 1N78A 1O3SA 2O5RA 3D5RC 3W1IA 1O69A 1SZUA 2VJ4A 5L3FA 4ASNA 1G59A 3GEZA 3ZQGA 3KYLA 3GMEA 4RLFA 3LG0A 2CV2A 1QQIA 1KZHA 3NUIA 1EJ9A 4RM1A 1FYLA 2ZC2A 2VGZA 2AS5F 4CXQA 3L2QA 1FSEA 4KT6A 3BTIA 4Y4RA 3VDXA 2GWRA 3L2CA 4LIUA 2BW3A 5JHFA 4E7KA 5ILVA 4IRIA 1T38A 4F7ZA 5J4VA 3CC4I 3NRAA 2X48A 4DGTA 2XAFA 4HSTA 2VE8A 3CMMA 2L54A 5IP6A 2Y9ZA 1ASAA 1GEWA 5D5SA 1WRJA 4O6JA 4R2NA 2YS9A 5CJ9A 4BU2A 3WY7A 2GB3A 2BV6A 3CDLA 5F27A 1UZCA 1V2DA 3CMYA 2QBTA 5K5OA 1AHFA 1QZEA 2W00A 4F93B 1X4PA 1LJ9A 2ICWG 3I59A 1I5ZA 1G4VA 1HKSA 1Y1VJ 2W7FA 3FK6A 5K7HA 4RGSA 4XRFA 1BW5A 1ZG3A 2LY2A 2DTRA 3P1TA 1MMGA 5FT6A 1AMSA 4L5IA 4B43A 4CYCB 3C3WA 1YJZA 5D5UB 1RVUA 1U5TB 3ATHA 4UHNA 4LJZF 2UUZA 4P96A 2HDCA 1S7AA 4HV5A 3GFJA 1JTXA 4JBAA 2BOLA 1F4KA 2CTZA 4HNUA 1LVAA 2HR3A 4IQJA 5EGOB 1AKHA 3JCUC 3KZIC 4BJTA 4FASD 1IN8A 1KQ0A 3G6EI 3W2WA 3JRHA 3TL4X 1IN6A 2A61A 4HPQA 3BN1A 2B7EA 2BYVE 2Z33A 1TT0A 1OFCX 2QCOA 4RMNA 1I27A 4HOBA 2LF8A 4OC9A 4M3EA 1S06A 5HS7A 2NOJB 3FX3A 5LBQA 2HEOA 4GRIA 3ZQFA 2VLAA 4LB5A 2DA7A 2W25A 3SEZA 4P55A 8AATA 3MAFA 1JUPA 4YG2F 2JA7J 2VIBA 2X3LA 5G0AA 1OKRA 5E79C 1BT4A 4F5FA 3QPHA 4ABZA 1ELUA 1XTAA 2Y31A 2ZFWA 3C2GA 2HXOA 5HOOA 3JRFA 2RGVA 3JWAA 4M73A 1JJ6C 1KL2A 3G0TA 5FROA 2EZLA 2FOKA 2XGEA 1V72A 1BJZA 5C4XJ 3BJ6A 4PSWA 3H0GJ 4MFEA 4GYGA 5EZGA 1X1PA 4R8HA 1HOMA 4P3MA 4M9ZA 4AZKA 5ILUA 2VONA 1QU3A 3WU2C 3OS0A 4W1UA 2R7ZJ 1PUFA 1M0PA 4MSOA 1A6IA 2IA1A 4PFNA 1LFPA 5B1BH 1W3UA 3DR4A 4JP0A 5AONA 5GP9A 1O7LA 2K85A 3G2BA 2QBYA 1ZODA 1YTYA 1LC5A 2RKHA 2HZPA 2VMQA 4F55A 3A2BA 5GPAA 2VKEA 3TOBA 3WG9A 3JRCA 3I4NJ 1OQYA 2VL8A 4B44A 4YIIA 3D1NI 2OZ6A 1IUYA 1Z67A 5L3EA 4M3FA 4Q48A 2YU3A 4A3KJ 2YRRA 3ZZJA 3K4MA 3RQ4A 3Q8NA 4AVPA 5DDGA 1HW1A 1GVJA 3H0DA 3HGYA 4K2EA 2Z5UA 5M3FJ 4ZLVA 1WQ2A 1GT0C 4WWCA 1YE9A 1XC5A 4UVBA 4K2MA 4OMYA 4JEWA 3HVYA 1VQ6I 5HLHA 1FOKA 1YW8A 2IBDA 2YCNA 1RRJA 2CGPA 2C6YA 1YIJI 3VSLA 3KPHA 3HOSA 2N8GA 3WCOA 3AEMA 3L44A 3ZMSA 1YJNI 4UNOA 1GDEA 5J8QA 3B1EA 1Q1VA 1Q1HA 2WB1A 2I10A 3B6CA 4YIRX 1QGNA 1FJLA 5FRNA 1N77A 3ZMZA 3UE8A 4GCVA 5M4BA 3AEJC 3A8UX 1JHFA 3OYBA 3OYLA 1AKCA 2Z16A 2O0RA 1WJCA 3ACZA 1QVUA 5FO5A 3SQNA 5IP9J 2GOXB 3MADA 1UHMA 2DMQA 4BJ5C 1MLYA 1WYUA 2R4GA 2PLYA 2BWNA 3K70C 3G8MA 4ZM4A 1T95A 3CF2A 3ONQA 1UU2A 4U2HA 2NS0A 4L5JA 1O3QA 1H89C 3RCHA 3ZN0A 1ZH5A 2O03A 3C7JA 3MAJA 3OYGA 4A00A 1D8JA 1XI9A 1BJOB 3DQVC 5IOZA 4BS9A 1FWZA 3FKIJ 3CD6I 1S08A 5EZHA 5F1JA 4IRGA 4RM3A 5LHIA 2YRIA 2HQRA 2PMZN 4KJZA 3A1YA 2IRFG 2DI3A 4XSXF 2BYLA 1A36A 4N0WA 1ON2A 4Q4ZF 3I55I 2CUJA 2QUFA 3BV0A 1MH4A 1WYTB 3FWEA 4I98B 3T32A 1IV6A 4LW4A 2EJRA 4RAZA 1KU9A 2VLFA 2LMDA 2MD5A 3IRRA 3VB2A 3TEDA 2HWVA 5DM6F 1XPXA 2OUMA 1B8IB 2V0YA 2LBFA 4CXRA 3LSRA 4RIZA 5K5RA 3T1BA 4GRXA 3SEQA 3B73A 4ETSA 3HRSA 1YIOA 2VOPA 1YOOA 3A9YA 1HKQA 2QM3A 3L7WA 3OSFA 1XSXA 2A69F 1JKQC 3CCRI 3IH2A 3GFIA 5BPDA 1OISA 2KQRA 2QLZA 3FXKA 3MKZA 2K02A 1J9IA 3IKVA 2L2OA 2EZIA 3FXJA 1GC3A 3WKRA 3OOUA 2D63A 1ORDA 1FOYA 1DP7P 3DPLC 1VQ8I 4CHUA 2JSPA 1X19A 4U1TA 4FE7A 4HBLA 1YAAA 1V55H 2GXAA 3CLQA 3H3ZA 4BXUA 2M45A 5E1ZB 3RPUA 5FLVA 4A0RA 2GA1A 1B72B 2EO5A 2LOOA 5DUKA 4OBVA 2B63J 1BQDA 3GTQJ 4KDPA 3HPHA 2DYRH 1JE8A 2LSOA 4DYCA 2OGEA 1LC8A 4XJOA 2CSTA 4IQ4A 2RREA 1UJ8A 4I7HA 1MAQA 1ASGA 5FFZA 1TTYA 3NARA 4HQEA 4FETA 1IO2A 3DR7A 4M2JA 2QVOA 3NDNA 1Z3XA 2CWEA 5IOYA 4Q5SF 2CV0A 3MZ8A 2PJRB 4L0ZB 5EUNA 1ETQA 4BJ6C 4C2MJ 5HODA 1LE8B 1LB2A 4YFKF 2DO7A 3CUOA 5E3MA 2H1LA 4BDYA 3DKYA 4EMYA 5DB5A 2FA5A 1ZG1A 3S3MA 1I50J 1W7PA 1YI2I 4O6ZA 4CO8A 3LQRA 3BCBA 2AQEA 3EI9A 4ZJZA 4ANJA 2OQRA 2JJHA 4CYDA 3M1CA 4EJUA 3U21A 4L18B 2FSWA 1R5HA 2EIJH 5TGTA 4B4CA 2CINA 4WYFA 3AOWA 2Z9OA 2X1DA 4A0FA 5J8CA 1WI9A 2L5QA 1XMXA 3PD6B 1ONVA 1P2FA 1AMRA 3DEEA 3OS1A 1A31A 1RV3A 2CFXA 1J04A 1T98A 4HNTA 3P9CA 2H1KA 4BUPA 2D45A 1AA7A 2ZXHA 1BL0A 2MSYA 3EYIA 1P4XA 4P9UA 1IW7F 2QQ8A 3N4MA 3J7ZI 3F8CA 3ZOBA 2MLKA 2KJCA 5H6RA 2BVLA 2VMOA 3AEOA 4GO1A 4HVKA 1K4TA 1M0QA 2CW0F 2MC4A 1IN5A 1YW9A 2M2EA 5F0FA 1SFEA 2EA2A 4M74A 1U8RA 2F48A 2STTA 2R7TA 5JVGF 5F64A 3A0BC 4IEJA 5D4RA 2HXIA 4IKFA 1B4AA 1IX8A 3CCEI 2I5UA 1DUXC 1IF1A 2A5YB 2VJIA 3OYHA 5BPIA 1SZSA 4KAMA 1TATA 4IL6C 5DUIA 5C3EJ 4WLHA 1RKWA 3TMOA 4I99C 3I64A 5BQTA 3MKJA 3RBLA 2Z9XA 2CG4A 1F36A 1W0UA 1TL8A 1AAMA 4ESBA 2X51A 2ZMEC 2E1MC 1J0RA 3SZGA 2WKAA 3FQ8A 3HRMA 2XAJA 5CLSA 1C4KA 1DKAA 1R5GA 3K28A 2ZP7A 3QP5A 3WG7H 4XN0A 4M3BA 1W36C 5IT3A 1U2WA 1WPKA 2MGQA 3B02A 1BR4A 2W24A 1AIAA 2E7WA 3CCQI 1GEXA 1PFFA 3FZ7A 4II2A 2R93J 5E1XA 2WK8A 4MQPA 5F0HA 2XPWA 1BI2A 2EZKA 4HF0A 2PX9A 4MHGA 3MMYB 1K4SA 2W4SA 2ELKA 3CUQC 3IV5A 1M7YA 4ZTFA 1T3IA 1XN7A 2XAGA 3J80Z 1MKMA 2P7VB 4KITB 3FBIB 1C7NA 2W8UA 2DFIA 2W82A 2PBIA 2X0LA 3K1NA 4JX6A 1VQ5I 2AY5A 5DCMB 3FISA 1R58A 3WKSA 4FX4A 1CQ8A 1XX5A 2LDUA 1RPWA 3MC6A 1AKBA 1TQPA 4M72A 2R5ZA 1IDYA 3F3XA 1I48A 4ISYA 1J7KA 3H14A 3E7LA 1YW7A 1DU0A 1E5EA 2HUUA 4XBFA 2LNBA 1MSEC 3LSIA 1O3RA 3ZMVA 2JA8J 5LGUA 3ECHA 4OIPF 3F23A 3L09A 2HOTA 1WCMJ 2IGKA 4UUSA 4A3EJ 1IJWC 5D6EA 2AY8A 2I8DA 2G7HA 2CSOA 2TDXA 2V9KA 5CKTA 2DMPA 4BQQA 3MQ0A 3OR1C 5ICEA 2VMTA 2R7OA 3HQTA 3CESA 1N2TA 4AO4A 4LFUA 3G7QA 4JEYA 3JAMK 4NC6A 1M4NA 4YIFA 1KA8A 2P7CB 4LGWA 2GA2A 1HW2A 4C2UA 1KU3A 2CJGA 1G6NA 3N05A 5CVUA 2AO9A 3WE3A 3RBFA 1D3YA 2XROA 4AIJA 1O61A 3KX2A 2OCEA 3IH3A 4P9FA 3S32A 1IJIA 5FJ8J 1F5TA 3PL8A 2LY1A 4IOCF 3HOVJ 3S1MJ 2CS3A 2IS6A 4WLJA 1U78A 2OV7A 2D2WA 3II0A 2K40A 3REOA 5FB2A 4MGRA 3M3YJ 1NK2P 1Z77A 2ID3A 2VBWA 1ZRCA 4XLNF 3FMRA 3V7CA 2IS1A 3RYRA 3M4OJ 3ASBA 2Q2EB 3ABLH 4DOZA 2RNGA 2D5VA 3E3VA 5J6XA 5F8VA 3AG1H 1KQ8A 1D7VA 4ZYEA 1RNLA 1Y0UA 4XRSA 3MZYA 1JI8A 2GQNA 1O62A 1IX7A 5FD5A 1S09A 3AOVA 1G3TA 4PDKA 2E2IJ 3H3UA 2E7UA 2X8UA 1QZYA 2W8TA 1B5OA 1AHDP 4G12A 2E19A 1E0EA 1E17A 1YOVB 1W5CC 4IHTA 4B48A 3CCYA 5TRDA 4E7SA 5LHGA 5IY5H 3L8AA 3BWNC 5D8KB 3TP3A 6PAXA 2X1EA 4RJYA 3PFIA 3PFYA 2VIAA 1R36A 2IA0A 4AU7A 2JN6A 1NG7A 2HPMA 2JSCA 4JE5D 2PB2A 1WJDA 2R7XA 3AELA 1KU2A 1HCRA 3H5RA 2VC0A 3CJNA 4CDGA 2M34A 1JKPC 3CCVI 1RZ4A 3OL3A 2DOAA 4DZJA 3SDBA 2G7UA 1AU7A 1ERDA 2E5ZA 5DEQA 4BNCA 1D0YA 2FNIA 3NEUA 5IPAA 4B47A 5EIGB 2CW8A 1ETWA 1OPCA 2MABA 2QQ9A 1MDXA 4XICA 2LG4A 2AY4A 3EZ1A 1SFFA 1HC8A 2P0WA 2DR1A 4C3IJ 3Q0UA 2W85A 3DBHB 4A6DA 2BI2A 2IW5A 2VQCA 3JWBA 2F2EA 2EIKH 2AEVA 4RJ0A 1X2MA 4RAFA 4AUXA 1SFXA 1YO5C 2STWA 1J32A 4LNLA 5E3OA 3L2VA 4ZYAA 1AHGA 3BWGA 3S17J 1VEFA 2MW8A 2BW3B 3H5AA 4BY7J 2VN2A 2WAEA 2X6YA 3A4CA 1FG3A 3BQZA 3ZXSA 4DBRA 5M5WJ 1T8IA 3S2DJ 3CQ6A 3ELPA 4G7HF 2AY7A 2VQHA 2LFBA 1IRXA 3OP7A 3ROUA 1X1DA 4ENMA 1HA8A 1R9TJ 1MBGA 1ZR4A 1QBJA 3FXMA 2X6OA 3WGIA 1Z1DA 2DDBA 4QSHA 3I59B 3VYUB 3AEMC 4F5LA 4ZWVA 1E3OC 3NTJA 3SFIA 4MKKA 3HSFA 5J47A 4H4KC 1R5ID 3OV8A 1YJWI 5E5IA 1FMWA 2CO5A 2W7KA 5K1YA 1FBUA 1NK3P 4P7YA 3DBRB 3C18A 3E77A 4G7OF 3K10A 3PDBB 2R7DA 3S2WA 4YFXF 2QSFX 2V26A 3GSBA 4OIRF 2M7AA 3JRDA 3WHBA 1GUUA 2QF7A 3HEFA 1UELB 1ZGAA 1BC8C 3BTCA 3LSMA 1ASLA 2VGUA 4CICA 1ZRDA 1IZ1A 1AKHB 3DPUA 3CMAI 4F5KA 3NWSA 1U08A 3CLOA 3HL2A 4JQFA 3ESWB 4RB2C 2V6CA 3RQIA 2DBBA 2QZ8A 2ZXWH 3RKWA 1AJSB 2YHKA 4X1EA 4BGDA 3W6KB 2E7IA 2LREA 5HHYA 3DF8A 3FRKA 3JR9A 1QO0D 1TQIA 4J00A 3BY6A 1J75A 4RGRA 1MIJA 1ZARA 3MAFB 1BOBA 2ZCWA 1I29A 1V4RA 3DLAA 4LOCA 1DGEA 1POGA 1TWCJ 2JRMA 4GGGA 4Y0HA 3NAUA 2X9DA 4E6KG 4FCYA 4EFFA 3HC7A 1CGPA 1M32A 1H9TA 4XJPA 1GV5A 5GTIC 3F0CA 3PPLA 1BJWA 2ZNYA 2DW4A 5E1WA 4EV0A 1YRNA 1ARTA 4HQMA 1YG2A 2XSJC 2A6EF 3MWMA 4B98A 3G4SI 1I3AA 4RKCA 4B1RA 2VMUA 1IUFA 4ENKA 1O4XA 5FLMJ 5D5XB 1IGNA 1UAAA 1WHUA 4A0YA 3VSKA 4A3CJ 4PVFA 4XIDA 2OGAA 2HVQA 4WXGA 2XGXA 4F3QA 3O6BB 1U3EM 3UR3C 4M9SA 2NS7A 3LQQA 1TWFJ 2P5LC 1WKHA 5FKKA 4N0BA 2LRDA 2FEZA 2MFZA 3H35A 1XEYA 3FQAA 1RR8C 1W7MA 2BHXA 3E6GA 3OSGA 2E36A 3BZKA 4BDZA 2UXXA 2QQBA 4EMSA 1R49A 1BM9A 2HNHA 1MD0A 1WGXA 2HP2A 2JISA 1AX4A 2HGCA 1QHHD 4BQNA 2BY3A 1LFUP 1OYIA 3TO7A 5E3LA 4EM1A 1QJ5A 4JEVA 1D8KA 2TPLA 1OATA 3EUCA 3VYRB 1EH6A 2Y0SN 2HYJA 4L9JA 1ETKA 4D0PA 3RDIA 4DIQA 2AY3A 1EH8A 1OMIA 1MBKA 2V9PA 4ZSWA 3QU3A 2JWTA 3FK7A 1IAWA 2FYFA 1J09A 2VPLA 1STZA 5IYBJ 1LEBA 3F72A 5FT5A 2G0EA 4I76A 2QSHX 1WH5A 4WYGA 4EGZA 1X3ZB 2HYFA 3PAAA 3EI7A 1W4MA 1XMAA 1MMSA 3JU7A 1TQMA 3QHXA 2XIGA 3F8BA 3RCHB 2X6XA 2WTEA 3ZQLA 5DX5A 1XGNA 4PFPA 1MBJA 1H8AC 2W7GA 5EG0B 2ZBKA 4UB6C 3CUQA 2YCPA 3EQLF 1USSA 5DD4A 1O57A 3FD0A 2KIFA 2OATA 4DW6A 2V1XA 3B1CA 3E97A 4IVNA 3HRUA 4HDUA 4EJTA 1ARSA 3JW4A 2NVQJ 1UU0A 3BDDA 1FOWA 2MBFA 4A5MA 2IGOA 1FYMA 1YLFA 2B0LA 3KYCB 1FIPA 2R5YB 1HF0A 4C9YA 3CDIA 2Z67A 4ITGA 3KEYA 4OU0A 1E5FA 2OKJA 2NNNA 3I58A 2XKPA 3BROA 4BE2A 5E4ZA 1SFUA 1AHXA 4CCMA 3USFA 2LKSA 5BOXA 5B3SH 3DPTA 4HA8A 2LBFB 1DP3A 1MSFC 4JF0A 1HDPA 2VGTA 1SVMA 3E5QA 1BR2A 2FRHA 1MNDA 2HVRA 1HSJA 1WJAA 3PIOF 2IAIA 4BEHA 3WU1B 2CQXA 1ZC9A 3AKZA 3JREA 1KYWA 3F8MA 3Q5FA 4RDUA 1B1BA 1N31A 2BIAA 3DTEA 3EPZA 1TASA 3LWSA 2PMZA 1PMOA 2DA5A 4XKCA 2HQ5A 3OYCA 1P92A 3P7NA 4XSZF 2CUZA 4KIBA 2PMHA 5DTDA 4LC3A 3HUGA 3ABKH 4CUGA 4CGZA 4B09A 2VT2A 3GZ6A 2CMPA 1B5PA 4CCNA 4M6VA 2DODA 3HBLA 4ITVA 3CJRB 2L9VA 5EEGA 2R3SA 1VF9A 2VKDA 2HZDA 1ENHA 2WAFA 4BXXJ 4HF2A 1LUJB 3K1PA 2GXBA 1D5VA 2LTPA 1ODDA 3H92A 3R4KA 2MH2A 4BH9A 3TDUC 3SFZA 3AENA 4N9HA 3M8FA 3DC1A 5J3LA 2E71A 4C3HJ 2E54A 1OLTA 4MQ9F 2KL4A 2JG2A 1ZRFA 1ULYA 2XF6A 3NQOA 1IUGA 4ADCA 3ELKA 2V1PA 4OTLA 2K9QA 3MVPA 2LD5A 1QHGA 2L9SA 4MO7A 1FP2A 4XOPA 3AFHA 4R79A 1DGRM 1Z7LA 2XGDA 5E18F 2VE9A 4NQWA 1PUEE 4PFOA 3CCJI 4A3BJ 3WTXC 3BWNA 1YYVA 3MC6C 3TBIA 2H27A 3FDBA 3H9JA 3PNYA 2DGLA 3TW6A 4I8AA 4DQ2A 3A03A 4PGHA 2EGYA 3K2AA 4R5ZA 1JXSA 3DU6A 1ASFA 1N25A 1C0NA 3VOMA 1TBXA 4LG0A 1ZKGA 3HTUA 3VFZA 4HNVA 3MFKA 5LD2C 2VT3A 3G1OA 1AKAA 4MQVA 1IRZA 2GQQA 3HDOA 3GXOA 2LYCA 4J8LA 4EM0B 1LQ1A 2E2HJ 9AATA 3SDGA 1XD7A 2NMPA 1V2FA 2DOFA 4E7IA 4ZTJA 1A6QA 3F22A 3TKYA 2CFOA 3FHNA 2XRNA 5GAHJ 3PO3J 3W1JA 5J1UA 4WF2A 2DMTA 4G94A 2NVXJ 2P5KA 1R4NB 4NNJA 1OHYA 2D5YA 2LP0A 3HOWJ 2LK2A 3HLMA 4KNYA 4IYOA 2JA6J 3PUBA 4AZJA 4MY5A 1GBNA 4XK1A 4WD2A 1B9HA 2ORDA 4NC8A 3T8TA 4BXFA 3ASAA 4PJNA 1MDMA 3FXLA 2DT6A 1V5FA 2EILH 4PJ0C 3NYUA 4IXOA 1CQTA 2QLRA 1UHSA 2YKXA 3EETA 3FDYA 3VODA 4MTDA 1QISA 2CV1A 2LKPA 4GE9A 2XHKA 3FHZA 4R5FA 2HS5A 4E7HA 1KQ9A 1IXSB 2GIZA 3A0HC 1D0ZA 2VB6A 2Z1DA 3VYSB 1LFBA 1C7GA 1ETXA 1LW5A 5DCFA 1R22A 2DU9A 1PP7U 5M5XJ 3VK2A 2O9LA 3I56I 1FTTA 4U0YA 1ETOA 2CQNA 3HXLA 5F04A 2J5OA 3G1LA 4C2TA 1EG5A 3CJTB 3JSPA 1BKGA 2OD5A 3A02A 1JGGA 3ISPA 1ASNA 2BI5A 4U88A 3V7RA 4Y15A 3ZMTA 2Y30A 1ASEA 2ZB9A 4ZH4F 1OXPA 2XPUA 2EV6A 3E6CC 4RB3C 4ESFA 2DLLA 2O61A 1XCBA 1PYVA 3P9KA 4DBQA 1U6GA 1IC8A 2EK5A 2ZJQF 2M9HA 4UOYA 1Z3YA 2C44A 1OYWA 3BPVA 2XF5A 1WYVA 2E34A 2HTJA 5E17F 5G4IA 3BOQA 3R6SA 3N97A 3K1MA 3HT4A 1ZYRF 1MBEA 4ZAHA 2V1DA 3FVUA 4FHTA 5EFSA 2W7IA 1DGWY 2BXZA 2GZWA 2PQ8A 4Z6YA 5M3MJ 4EEFG 4KYWA 2BZTA 2OBPA 2EH6A 1K61A 2DGMA 2FMYA 3KE2A 1SVLA 3M9AA 2PFBA 2Z61A 1SANA 2BIEA 2Z20A 2K27A 2M1BA 1H0CA 2R5ZB 1BQAA 4GE7A 2WADA 3PNVA 2FNAA 4P1WA 3A9ZA 3GFLA 3FMSA 1Y4IA 2VGVA 2P81A 4W1WA 1K79A 2P8TA 3HOXJ 1RIOH 3UNGC 1ZGJA 5GAEJ 1C9CA 3U1DA 4AIDA 3LVLB 3TCMA 3P9IA 4LD5A 5KCMA 1I1GA 5LGTA 3KP7A 4ZC3A 2YKUA 1D0XA 2Z99A 3IL2A 4MNUA 4I09A 3PO2J 3KLOA 4XKWA 4MLOA 1CZEA 1HW5A 2W7EA 1P4WA 2VMXA 4Y0IA 1ETVA 1B59A 2DTZA 2V9VA 4NDLA 1NH3A 2QB2A 1TW3A 2JVHA 1IX6A 1VQMI 1YNUA 4XL9A 4JF1A 3HRTA 3EIAA 2ZYJA 1GC0A 1O4SA 2KMUA 4NOGA 2KIUA 1OJLA 1LKXA 1A04A 2M5WA 4G6QA 4XQ2A 2K4JA 4EJVA 3D5LA 3ECOA 5GPCA 4JYKA 3WCNA 2LC2A 3K4NA 4HW0A 4AYBN 3W6VA 2L7MP 4W1XA 3K4LA 4X6AJ 2W7JA 4JX4A 1V5GA 2H09A 1FEXA 1GDTA 4ZDOA 2KRHA 4OOIA 1D1CA 3CBFA 4A5NA 3JAMZ 1M0NA 1W7NA 2EINH 3LOCA 1G3WA 2ZJPF 2ME6A 2VBZA 1WSTA 2F4MB 4MEYF 1V54H 1D7UA 2EFWA 2BGCA 3RKYA 1MDZA 4CVQA 1U0JA 4HX4A 3QPSA 3DWLE 4LK0F 1S7OA 2A6HF 4IXAA 2IPQX 5EAVA 3GWZA 5LRRA 4Y13A 1Z91A 4IO9F 1XS9A 2DJIA 3I0TA 4P5OA 3E5UA 1ZK8A 2K9SA 2Y0MA 2DYSH 2PI0A 2HOXA 1YX5A 5CVVA 5E8GA 1ORKA 2BY1A 2QB3A 2VKVA 4XLEA 4Q6RA 1MBHA 3I5TA 4XLPF 2DFEA 3BR2A 3V4GA 3F21A 1T0FC 2JPBA 3IKTA 5M4DA 4CBSA 2VI9A 3QODA 4FQGA 4S04A 3WTTC 3FSLA 2BHZA 3WU0A 2RC4A 2RAEA 2XPVA 1SD5A 3DYDA 4XEWA 2LR8A 4TN4A 2WC2A 4ZWMA 1VFCA 3B6AA 3DP7A 3IUOA 3O8GA 2O1BA 4BHDA 1V2EA 5KNLA 1IN7A 2BI3A 3J7AO 3JW9A 3MKYB 2M7BA 2PB0A 4H0EA 3WTZA 5F9SA 4M3DA 1QNTA 3HDDA 2P4WA 2R0QC 3FTBA 3EUAA 1ACIA 2IJLA 2QKMB 4LB6B 1IVRA 1W7LA 3M8EA 3V8KA 3TATA 4B8XA 3LWFA 1U9OA 1Y56A 4PJJA 4UB8C 2WK9A 1LDJA 2ZFUA 3BG9A 2V1NA 1HBXG 3CC7I 3A01B 3KZZA 1UKJA 2FM1A 2VMPA 1DGDA 2MG4A 1B9MA 2X85A 1QITA 1CJ0A 4FTHA 1IXRC 3BCXA 3HOUJ 3BB8A 2A05A 2EA4A 2L7ZA 1ARGA 1Y0NA 4KA4A 4WBTA 3HGGA 2KDZA 4AOAA 2ETHA 1I3QJ 3GVAA 5LH9A 3TFUA 2WY8Q 2NYXA 1I39A 1R00A 1H88C 4UV9A 2EB7A 2O7CA 1RC9A 2FX0A 1JUMA 4E7JA 2Y69H 3GTOJ 2YPRA 4RAYA 2EZ1A 4A0XA 3KEQA 3PA9A 2W7LA 3S93A 4OYTA 3M1EA 2GMSA 2CY8A 3WTWC 4A3IJ 1KU7A
chains in the Genus database with same