4TV7A

Crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
460
structure length
431
Chain Sequence
b'TITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAALPDDLKEIHIWISFSHMDTDHFPIKSWFRCEQKAASRSYMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEDTRRTEQDILSHAAGLQLEIFGMSRFRPALIIGFARLKEEDIQEGVQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Role of the aminotransferase domain in Bacillus subtilis GabR, a pyridoxal 5'-phosphate-dependent transcriptional regulator
pubmed doi rcsb
source organism Bacillus subtilis 168
molecule tags Transcription
total genus 132
structure length 431
sequence length 460
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4tv7A01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4tv7A02
1TOIA 2D1VA 1CQ8A 4ZM3A 1FOKA 1ON2A 2KIUA 2FQ3A 3JWBA 1GD9A 1DJEA 4WD2A 4RKDA 4K2MA 2CY8A 2AY4A 1UCRA 1WSUA 3IHJA 5L3EA 4PFNA 2PFBA 1MLYA 1I27A 1Z6TA 2CJGA 5AX8A 1WKHA 5ICEA 5H6RA 2OATA 3W1IA 1YOOA 3MAFB 2G7UA 3HUGA 2E7IA 3RKXA 1WYTB 5HXXA 4HYEA 2O0YA 1IXCA 1WKGA 1A04A 3GBXA 4OMAA 4RLGA 3CLOA 3G3ZA 3F72A 1EH7A 4XRFA 4ZYGA 3MZYA 1CZCA 2FNPA 1Z3ZA 5DB5A 1J75A 4OYTA 1FSEA 1D8JA 3GSBA 2KIFA 1MDMB 4RJ0A 1I41A 2BE5F 3DXJF 2WWYA 2LNBA 1LC8A 9AATA 3FQ8A 2LSOA 2D5YA 1O3QA 1XI9A 1HW1A 1AY8A 3M5UA 1D7UA 1ARIA 3BWNA 1MKMA 5FFZA 3FVSA 1BI3A 1ASAA 4GYGA 4WXDA 3IRQA 2H27A 4H51A 5LH9A 3KP3A 1FBSA 1RVYA 5HDGA 3HVYA 3JTXA 1XB4A 5EUEA 5DDGA 2MA3A 1DGDA 3OOPA 3GFMA 1PDNC 2AY6A 2FOKA 3L9FA 4JEXA 4IXAA 1AMAA 1M0OA 2CJHA 3L2CA 1ZYRF 3QGUA 5E3KA 3FHZA 2QENA 3CJNA 2YKVA 2EV5A 4KYOA 2OZ6A 1Y4IA 2YU3A 2HKXA 1AKBA 1ARTA 1ARGA 2VLHA 4MHGA 3E6MA 1BS0A 8AATA 2EZ2A 2JISA 4Q4ZF 2XAHA 2OAZA 2BBYA 3B1CA 2CH2A 1C0WA 1OXPA 3RKYA 1P2FA 3RDIA 2P5VA 2IVMA 3CO6C 4ZAHA 2DU9A 2VIAA 2XROA 5JHUA 4RAEA 4R1HA 3GXOA 1R22A 2A69F 4F7ZA 1MDXA 4U7BA 3V7SA 1WYUA 2AATA 2VYCA 5LGUA 3I58A 2FMYA 1ZGAA 4XEWA 1DKAA 2A6EF 2FNUA 1U5TA 1J32A 4Q47A 4KN7X 5M4DA 1JHFA 4RIZA 3EI5A 1ZRFA 5DEQA 2HFHA 4A00A 1AHGA 1G7XA 3FVUA 3L8AA 1UHWA 3MCZA 3S2WA 1S3JA 1MAQA 1WYVA 3E2ZB 4ZWMA 3KZZA 2BYJA 3DQVC 3DC1A 5HS9A 3QOPA 1ORDA 1S08A 3B73A 4BAYA 3B8XA 4ON0A 4W91A 2PQ8A 4FHTA 3F23A 1EJIA 1GBNA 2WK7A 2ZCWA 3IKVA 3RCHB 3M8EA 3AEMA 2VOOA 1B9HA 3B1EA 1TPLA 2C44A 3OV8A 1EG5A 1W7NA 1ASLA 3KP7A 3SHFA 1BBYA 1Z6RA 4OTLA 2FBIA 4GXOA 4ENJA 4UVBA 2P6TA 1J9IA 4R2NA 3LVKA 1ON1A 3E6BA 1ECXA 3HIFA 1PUEE 2O03A 2PO3A 4ZDLA 2VT3A 1ZLJA 2XAJA 2NS0A 4F5LA 2JT1A 1FLIA 2FBKA 2XV4S 2CSOA 2CYYA 1N8PA 2W7HA 1SFFA 2ISZA 2QZ8A 4N0WA 1FT9A 5BMZA 3KP2A 3GJUA 3PQJA 3WGHA 2KJCA 3BP8A 1JF9A 2BHXA 3E2ZA 4RB1A 3SZTA 4MSOA 3A9XA 2P6SA 2JZYA 3U2RA 4WF2A 3DPTA 1JGSA 1S29A 5D8KB 1FX7A 2VT2A 4LGWA 2OKJA 2Q7WA 5TRDA 2X3LA 1F9NA 1XCBA 4HV6A 3F8MA 3E97A 1KGSA 2K7LA 2F5FA 2ACJA 5J6XA 1D2FA 4IHSA 2PG4A 3KGWA 3FXQA 3GETA 2W7EA 4GDYA 4TN4A 5E4ZA 3QPGA 1SF2A 2V1DA 1SFEA 4EMSA 4Y13A 4IYOB 1GEWA 1AOYA 1OYWA 2Z1ZA 3I59A 4R5FA 4KICA 1AHEA 4BHBA 3EYYA 3ULQB 3IWFA 1FPQA 1XGOA 2HZTA 2HGCA 5FT4A 4KUMA 5E1ZB 4Q5SF 2VI9A 2FE3A 2W85A 4M9ZA 1YJYA 3WGCA 3CTAA 1N2TA 1SFXA 3MBBA 4EJWA 2BIAA 2KRFA 3RPUA 2XAFA 2OD5A 3Q9SA 1WWXA 1QQIA 5D5SA 2D7YA 4A12A 1R1UA 1U8RA 3CQ5A 1P4XA 2EK5A 4UV9A 1ZLKA 4MQRA 1HW5A 3KEOA 2BYVE 4GE9A 5HS7A 3UAKA 4KMUX 5BPIA 4A0HA 3E3VA 1O3RA 3FZ7A 2OQRA 3KP4A 3W1JA 4I98B 2XIGA 3I64A 1YO5C 1BQAA 2DFIA 5CVVA 2DKBA 2BI3A 2OQXA 3JAMZ 1B1BA 4E70A 1H0MA 4BNCA 4G7HF 3BN1A 1DPRA 5K1YA 5G2QA 2VE8A 2HYGD 2DPUA 1X29A 4ADBA 4ENMA 3QI6A 3CDHA 1RIOH 5ERIA 1M32A 1T3IA 1AHYA 4B98A 2AY7A 2HWVA 4IXOA 2BIGA 5ICCA 1L3LA 3V7RA 1KA8A 5IT9K 2VC0A 1FC4A 3RTRA 1X28A 3IL2A 1KKPA 3K7YA 3USFA 2AY3A 2QLRA 2D61A 1FBQA 2W84A 3FX3A 3E9KA 1XGMA 2D63A 1WKMA 2ZKZA 3ISLA 3LY1A 4AVPA 1C4KA 1LDDA 3BOQA 2HOYA 1FC3A 1RZ4A 1XN7A 4G9YA 4PFFA 3FMSA 3EIAA 3AENA 4GSAA 1G3TA 1KYZA 1AMRA 2COMA 2EV0A 3NUIA 2R7FA 3ZZJA 1QITA 3BPXA 3PDXA 1BC7C 1ASFA 1D8KA 5F8VA 4Q76A 4L9VA 4FX4A 4UHMA 2QM3A 2NMPA 1H0CA 4KDPA 4A6UA 1K78B 1UU1A 4M6XA 3D0SA 4WWCA 3JU7A 1JG8A 1MDZA 4GO1A 4IXSA 3K1NA 4MKKA 2EO5A 1PMOA 2Q2EA 3WODF 1YW7A 3FMRA 2FU4A 2W7GA 1ZARA 1OATA 2FXAA 5HLGA 3MAJA 2XKOA 5CVIA 3BJ6A 3NU8A 2L02A 1OYYA 4PGGA 2VMTA 3LQRA 4U0YA 5LHGA 2EJRA 4KYWA 2VGVA 2GQNA 4HBLA 1X0MA 1LC7A 1MJAA 1ZRCA 1D7VA 1VEFA 1S7OA 4A6DA 5HVQC 4WK8F 4IRGA 2CINA 2MH9A 2EFWA 5E5IA 2FQ6A 4XLNF 1ASGA 4ISYA 1WSTA 1KMKA 2FEZA 2D66A 1G3YA 4P3MA 3CUQC 2A61A 1ZG1A 1HKQA 1YTYA 3PGYA 1R1VA 4UHOA 1CQ6A 1H1CA 2YSRA 4BHPA 1BJ4A 1YW9A 1K78A 2VGZA 1TOGA 3NU7A 1QNTA 3DR4A 1ASEA 5F9SA 2LF8A 1AICA 3ZMUA 4ZDOA 4LW4A 1Y0UA 3KKIA 3QRFF 5D5XB 4LLLA 4NHJA 4CHUA 1WRJA 3WE3A 4OU0A 4I02A 2FSWA 3I53A 3M9AA 2F8JA 1YIOA 4RJYA 1LEAA 2Y75A 3LAJA 4PDKA 1XMKA 2ZO4A 1CGPA 2HUIA 1IVRA 2VMYA 3HL2A 3REOA 2R5CB 4Q75A 4N9HA 2ZMEA 1LB2A 3R60A 4AZJA 1U2WA 5CJ9A 3ELEA 3E6CC 3SQNA 2UXNA 4XJLA 1XDUA 3UE8A 4WP0A 1QZ9A 1C7NA 7AATA 2XRNA 4UHNA 3DEUA 4CXFA 4OIOF 2IA2A 2ZYJA 3LSTA 1FZPB 2DPDA 2BIEA 1D7RA 3GVAA 2G7HA 5FFXA 5LRSA 4FFCA 4IPAA 4WXHA 1DPUA 1LEBA 2Z9XA 4I0BA 5FO5A 1KYWA 4UUVA 3H14A 1TW2A 3N75A 3B02A 2Z9VA 2YX7A 1XSXA 4G94A 4EM1A 3AV7A 4NQWA 4HLYA 5D8LB 5D5WB 2HQNA 4EFFA 5FLXK 1BI2A 4WYCA 1I43A 1SVVA 3I0TA 4IHTA 4JEWA 4DBCA 3II0A 2ZBKA 1W7PA 2HOZA 3FKDA 4MQQA 1IN7A 2QA3A 3ASAA 2QYOA 4A0RA 2YPRA 1IAYA 4G6DA 3A9ZA 3T1BA 4M2KA 4U0VA 3JSOA 3EI9A 1ZHFA 3RIRA 3RJPA 5A2QK 4ESJA 4L0OA 5ICGA 2GWRA 2YKXA 3C3WA 1R5HA 1I1GA 4LLGF 2VBZA 2FN6A 3PJ0A 1U6GA 1SPAA 3AEJC 2GMSA 1AX4A 4F5JA 3MKJA 3I16A 3F3XA 1OYIA 4WYGA 1XSVA 5G0AA 3F22A 5G4IA 1PMMA 2GAUA 1MJ9A 2CGPA 4O6ZA 3WCOA 3C1DA 4CDGA 2B0LA 1XMAA 4WYEA 1YAAA 5D4SA 5BS6A 5K5OA 3ZMDA 1IJIA 2W8UA 3UWCA 3SXYA 1O61A 3P7NA 1QJ5A 1SD7A 3FQ7A 1J7KA 2PJPA 2O3FA 2QUFA 1K79A 2OZUA 3HOSA 3FRKA 4P7YA 1S8NA 2YOBA 1B8GA 1ZODA 3JZLA 4CBRA 2AY8A 1W4MA 4J8LA 1BIBA 3NRAA 3TOAA 3F6OA 3Q8NA 2FF4A 3CUQA 3TO9A 2STTA 5F1RA 3TGNA 3ERED 4AIKA 1O7FA 1IN8A 3GWPA 5CVJA 1P6RA 2BWNA 3BV0A 3HTUA 4EB7A 4LNJA 4W1WA 1HKSA 3GFJA 2RQPA 1UFMA 5BJ4A 1CQ7A 4R5ZA 2ISYA 1XCVA 1MDOA 3H7FA 4WLJA 2HOXA 2W7LA 1EV7A 1LVAA 1RV3A 2OA4A 4XAUA 3IF2A 4DGTA 1F4KA 1BOAA 1BI0A 1YW8A 3Q5FA 3E6DA 4KA4A 5HOOA 2AY9A 2NRAC 1M7YA 3HRUA 4IX8A 1YQAA 3GFLA 1DJ9A 4MQVA 2GSAA 1FWZA 4XSXF 2V6CA 4ZYEA 1SMYF 3K2ZA 3JTHA 1K6OA 1KQ9A 3N5MA 2VOPA 4ITGA 2YRRA 5HDKA 4ZZLA 2Z9WA 1G6NA 5LHAA 4UVCA 3FXUA 2IA1A 1W23A 1E5EA 2QBTA 2QWWA 4WXCA 1J2XA 3KGXA 3T32A 2D45A 4ZYDA 3M8FA 2TDXA 4EM2A 1JS6A 1UHMA 3KETA 4XJOA 2Y0MA 3HSEA 3RKWA 1FYMA 2CFBA 3GLXA 4KIFA 2DR1A 3B46A 4M2MA 3H3UA 1AJSA 4HV5A 1ONVA 1WYUB 1MZBA 6PAXA 3K1MA 3LWSA 1R7JA 2JRTA 3E77A 4YFKF 2MH2A 5K5QA 3CAIA 3KLOA 3BC8A 3DFGA 3COAC 4BA5A 1U5TB 2ESHA 1QZZA 1CL2A 2H6CA 2JG2A 5CVUA 1KKJA 2HEOA 3WY7A 1WYVB 2R5EA 3JW4A 3ML6A 5J8FA 3GUDA 5D6FA 3KP6A 2BWPA 3WCNA 5H6QA 2VMNA 3EQLF 1ASNA 1OKRA 1BT4A 3IC7A 2F5CA 3VK2A 4PZJA 5ILUA 1TQMA 3FMQA 3WE2A 1ZRDA 4HDUA 2FRHA 1JS3A 4BMKA 1M0PA 3F6VA 3DXVA 4LB5A 3F8FA 4RM1A 1ZC9A 3PD6A 5EEGA 2CW0F 1I1SA 3R0AA 2BGCA 5L3DA 3H92A 2BI9A 1SD4A 3ZN0A 3COGA 5EIGB 4OT8A 2A3SA 2DT5A 2W7IA 2CB1A 4WBTA 2VC1A 5IWQA 5DCFA 1ZG5A 2XGXA 1QPMA 2YR2A 2ZNYA 4G8XA 3BJOA 1E5FA 2D65A 4OINF 5LHHA 5ILSA 4BHCA 3WU1B 4ZWVA 2VMRA 2BI5A 3AATA 1IX8A 2VGUA 4WCGA 4FL0A 4R8DA 2R2NA 2XVCA 5BPDA 3J80Z 2YKUA 3PAAA 4ATPA 3P9KA 3QN6A 4OBVA 4W8IA 3NDNA 1PP7U 3K69A 1KL2A 1C7OA 2RNJA 3EYIA 5AIPA 2C0RA 1SZKA 3K28A 5HDMA 1IBJA 2ZFWA 3F0HA 2L54A 2DGKA 1GC2A 3I4PA 4HVKA 1FP1D 2QBYA 3FFRA 3HRMA 4ITXA 4HF1A 4YG2F 1O69A 1HXDA 4QLCU 2AEVA 2O61A 3GZ6A 1BN5A 2Y48A 5K5RA 1IUGA 1P92A 3I59B 5EIGA 2Z5UA 1QZYA 4I8AA 1N31A 3HLMA 2JPBA 2JJEA 4RS8A 3GW2A 2K4BA 4ESFA 1S0AA 5C6UA 4RKCA 3WKRA 1QBJA 3V8KA 2Z9UA 4PGHA 3EIBA 4JE5A 3SFZA 2IPQX 3QU3A 3CQ4A 4RGSA 4FX0A 1IF1A 4A6RA 1C0NA 4A2UA 3CQ6A 1AY5A 2M45A 2HKOA 4U7DA 1EQBA 3WTSC 1CZEA 3R9AA 2X5FA 4XK1A 4P55A 1BJNA 2QVOA 2VBYA 2BV6A 1DFOA 1Z05A 4L9JA 3DPLC 3HHHA 4KIGA 5KVRA 5L3FA 1OR7A 4EGZA 4A72A 2CSTA 1V2EA 2X4HA 3C7JA 1JE8A 3VAXA 1BQDA 1WQ2A 4ZH4F 3F8NA 3FZ8A 3FXRA 2BWOA 2DBBA 3ZZKA 1YNUA 1CF7A 4P9FA 3LFKA 2V1UA 2NNYA 4CBSA 2HUFA 2CG4A 4MGRA 2VMUA 2DK8A 4BQAA 4OOIA 2ADUA 4EJTA 2W7MA 2KJBA 3EUCA 3DR7A 3JAMK 4XLPF 3MEBA 2WTEA 3RBFA 3K0LA 3VOMA 2DTRA 4B9BA 4N9IA 1AAMA 4OBUA 2AY1A 2RFVA 1VP4A 4LW2A 4CXRA 2ZUKA 3AENB 5J8CA 1YIYA 2ZSMA 2VGTA 1QO0D 3ZMTA 4H0EA 1L0OC 1O3SA 2GA1A 1CJ0A 4I7HA 4XBFA 3CBFA 3TKYA 1H9GA 2L01A 4I0AA 1XGNA 2JGTA 5FT5A 4BA4A 1ZOBA 4M71A 4S05A 3GZDC 2CJDA 1R58A 4RB3C 4IJAA 3KFWX 4WX9A 4L5IA 3O2PE 3V4GA 1D5VA 2AY2A 2HP1A 2ZXJA 5L3GA 1GC4A 1USTA 1F5TA 4TV7A 3ZPLA 1MGVA 1OHYA 3GFIA 1ELUA 2MLKA 2W8VA 1R00A 5E1XA 1IAXA 2HS5A 4M74A 5E18F 3RI4A 1BW0A 3E5XA 4KMFA 4AZKA 2D2WA 2AY5A 1KU2A 1BJOB 3E5QA 2WC2A 4WB0A 1EH6A 2HUUA 1U78A 4MNUA 3WZFA 3KCCA 3DRDA 1UU2A 2RC4A 3QM2A 2EA4A 2A07F 3T5XA 5EUDA 4K2BA 2LF7A 1IRGA 2W8JA 3ECHA 1QISA 3PA9A 4MEXF 5M4BA 3J81Z 4I09A 2GXBA 5G4JA 4EJOA 5KK1A 1AJRA 3ELPA 5DJ1A 3M1EA 2ELHA 4M9XA 4OCAA 3N97A 2GQQA 1P4AA 3KE3A 1TATA 1XEYA 2EZ1A 3MC6C 4E77A 1TTYA 2IA0A 1QGNA 1T98A 3ATHA 4RGXA 4HAMA 5F64A 3ISPA 4EJUA 5DUKA 4KNYA 1GHCA 5JR3A 4U1TA 5HLHA 4JBAA 3OP7A 4JEZA 2W24A 3LA3A 1CS1A 1BJOA 1GXPA 1PFFA 1HQCA 4F4EA 2EV6A 1JXSA 2ZMEB 1TLHB 3ABUA 4QGRA 5HS8A 1B9MA 1D7SA 1J0RA 3TQNA 2P8TA 4I2OA 1TOKA 3HMUA 3A9YA 4JF0A 2CFXA 2CH1A 1G4DA 2CO5A 2CTZA 4UV8A 2DK5A 5LEKA 1OXOA 1FBUA 4LK0F 4EMYA 3NX3A 2VMVA 3EUHA 2DQLA 1HBXG 3DV8A 3G7QA 5EQCA 4ZZDA 3NRVA 2VODA 4LK1F 2PI0A 1BC8C 1B5OA 1TOJA 4IRHA 3RI6A 3BROA 1LDKB 3EZ1A 1IXRC 2ZNZA 3HSRA 3I5UA 1B59A 3WTTC 2WV0A 3GZCA 2R0TA 1V3FA 4U88A 2BEOA 1RNLA 4WYAA 3ZN1A 1TNSA 2W25A 4JQFA 1BJWA 3G8MA 1T0FA 1T6SA 1W7PB 1OPCA 3QBOA 1JHHA 4TMRA 2HDCA 5LLQA 3DKWA 1LDJA 4M73A 4MKJA 3EDPA 4G7OF 3WKSA 2CQKA 4NB5A 1YJZA 3F8BA 1PP8F 3EI6A 4K2IA 1P3WA 2VLFA 4E1OA 3ECDA 2IRFG 1RI7A 3FM3A 1GXQA 1REPC 2RVCA 3WU0A 5LEJA 3HDOA 4XJPA 2XAGA 5D5VB 3QPHA 2HTJA 3TO6A 2P7CB 2Z9OA 2R7DA 2GIVA 5FD5A 2EFQA 1I29A 5M49A 3KZYA 5DJ9A 3WTYC 2D1HA 3GZDA 1QIRA 1CL1A 3C18A 1O4SA 4AD9A 2YKYA 3E2YA 2Z67A 1FG3A 3BWNC 4CGZA 4A5NA 2H6BA 2C7TA 2W7FA 1ASDA 2D64A 5F6FA 1IX7A 3I5TA 3AAFA 3AEPA 1S09A 3E2FA 3WGBA 4EJVA 3VP6A 3MADA 5ILVA 3MAUA 4A0FA 3W6JB 4HA8A 1S06A 1BKGA 3CUQB 5E17F 1W5SA 2VXZA 2F2EA 3AELA 5D5UB 2CWEA 4M2JA 1F1ZA 3FVXA 2AS5F 2E1CA 2PB0A 4O6JA 4YIFA 1BI1A 3D5LA 3BS8A 3JTGA 1B9IA 2DW4A 4L18B 3TFTA 5LRRA 2GXGA 5J8QA 3MC6A 1FNNA 4RGUA 3HRSA 4GGGA 3ECOA 1OMIA 3ZMVA 3NUBA 3ZQ7A 4PIWA 3HHGA 1SAXA 3R0JA 1HW2A 1IN4A 3Q9VA 1W7PD 2ZC0A 3PQKA 4WXFA 4ETSA 3A8UX 3B1DA 5LGNA 2A6HF 2PEXA 1W5TA 2YHKA 4EQQA 1TOEA 2NNNA 2DGLA 4W1XA 2IP2A 1GEXA 5HDNA 3EI7A 5BOXA 3BWGA 1O3TA 2XASA 2Z20A 3WTVC 3U1DA 1T39A 4IXZA 4AH3A 4RAZA 3BZ6A 1ULYA 1RVUA 3VK4A 4HLXA 2RN7A 2P5LC 2FM1A 1H9TA 4P5OA 2L3DA 3LA7A 3BPVA 5D4RA 4ADEA 3DZZA 3VK3A 3O6BB 3P9CA 2K86A 2VI8A 4GRXA 4WYDA 1AJSB 3I71A 1YS7A 4HW0A 3GX4X 2EWNA 4A5MA 4E3RA 5CLSA 3ZMSA 3LV2A 3AEMC 1ODDA 4RB2C 2Z99A 1KU9A 3VOEA 1AHXA 1HSTA 5L3CA 3VB2A 1E2XA 2JJFA 2P7VB 4ZSWA 4LNMA 5FT6A 1D3YA 1ASMA 3DU4A 4Y0HA 4DQ6A 4N0BA 2FBHA 4IVNA 4ZASA 1DDNA 2V9VA 3BDDA 2FYFA 4ZSYA 2MC3A 4DQ2A 4BHDA 3DYDA 4LG0A 5DD8A 1TBXA 2XH1A 4CZZA 5L3BA 4Y0IA 4U2HA 4HF8A 3NYUA 5TF5A 3G73A 1O7LA 1ZAOA 2QQ9A 3F8CA 4IY7A 1KQ0A 2ESNA 3ASBA 4MY5A 5LBQA 3TOBA 2GZWA 1K7AA 2VE9A 3FM5A 1IRFA 2JJGA 3FD0A 4S04A 1S7AA 1IZ1A 4U0WA 3JSPA 1Z7UA 3T8RA 3FWEA 4AOAA 3TQXA 2W57A 3PD6B 5BJ3A 1U08A 1P4WA 2W8TA 1I6XA 5D95A 2YX4A 2V0YA 3OKSA 4JEYA 1M0NA 1S07A 4DNCA 5G2PA 2F5DA 2MD5A 4LFUA 3BCXA 3HSFA 3KLNA 2FA5A 4LJZF 1M6SA 2ETHA 1VTNC 4GEBA 4HQEA 2W7JA 3P6KA 1VJOA 5JAYA 2EPJA 5E8IA 1ELQA 2HYFA 4W1VA 1SD5A 1AMQA 1MLZA 2E1NA 1B4XA 3ZRQA 2QMAA 4BYYA 4Q6RA 3QU6A 2JJHA 3MAFA 4UQVA 1AKAA 5E8GA 1WYTA 2O7CA 3A2BA 4MQ9F 5FD6A 1AIAA 3AEJA 4YFNF 1LJ9A 4XQ2A 3MFKA 2BI2A 3I54A 3I4JA 1RUNA 4KIBA 2WK8A 1SFUA 2C6YA 3FCRA 3KEQA 1B5PA 4IW7A 1G7WA 1MDMA 4GYIA 5IT3A 4HX7A 4B09A 1UU0A 3J80K 1W7MA 1B9NA 3QAHA 4G6QA 1T2KA 1PG8A 2NYXA 2QBYB 4JEVA 3CUOA 2H94A 3P1TA 1ZGJA 2Z33A 1BIAA 2O8XA 1I48A 1YS6A 2K27A 3K9TA 1X3UA 3KE2A 1LQ1A 3RUYA 4ADDA 4YFXF 2YCPA 3W6KB 2QB3A 3RQ1A 5ICFA 3T0YA 3DP7A 4F5IA 1G4XA 2EA2A 1GEYA 2HQRA 1KMJA 4ADCA 4L9NA 3WGIA 1IUYA 2FMLA 1DTYA 3DF8A 2EFNA 2VGWA 3E6GA 3T8TA 4CYDA 2UXXA 1V4RA 1LS3A 4NOGA 1XDSA 2R3SA 1XSDA 3GZ5A 1R1TA 1S6LA 2PN6A 2IJLA 3V8JA 4L9TA 3NYTA 2EFOA 2ZP7A 3FF5A 3BCAA 3G0TA 3F21A 2KKOA 4CO8A 1Q1HA 2OKKA 1YYVA 2JTVA 1IAWA 3NNKA 4P96A 3U9GA 3FDBA 1X2AA 4LMYA 1BM9A 3L7WA 1TQPA 3GF2A 3QPTA 4ZYHA 3TATA 1AKCA 3LG0A 4B8XA 3FTBA 5BQTA 1USSA 1CF7B 2BKWA 3EI8A 1SMTA 2E7JA 2BI1A 3L00A 1IX6A 4A0YA 2VGSA 3PDBB 1I5ZA 3TDZC 4A0XA 1W3UA 3K1PA 4Y15A 4RAYA 2OGEA 4RB0A 2OU2A 4WLHA 3PIUA 1GC3A 2HP2A 2EB7A 1TNTA 2HORA 4F5HA 4ENKA 2VBWA 2FNIA 1GVJA 1FYKA 1XGSA 3MEXA 3F9TA 3DXWA 4G7ZF 2L4MA 3NQOA 2VMWA 2QQBA 2DOUA 2OQGA 4L0YB 2UZKA 4Q48A 3LWFA 2A68F 1V72A 2VMQA 4JK1X 3IKTA 1LW5A 3GO5A 4FT8A 3RCHA 4LB6B 3ZP5A 1ARSA 1O57A 1Z1DA 1OHWA 2GB3A 4ZM4A 2KIMA 2DQRA 4KXKA 3H3ZA 4Y17A 4BH9A 4MTEA 5JFRA 3PDBA 5EFSA 2Q8KA 3KP5A 1LK9A 4AO4A 4OIQF 4JE5D 4OIRF 3GEZA 4BQ0A 3AOWA 2V1PA 2AXLA 2P5KA 2NAZA 2AEUA 1QJ3A 2M30A 3RYRA 1HKTA 4WB0B 3L09A 1FG7A 4Z2YA 1M4NA 2V1XA 3VODA 3ACZA 1ZH5A 1SD6A 3TO7A 5DX5A 4KN4X 4M9SA 3RBLA 3EZSA 2M87A 4IRIA 3BCBA 4OMYA 3V8LA 3AEOA 1GC0A 3RYPA 2RV8A 5E1WA 3QP6A 4UNOA 1YIZA 2PMUA 4EM0B 4CXQA 2STWA 2QLZA 2VMZA 5EUNA 2W7KA 1SZUA 4M6YA 1DJUA 2XHKA 1T38A 1R5GA 2G9WA 2DAOA 4A6TA 2QQAA 5AONA 3GYHX 1YJSA 2K4JA 1E17A 4WXGA 4LD5A 5CVRA 3J81K 1EH8A 1FP2A 3HT4A 2EFPA 4PVFA 3AOVA 4F5MA 2GA2A 2J5OA 2O0RA 5FB2A 3DODA 3E5UA 3WG9A 4IYOA 2DI3A 2V79A 3TCMA 1IN5A 1R36A 4GCVA 2DLLA 4MTDA 1AWCA 3NEUA 4LNLA 2RKHA 4HOBA 1ARHA 2E7WA 2WKAA 1IXSB 5DYMA 2JPCA 1J59A 2UWMA 3WTZA 4F5FA 2ZSLA 4GE7A 2LDUA 4HZFA 3R4TA 3W1HA 4L5JA 5TJJA 2FNAA 2W7DA 3QHXA 1G3WA 3VEPA 1TASA 1MD0A 3IRRA 4EV0A 3EETA 2VMXA 4D0PA 2CANA 1KU3A 4EB5A 3L44A 4HX4A 4F5KA 2VMSA 1NHAA 2WK9A 4AIJA 1AHFA 4R79A 2MLGA 2O1BA 1Z9CA 2VMPA 2LKPA 1KL1A 2C81A 4F5GA 5DD4A 4HDVA 5JI6A 4CICA 5FGMA 5IT9Z 1C7GA 2TPLA 1YLFA 2PMHA 2GMUA 1XD7A 3LVLB 1OHVA 4AWXB 1RV4A 1UKJA 1V2FA 4BXUA 4KFCA 3WLXA 2PBIA 1SZSA 1TARA 4EU1A 2QB2A 3BJAA 3PFIA 2Q0OA 4XSZF 1AIBA 1FY7A 4O3MA 5E20A 1BJAA 2HR3A 5EAVA 4K2EA 2M5WA 3TDUC 3V7CA 3QP5A 4ENNA 4JF1A 1UB9A 4A0ZA 3BB8A 3JWAA 4XJMA 2DGMA 2DO7A 2VONA 3R61A 2XKPA 2E7UA 3ROUA 1ZREA 2J5PA 3GR9A 4GE4A 2H09A 3R6SA 4I01A 2HZPA 1TW3A 2L4AA 2HTSA 4KT5C 1KU7A 3ABTA 2P4WA 5HHYA 1LKCA 2PLYA 4WYFA 1DUXC 2O6GE 4J5UA 3SZPA 2A5YB 1IN6A 4OC9A 4YIIA 1DP7P 5G09A 2Z61A 2M8EA 3LAPA 5JVTA 1ZG3A 4W5KA 5K8BA 1TQIA 2JSCA 4LLNA 4ZDPA 3R4KA 2OBPA 3J7AO 3ZMZA 4OMZA 1KQ8A 3FFHA 4UOYA 3WGGA 4RGRA 4HF2A 1MJBA 2X5DA 2X8UA 2YCNA 4MEYF 4WXBA 5EAAA 3GWZA 2D7ZA 3LQQA 3WTUC 1ASCA 3HTSB 4LC3A 2G6WA 5H20A 1GCKA 1ASBA 4Y0DA 3LVJA 1MAPA 4ZLVA 4HQMA 3D6KA 3HBXA 1AY4A 5DCMB 4P9UA 2YRIA 3MWMA 4UHTA 5FT8A 3JW9A 4A6EA 2RDPA 2M1BA 2XUBA 1J04A 5D6EA 4HF0A 1DGEA 3BY6A 4UVAA 3BWOA 1RUOA 3N4MA 2BYLA 5LGTA 3P9IA 4OIPF 4ESBA 1O62A 3PPLA 2IW5A 3NTJA 5EEHA 1GDEA 4KAMA 2VMOA 3FZ6A 3IWZA 1G3SA 4ASNA 5DV5A 2ZJ2A 5HLIA 3MQ0A 4QWQA 2YCTA 3ZRRA 1HSJA 3HQTA 2OGAA 1LC5A 2R5CA 1IW7F 2X0LA 1M0QA 2XBNA 4AIHA 2W8WA 3LA2A 3HRTA 3O3KA 3FSLA 2ORDA 1Z91A 4E3QA 3WTWC 3HYIA 1YFHA 2IT0A 2PB2A 4IF4A 5DCMA 2RGVA 2VN2A 3MZHA 2Z1YA 1C9CA 2EH6A 1AMSA 3TFUA 1LW4A 5FLXZ 2EGYA 2VBXA 1MGTA 5I92A 4L0ZB 4HX8A 4RITA 3LVMA 3M7GA 2E7XA 2E54A 3IHUA 1J5YA 5DUIA 3HOTA 4EVIA 2XAQA 3N0LA 3VFZA 5M46A 1QGPA 1AAWA 3FQAA 4EGYA 5A2QZ 2ZJGA 5ED4A 3CO7C 3WTXC 3K40A 2K02A 1YG2A 1R23A 4LG0B 1U5TC 4Q31A 5CYVA 4M72A 3F6TA 3NYSA 4MQPA 4AO9A 1W7LA 2DKJA 4CVQA 3ELKA 5AIQA 1STZA 2HOEA 4R8HA 2Z3YA 5LHIA 4UXNA 1FYLA 1B6AA 2VIBA 4ATQA 2MBFA 3ZRPA 1ZN2A 1LNWA 2F5EA 1Z7DA 1U3EM 1G4VA 4A0GA 1V2DA 1B4AA 1FSHA 3WX9A 4O5VA 4PCQA 3FZVA 1WI9A 3RPQA
chains in the Genus database with same CATH superfamily
1TOIA 2D1VA 1CQ8A 4ZM3A 5K7FA 1RR8C 5JVGF 2V7FA 1FOKA 1ON2A 3ZQCA 2F48A 2KIUA 2FQ3A 3JWBA 1GD9A 2EQRA 1DJEA 4WD2A 4RKDA 4K2MA 2CY8A 2AY4A 1OISA 1UCRA 1WSUA 3IHJA 5L3EA 4PFNA 1ZQ3P 2PFBA 1MLYA 1I27A 1Z6TA 2CJGA 5AX8A 1WKHA 5ICEA 3VYSB 5H6RA 2OATA 2CQ7A 2LYCA 3W1IA 1YOOA 4B48A 3MAFB 4XOPA 3GTKJ 2G7UA 3HUGA 2E7IA 3RKXA 2E1MB 1WYTB 5HXXA 1MMGA 2O0YA 4HYEA 1IXCA 1R49A 1WKGA 1A04A 3G2BA 3GBXA 4OMAA 4RLGA 3CLOA 3G3ZA 2F6CA 3F72A 1EH7A 4XRFA 4D1QA 4ZYGA 2LBFA 3K4NA 3MZYA 4OWRB 3TP0A 2FNPA 5E3NA 1CZCA 1J75A 1Z3ZA 2K5CA 5DB5A 4OYTA 3S32A 4BY1J 1FSEA 1D8JA 3GSBA 2KIFA 1MDMB 4RJ0A 1R4MB 1LE8A 1I41A 3DLLF 2BE5F 3DXJF 2WWYA 2KRHA 4M3FA 1D1CA 3MKZA 1VF9A 4AU7A 3CCLI 1Z21A 2EIMH 2LNBA 1LC8A 9AATA 3FQ8A 2LSOA 2D5YA 1O3QA 3S15J 1XI9A 3BR6A 1I39A 3CMEI 1Y56A 1HW1A 4P1WA 1AY8A 3M5UA 3GTLJ 1D7UA 1ARIA 3BWNA 2VQGA 1MKMA 5FFZA 1UAAA 1VQ9I 1IV8A 3FVSA 1BI3A 1ASAA 3K10A 4GYGA 1AA7A 3LMMA 4HSRA 4WXDA 3IRQA 2H27A 4H51A 3M8JA 1MBFA 1Y6IA 5LH9A 3KP3A 1FBSA 1RVYA 5HDGA 3HVYA 2IS2A 3JTXA 1XB4A 3SDGA 5EUEA 3TL4X 5DDGA 2MA3A 5KNLA 1DGDA 4BU2A 2X1DA 3GFMA 3OOPA 4ZYAA 1PDNC 2AY6A 2FOKA 3L9FA 3BLYA 2R5ZB 4IXAA 4JEXA 1AMAA 1M0OA 2CJHA 3L2CA 1ZYRF 3QGUA 4L5EA 4RMNA 3FHZA 3HG9A 3QOEA 2QENA 3CJNA 2YKVA 5E3KA 2EV5A 4E7IA 3H1CA 4KYOA 3GTQJ 2OZ6A 3LSIA 3ZCOA 5F1JA 1Y4IA 3HGYA 2YU3A 4FISA 3A0HC 3KX2A 2HKXA 3QYEA 1ETYA 3OYEA 1AKBA 1X1AA 1PYVA 1ARTA 3FXMA 5IYBJ 1ARGA 3CJRB 2L9RA 4MHGA 2VLHA 3E6MA 1BS0A 8AATA 2E1OA 2X51A 2EZ2A 2JISA 4Q4ZF 2XAHA 3AG2H 2OAZA 5F0FA 2HZDA 2BBYA 3B1CA 2CH2A 5IP6A 1BOBA 3LSMA 2O7OA 1C0WA 1JI8A 2TRTA 3DPUA 5E3MA 1OXPA 3RKYA 1P2FA 3RDIA 1MBKA 2P5VA 2IVMA 3CO6C 4ZAHA 2DU9A 2VIAA 2M3AA 5JHUA 2XROA 4RAEA 4R1HA 2GM4A 3GXOA 1R22A 2A69F 3EUKL 4F7ZA 1MDXA 4U7BA 3V7SA 1VQ4I 2WY7Q 2VKDA 1WYUA 3CJTB 2CQQA 2AATA 2K9MA 2VYCA 5LGUA 3I58A 2FMYA 2X1CA 1ZGAA 4XEWA 1DKAA 3AL0C 2A6EF 2FNUA 1GVDA 2DA5A 1U5TA 1J32A 4Q47A 1OQYA 4KN7X 5M4DA 1JHFA 5K7ZA 4RIZA 1K61A 3EI5A 3IUOA 1ZRFA 5DEQA 2HFHA 4A00A 1W0UA 3MD2A 1AHGA 1GV2A 1MH4A 1MSEC 1V5GA 1UHWA 3K7AJ 3MCZA 3S2WA 2MGQA 1S3JA 1MAQA 1WYVA 3QPSA 1HA8A 2LG4A 3E2ZB 3KZZA 2VKVA 4MLOA 4BXXJ 2BYJA 4ZWMA 3OIQA 2XDVA 3DQVC 3DC1A 2PMZN 5HS9A 3KYLA 4XKVA 3QOPA 3K4BA 1ORDA 1S08A 3B73A 2NVQJ 4BAYA 1PJRA 4ON0A 3B8XA 4W91A 4M3GA 2PQ8A 1U9OA 4FHTA 1MMNA 3F23A 2VJJA 1EJIA 1GBNA 3NARA 2WK7A 2ZCWA 3IKVA 3RCHB 1IO2A 3M8EA 2YU9J 3AEMA 2VOOA 3HOVJ 1B9HA 3B1EA 3FIWA 2B9SA 1TPLA 3OV8A 2C44A 1EG5A 4BL0B 1W7NA 1ASLA 3KP7A 2FOWA 4ZTFA 3SHFA 1BBYA 2LD5A 1Z6RA 1IC8A 2ID3A 2FBIA 3L2QA 2R93J 3RZOJ 4OTLA 1A5JA 1WH5A 4GXOA 4XM3A 2DMUA 4UVBA 2P6TA 4ENJA 2VB6A 1J9IA 4U87A 4R2NA 2I5UA 3LVKA 1ON1A 3E6BA 1ZKGA 1ECXA 3HIFA 4W97A 1PUEE 2O03A 2PO3A 3OYKA 4ZDLA 3H9GA 4ZTJA 4NUBA 2VT3A 1ZLJA 2XAJA 2NS0A 4F5LA 2JT1A 1FLIA 2FBKA 2XV4S 2CSOA 1BL0A 2CYYA 1N8PA 3PFYA 2W7HA 1SFFA 2ISZA 2QZ8A 3B6CA 4N0WA 1FT9A 5BMZA 5IP7J 1JUMA 3KP2A 3OYBA 3GJUA 4V2GA 2HQAA 3PQJA 3WGHA 2KJCA 3BP8A 1JF9A 3BT9A 2BHXA 4RB1A 3E2ZA 3SZTA 4MSOA 3A9XA 3FBNB 2P6SA 2JZYA 3U2RA 4WF2A 3ZR8X 3DPTA 1JGSA 1S29A 5TISC 1FX7A 5D8KB 3S14J 2VT2A 4LGWA 3QPLA 2OKJA 3H5AA 2Q7WA 5TRDA 2LH9A 1O4XA 2X3LA 4R8DA 5FKOA 1F9NA 1XCBA 4HV6A 3MKYB 2R7RA 3F8MA 1TWHJ 3E97A 2XGDA 1KGSA 2K7LA 2F5FA 2ACJA 5J6XA 1TL8A 1D2FA 4IHSA 2PG4A 2DA4A 3KGWA 3FXQA 2R7VA 3GETA 2W7EA 1SVOA 4GDYA 4TN4A 5E4ZA 3QPGA 1SF2A 2R7TA 5K7HA 2X48A 2XAUA 1JUSA 2V1DA 5C3EJ 1SFEA 4EMSA 4D5FA 4Y13A 3CMYA 2DOFA 4IYOB 1GEWA 1AOYA 1OYWA 2Z1ZA 3DLAA 2IGNA 3I59A 4R5FA 3E7LA 4KICA 1AHEA 4BHBA 3EYYA 3ULQB 2G0EA 1FPQA 1XGOA 2HZTA 2HGCA 3HKZA 2XGEA 3IWFA 4KUMA 5KCMA 5FT4A 5E1ZB 3CD6I 4Q5SF 2FE3A 3VSLA 2IS1A 2VI9A 2W85A 1HCRA 4M9ZA 1YJYA 3H35A 1MIJA 3WGCA 3CTAA 2MD0A 1N2TA 1SFXA 3MBBA 4EJWA 4F55A 3KYCB 2BIAA 2KRFA 3RPUA 3ZRGA 2XAFA 2LR8A 2OD5A 3Q9SA 2KLOA 2IGOA 1WWXA 1QQIA 5D5SA 4NDLA 2ZMEC 2D7YA 4A12A 1R1UA 3HGGA 1MBEA 1U8RA 1GT0C 2XC7A 3CQ5A 1P4XA 2EK5A 1N25A 4UV9A 3OYMA 1ZLKA 3FKDA 4MQRA 1HW5A 3KEOA 2BYVE 2X6XA 2VL8A 3D5RC 4XLAA 4GE9A 5HS7A 3UAKA 4KMUX 2MYSA 5BPIA 3K2AA 4A0HA 5J3LA 3E3VA 4CYCA 1O3RA 3PUFA 3FZ7A 2OQRA 3KP4A 3W1JA 2FQ4A 2XIGA 2CW7A 4I98B 3I64A 1Z0XA 3VYTB 4FTHA 1YO5C 3S1RJ 1BQAA 4A3DJ 2DFIA 4FQGA 4NC7A 5CVVA 2DKBA 4BJ5C 2BI3A 2OQXA 3C2GA 1TWAJ 1TWFJ 3JAMZ 1B1BA 2CH0A 3MKLA 4E70A 1H0MA 4IEJA 4BNCA 4DYRA 5KAFC 4G7HF 2HOTA 3BN1A 1ZR2A 2LY2A 1DPRA 5K1YA 5G2QA 1MNMC 2VE8A 2HYGD 2DPUA 1XTAA 1X29A 3WHBA 4ADBA 4ENMA 3OS1A 5M5WJ 3E1SA 1KONA 3QI6A 2Q2EB 3CDHA 5ERIA 3JRBA 1RIOH 1AHYA 1M32A 1T3IA 2HWVA 2AY7A 3CJQB 4IXOA 3EZSA 2BIGA 5ICCA 2AO9A 2VI6A 2M4KA 3V7RA 1L3LA 1KA8A 1UZCA 5IT9K 2VC0A 1FC4A 3RTRA 4BXFA 1X28A 4IQ4A 3IL2A 1KKPA 3K7YA 3USFA 2AY3A 2QLRA 2D61A 4E7KA 1FBQA 2W84A 3FX3A 4G6TB 3E9KA 1XGMA 4BDYA 2D63A 1Z67A 1WKMA 2ZKZA 3ISLA 3LY1A 4FL0A 3CCEI 1ETWA 3NWTA 4AVPA 1B8IB 1C4KA 1LDDA 3BOQA 2HOYA 1FC3A 1RZ4A 1XN7A 4G9YA 4PFFA 3FMSA 1SAUA 2R92J 3EIAA 3AENA 2HOSA 1G3TA 4GSAA 1KYZA 4C30A 1AMRA 2COMA 2EV0A 3AG1H 3NUIA 2R7FA 4YRVA 3ZZJA 1OCRH 1QITA 3BPXA 2JK3A 3BR5A 4X6AJ 1VQLI 2JUCA 1FOXA 2M7BA 1BC7C 1ASFA 1D8KA 3JRIA 3PDXA 4Q76A 4L9VA 5F8VA 4QPOA 2KPMA 4FX4A 2QM3A 4UHMA 1UG0A 4A3BJ 1YRNA 2NMPA 1H0CA 1WH7A 4KDPA 4A6UA 1K78B 1UU1A 4M6XA 3TP3A 3VWBA 3D0SA 4YIRX 4WWCA 2HDDA 3K70C 3JU7A 4DZJA 1JG8A 4GO1A 1MDZA 4BKXA 3K1NA 4IXSA 4MKKA 2EO5A 5JHFA 1PMOA 2Q2EA 1YW7A 3FMRA 3WODF 2FU4A 2W7GA 1JTXA 1GUUA 1WFXA 1ZARA 5EZHA 1OATA 1T8IA 2FXAA 5HLGA 3MAJA 2XKOA 2M8GX 5CVIA 3BJ6A 3NU8A 2H8WA 1MNEA 2L02A 2P0WA 1OYYA 2WAQN 4PGGA 2VMTA 3LQRA 4U0YA 5LHGA 2EJRA 3GTJJ 4KYWA 2VGVA 2GQNA 4HBLA 1E3HA 1LC7A 1X0MA 1MJAA 4Y3OA 1ZRCA 1D7VA 1VEFA 1S7OA 3S93A 2CUJA 4A6DA 5HVQC 4WK8F 4IRGA 3S2DJ 5FRNA 3PO3J 2CINA 3JRAA 2H1LA 2MH9A 2EFWA 5E5IA 2FQ6A 1WVRA 4XLNF 4F91B 1ASGA 1SFKA 4ISYA 1WSTA 1KMKA 2FEZA 2D66A 1G3YA 3BTIA 3IV5A 3CUQC 4P3MA 2DDAA 3U21A 2A61A 1YJ9I 3FDYA 2DT7B 1ZG1A 1HKQA 3BR0A 1YTYA 3PGYA 1R1VA 4UHOA 1CQ6A 1QZEA 1H1CA 3GMEA 2YSRA 4BHPA 2KL4A 1BJ4A 1I50J 1YW9A 1K78A 2R7SA 1TOGA 4RAGA 2VGZA 1QNTA 3S3NA 1SANA 2XF6A 1ASEA 3DR4A 3GTMJ 1LFBA 2LF8A 1AICA 5F9SA 1BR4A 4OAZA 3FXLA 3ZMUA 4ZDOA 4LW4A 1Y0UA 5HLTA 3KKIA 1SVLA 3QRFF 1IUFA 5D5XB 4LLLA 4NHJA 4XONA 4CUGA 4E4HA 1WRJA 4CHUA 4LOCA 3WE3A 4OU0A 4I02A 1FEXA 5EJCA 5EGOB 2FSWA 3I53A 3M9AA 2JQ7A 3EPZA 2F8JA 1YIOA 4RJYA 1X1CA 1LEAA 2OJED 2Y75A 3LAJA 4PDKA 1XMKA 2ZO4A 1CGPA 2HUIA 1IVRA 3H9QA 2VMYA 2FX0A 3HL2A 3REOA 2VKHA 2R5CB 4Q75A 4N9HA 2ZMEA 1LB2A 2VPLA 3R60A 4AZJA 1U2WA 5CJ9A 3ELEA 1MBGA 3E6CC 3SQNA 2UXNA 4XJLA 1XDUA 3UE8A 4WP0A 1QZ9A 1N75A 1C7NA 7AATA 3OYLA 1DGRM 2XRNA 4UHNA 2ZXIA 4RAFA 3DEUA 4CXFA 3N05A 2IA2A 4OIOF 4BQOA 2ZYJA 3LSTA 3PNTA 1AKHB 1FZPB 2DPDA 2BIEA 1D7RA 5M3MJ 1BW6A 3GVAA 3MN2A 1OCPA 2PX9A 2G7HA 1NG6A 5FFXA 4IX7A 1V54H 5LRSA 4FFCA 4IPAA 4WXHA 3GTPJ 1DPUA 1LEBA 3HM5A 4I0BA 5FO5A 2Z9XA 2NVTJ 1KYWA 4UUVA 3H14A 3ZOBA 2L7MP 1TW2A 3TW6A 2M9HA 1HLVA 3N75A 3B02A 3OSGA 2Z9VA 2YX7A 4J00A 1XSXA 2PJRB 4G94A 4DYQA 4EM1A 3AV7A 4NQWA 4HLYA 5D8LB 2HVRA 5D5WB 2HQNA 4EFFA 5FLXK 1BI2A 4WYCA 3HPGA 4JYKA 4Y4RA 1I43A 3KEYA 2KT0A 1SVVA 3I0TA 4IHTA 4JEWA 4DBCA 4E6KG 1VZ0A 2LP0A 3DTEA 3II0A 2ZBKA 1W7PA 2M34A 2XPWA 2WADA 1IN7A 1RPWA 2HOZA 2QA3A 1TP4A 2E60A 1Z3XA 2QYOA 3ASAA 4A0RA 2YPRA 1IAYA 4G6DA 2QSGX 3A9ZA 2OTLI 3T1BA 4M2KA 4U0VA 3J7YJ 2HOAA 3JSOA 3EI9A 2LRDA 3PUBA 1T33A 1ZHFA 3RIRA 3RJPA 5A2QK 4ESJA 4L0OA 3UR3C 1X4PA 2GWRA 5ICGA 3C3WA 2YKXA 1R5HA 1I1GA 4XICA 4LITA 4PSXA 4LLGF 2VBZA 2FN6A 3PJ0A 1U6GA 1AKHA 1SPAA 3AEJC 2GMSA 2JSPA 3PNYA 1AX4A 4F5JA 3MKJA 3I16A 3F3XA 1OYIA 3A01A 1D0XA 1S5LC 4WYGA 1XSVA 5G0AA 2Y31A 3F22A 2Y9ZA 5G4IA 1PMMA 2GAUA 5C4JJ 1MJ9A 3O8GA 4B1RA 2CGPA 4M3EA 1JKPC 5B66C 1RRJA 1X2NA 3G1MA 1VQ8I 4O6ZA 3WCOA 3LSPA 3C1DA 3W2WA 4CDGA 4XKCA 2B0LA 1XMAA 4WYEA 2HPIA 1YAAA 4YEJA 3Q3SA 5D4SA 4J01A 5BS6A 3ZQGA 3S2HJ 1FMWA 4KJZA 5K5OA 3ZMDA 1IJIA 2W8UA 3UWCA 3SXYA 1O61A 3P7NA 5J1RA 1QJ5A 1SD7A 2KZGA 1J7KA 3G4SI 2HVSA 1VQOI 3FQ7A 2PJPA 2O3FA 1FIPA 2QUFA 3GTOJ 1K79A 2OZUA 3HOSA 4N4OB 3FRKA 4P7YA 1S8NA 2YOBA 1B8GA 2GOMA 1ZODA 3JZLA 4CBRA 2LBFB 2AY8A 2LK2A 2E71A 1W4MA 4J8LA 1X2MA 1BIBA 4CH7A 2LTPA 5GTHC 4E7LA 3TOAA 3F6OA 1LE8B 3NRAA 3Q8NA 2FF4A 3CUQA 2DYSH 1WJEA 3TO9A 5F1RA 5IOZA 2STTA 3TGNA 4CCOA 3ERED 4AIKA 1O7FA 3HC7A 1IN8A 3GWPA 5CVJA 1P6RA 4ZWVA 2BWNA 1A6QA 2DYRH 2JA2A 3BV0A 1WCMJ 5LFAA 3HTUA 2VPRA 4EB7A 4LNJA 2Y9YA 2E34A 4W1WA 1HKSA 1UG2A 3GFJA 2RQPA 1UFMA 5BJ4A 1T56A 4W1UA 1CQ7A 2ISYA 2Y0SN 1XCVA 4PK4A 2L9SA 1MDOA 2AQFA 4R5ZA 5M3FJ 3H7FA 4WLJA 2IEKA 2HOXA 2W7LA 1EV7A 1LVAA 3OS0A 2OA4A 1RV3A 4XAUA 3IF2A 4DGTA 4GDFA 1F4KA 1BOAA 1E0EA 1BI0A 1YW8A 3Q5FA 3Q0UA 2WA0A 3E6DA 4KA4A 5HOOA 5DM6F 3A03A 2NRAC 2AY9A 4XKWA 1PUFB 1M7YA 1ETVA 3HJEA 2X1EA 3HRUA 4IX8A 4UUTA 2VJ5A 5FKKA 1YQAA 4CCMA 3GFLA 3K4JA 1DJ9A 4MQVA 4CSWA 5C4XJ 2GSAA 1FWZA 1DU0A 1JUPA 4Y52J 4IQJA 4XSXF 2V6CA 4ZYEA 1HF0A 1VQMI 2KDOA 1SMYF 1ZELA 2XPUA 1YIJI 3K2ZA 3GCMA 3JTHA 1K6OA 1KQ9A 3PSFA 4IHWA 4AVZA 2NVXJ 3N5MA 2VOPA 4ITGA 4C3IJ 2YRRA 5HDKA 4ZZLA 3AG4H 1D1AA 2Z9WA 1G6NA 4E7HA 5LHAA 4UVCA 2R7ZJ 3CLQA 3FXUA 2F4MB 2IA1A 1W23A 1E5EA 2QBTA 2K3PA 2QWWA 2HU9A 3PNVA 4WXCA 1J2XA 3KGXA 2EH3A 3T32A 3AFHA 4ZYDA 2D45A 3M8FA 3FK7A 2TDXA 3SJMA 4EM2A 2NXNB 3RCOA 4H4KC 1UHMA 1JS6A 1Y1VJ 1NH3A 2CQNA 3KETA 2Y0MA 3HSEA 3RKWA 5C44J 4XJOA 1FYMA 2W4SA 2IGKA 1OR7C 3QYBA 2MW8A 3DEEA 4CCNA 2CFBA 3GLXA 4KIFA 2DR1A 2M7AA 2WAQA 2DODA 3FXJA 3B46A 1X1DA 4M2MA 3H3UA 1AJSA 4LG3A 2JWTA 4HV5A 4UB8C 3A0BC 1ONVA 2VIXA 1WYUB 1MZBA 1PUFA 4IOAF 2QGUA 6PAXA 3K1MA 4BDZA 3BR1A 2LY9A 3LWSA 1R7JA 3A02A 2JRTA 3GLLA 3E77A 4YFKF 2MH2A 4C9YA 2LFBA 5K5QA 2OPTA 3CAIA 3AKZA 3KLOA 3BC8A 3DFGA 1JTYA 3COAC 1U5TB 4II3A 2ESHA 1K4TA 4BA5A 1QZZA 1CL2A 5JLWA 2H6CA 1TT0A 1M1EB 2JG2A 1MBHA 5CVUA 1KKJA 3J7ZI 2HEOA 3WY7A 2LMDA 1WYVB 2R5EA 1OJLA 3JW4A 3ML6A 5J8FA 3GUDA 5D6FA 3KP6A 5EG0A 2BWPA 5HODA 5H6QA 3WCNA 3BTLA 2VMNA 1TZLA 2KZVA 3BZCA 4B98A 1JJ6C 3EQLF 1ASNA 4PJLA 4E7JA 1OKRA 4BE2A 1BT4A 3IC7A 2F5CA 3VK2A 3G1OA 2GLOA 4PZJA 5ILUA 1MMAA 1TQMA 3FMQA 3WE2A 4HDUA 1ZRDA 1VQPI 3L8AA 2FRHA 3WU2C 2R7UA 1JS3A 4BMKA 3G1LA 1M0PA 2CMPA 4II2A 1S9HA 3F6VA 4D7MA 3DXVA 4LB5A 1VNDA 2K9LA 3F8FA 2W48A 1NTCA 1S7EA 4RM1A 1ETQA 1ZC9A 1Y8QB 3PD6A 5EEGA 3WHCA 2CW0F 1TWCJ 5IYDJ 4Y33A 4CA0A 1I1SA 3R0AA 2BGCA 5L3DA 3H92A 2BI9A 1SD4A 3ZN0A 3HOZJ 3COGA 5EIGB 3Q0WA 2A3SA 4OT8A 2DT5A 2W7IA 2CB1A 2XF7A 4WBTA 5GPCA 2VC1A 5IWQA 5DCFA 1ZG5A 4A3FJ 2XGXA 5FJ8J 1FOWA 2GBYA 1QPMA 2YR2A 4EEFG 2ZNYA 4G8XA 3A2KA 1BJZA 3BJOA 1E5FA 2D65A 4OINF 5LHHA 5ILSA 4IL6C 4BHCA 3WU1B 1RKWA 5IY5H 1IRZA 2VMRA 3OSFA 2BI5A 3AATA 1IX8A 2VGUA 4WCGA 1UMQA 2CQXA 4NC8A 2XVCA 4BJ6C 3J80Z 5BPDA 1W36D 2R2NA 2YKUA 3PAAA 4ATPA 3P9KA 4HNTA 1IG7A 3SDBA 3QN6A 4FE7A 4OBVA 4LIVA 4W8IA 3NDNA 1PP7U 2O5RA 3K69A 1KL2A 1C7OA 2RNJA 4XKBA 3EYIA 1ITYA 5AIPA 1I6HJ 2R7WA 2C0RA 2R7OA 1SZKA 4HPQA 3K28A 5HDMA 4BBRJ 2DJNA 2HI3A 1IBJA 2ZFWA 4KITB 3F0HA 2L54A 2DGKA 1GC2A 5E3OA 3I4PA 4ZC3A 4HVKA 1FP1D 2QBYA 3FFRA 3HRMA 3M1CA 4ITXA 4HF1A 4YG2F 2L7ZA 4A3MJ 2ELKA 1HXDA 4QLCU 5EEAA 2O61A 1BA5A 4XR6A 1O69A 2AEVA 2BY0A 1U9NA 3QWLA 2E19A 5K5RA 1BN5A 1EKEA 2V26A 2Y48A 3K4MA 3GZ6A 1P92A 3I59B 1IUGA 1N78A 1Y39A 5EIGA 2Z5UA 2CV1A 1QZYA 4I8AA 2B7EA 2ZJQF 1TT5B 1N31A 3HLMA 2JPBA 2RAEA 3S16J 2JJEA 3OYIA 4RS8A 3GW2A 2K4BA 4ESFA 1S0AA 1P7JA 1RC9A 1D1BA 4C2TA 4RKCA 3WKRA 5C6UA 2QF7A 1QBJA 2VASA 2R7QA 3V8KA 2Z9UA 4PGHA 3FHNA 3EIBA 1SEUA 3SFZA 5F08A 4JE5A 2IPQX 3QU3A 1X3WB 3CQ4A 5GTIC 4IKFA 1TWGJ 4JOMA 1R4NB 3LSHA 4RGSA 2R7XA 5M5YJ 4FX0A 1W1WE 2ME0A 1IF1A 2F4IA 4A6RA 1C0NA 4A2UA 2DN0A 2LOOA 3CQ6A 1AY5A 2M45A 2HKOA 3ONQA 4U7DA 4JX4A 3M4OJ 1EQBA 3WTSC 1CZEA 3R9AA 4XL9A 2X5FA 2CRGA 1ETXA 4XK1A 4P55A 1BJNA 1FOYA 2KISA 2QVOA 2VBYA 2BV6A 4PFPA 1DFOA 1Z05A 2L9VA 2Q1ZB 2HXOA 4L9JA 3DPLC 3HHHA 3ZQIA 1EA3A 4CYCB 4KIGA 3LSJA 3EUHC 3P5JA 5KVRA 5F0HA 5L3FA 1OR7A 4EGZA 4A72A 2CSTA 1V2EA 2X4HA 3C7JA 3SYTA 2V9PA 1JE8A 3VAXA 1BQDA 1WQ2A 2IGMA 4AIDA 4ZH4F 3F8NA 2L9NA 3FXRA 3FZ8A 5FRMA 2BWOA 2DBBA 3LFUA 3ZZKA 1YNUA 1CF7A 4P9FA 3LFKA 2V1UA 3MVPA 2NNYA 2F5VA 2K9SA 4CBSA 3AL0B 2HUFA 2CG4A 2DJIA 3OIPA 4MGRA 3Q0VA 2DK8A 2VMUA 4BQAA 4OOIA 2ADUA 4S0HB 4EJTA 2W7MA 2JVHA 2KJBA 3EUCA 5B1BH 3OYNA 3H9JA 3DR7A 3JAMK 2AQEA 1IDZA 1T0FC 4XLPF 2VQHA 2WTEA 3JRCA 3MEBA 3RBFA 3K0LA 3VOMA 2DTRA 4B9BA 4N9IA 1AAMA 1WJDA 4OBUA 2AY1A 2RFVA 1VP4A 3DKYA 4LW2A 4CXRA 4BJTA 2JVGA 2ZUKA 3L2VA 2QKMB 3AENB 2JN6A 3CP2A 4BUPA 4BY7J 5J8CA 1YIYA 3S1QJ 2ZSMA 2VGTA 1QO0D 3ZMTA 3H0DA 4H0EA 1L0OC 1O3SA 2GA1A 3OYJA 4I7HA 4XBFA 1CJ0A 2YUSA 3CBFA 3TKYA 1H9GA 3OL4A 2L01A 2MABA 1YRNB 4I0AA 2VJIA 1XGNA 2JGTA 5FT5A 3BR3A 1JT0A 4BA4A 1ZOBA 5IP9J 4M71A 4S05A 3GZDC 3BTCA 3S8PA 4A93J 1E3PA 3W6VA 2CJDA 2KQRA 1R58A 4RB3C 4IJAA 3KFWX 4WX9A 1K6YA 4L5IA 3O2PE 3V4GA 1D5VA 2AY2A 2HP1A 2ZXJA 1VQNI 4UUSB 5L3GA 1GC4A 1USTA 2ECCA 4XLHA 1F5TA 2L2OA 4TV7A 3ZPLA 1MGVA 3OR2C 1OHYA 3GFIA 1ELUA 2MLKA 3DTIA 2W8VA 1R00A 4PJMA 5E1XA 5IOYA 3RPUD 1SFOJ 1IAXA 2HS5A 4M74A 5E18F 4FE4A 3RI4A 1BW0A 3E5XA 4KMFA 4AZKA 3PL8A 2D2WA 2X6YA 3DEWA 3OWTA 2AY5A 1ZK8A 1KU2A 1BJOB 2Z1DA 3E5QA 2WC2A 4WB0A 3F9KA 1EH6A 1W0TA 1YX5A 2HUUA 1Y8RB 1U78A 4MNUA 3WZFA 1LFUP 3KCCA 3DRDA 1UU2A 2GOXB 2RC4A 4B3XA 3QM2A 2EA4A 2A07F 3T5XA 2JA7J 5EUDA 4K2BA 2LF7A 2JJ7A 3K6GA 1IRGA 3ECHA 2W8JA 2BY3A 1MNDA 2GXAA 1QISA 3PA9A 4XLCA 4MEXF 2A6TA 5M4BA 3J81Z 4I09A 2GXBA 4IHVA 2BHYA 1T08B 2QSFX 5G4JA 4EJOA 5KK1A 1AJRA 3ELPA 5DJ1A 1K83J 3LSKA 3M1EA 4FCYA 4G12A 5IYCJ 3IAS2 2ELHA 4CCLA 4M9XA 2V4JC 3SEZA 4OCAA 3N97A 2GQQA 1P4AA 4DOZA 3KE3A 2CUEA 1TATA 1XEYA 2EZ1A 1A6IA 3MC6C 4E77A 3JR9A 1TTYA 2IA0A 4ITVA 1A36A 1QGNA 1T98A 3CCUI 4UUSA 3ATHA 4RGXA 4PJNA 4HAMA 3JRGA 5F64A 3ISPA 1IRXA 4EJUA 3M3YJ 5DUKA 2ELJA 2ZFUA 4KNYA 1GHCA 3OYFA 5JR3A 1MH3A 3KYDB 1D0ZA 2ECBA 4U1TA 4RDUA 5HLHA 4JBAA 3OP7A 4JEZA 1X1BA 2W24A 3CDLA 3LA3A 2WB1N 1CS1A 1MMDA 1BJOA 1GXPA 1PFFA 2ICWG 4PSWA 1HQCA 4AC0A 4F4EA 2XB5A 2EV6A 3M07A 1JXSA 2ZMEB 1TLHB 3ABUA 4QGRA 5HS8A 1B9MA 1D7SA 2B63J 1J0RA 3TQNA 2JA8J 1XG1A 2P8TA 4I2OA 1EF4A 1TOKA 3HMUA 2CW8A 2BVLA 3BG3A 3A9YA 2EZHA 4JF0A 2CFXA 1RKTA 1U0JA 2CH1A 1G4DA 2CO5A 2CTZA 1S72I 4UV8A 2DK5A 3ZQHA 5CQGA 1XS9A 4GFBA 5LEKA 1VFCA 1FBUA 1OXOA 4LK0F 4CZCA 3I55I 2VMVA 3NX3A 4I76A 3EUHA 4EMYA 2DQLA 1V5FA 3S1NJ 1HBXG 3OS2A 3DV8A 3G7QA 1G2HA 5EQCA 5J1UA 3WG7H 4ZZDA 3OYDA 1WJ5A 3ZGKA 3NRVA 2VODA 1YOVB 4LK1F 2PI0A 3ERMA 1BC8C 1B5OA 5JLXA 3TEDA 1TOJA 4IRHA 3RI6A 2BY1A 1YI2I 3BROA 1LDKB 3EZ1A 1IXRC 2ZNZA 3HSRA 1Z77A 3I5UA 1B59A 1LFPA 3WTTC 2WV0A 2DTZA 3GZCA 4NQWB 2R0TA 2PMZA 5J4VA 1V3FA 2DMTA 4U88A 2BEOA 1RNLA 1RR7A 4WYAA 3OYGA 3ZN1A 4NBQA 1TNSA 2W25A 4JQFA 1BJWA 3G8MA 1T0FA 1T6SA 1W7PB 3SZGA 1OPCA 3QBOA 2O9LA 1JHHA 4TMRA 2HDCA 5LLQA 1SVMA 2BHZA 3DKWA 1LDJA 4M73A 4QSHA 4MKJA 2M0MA 2MFZA 3JCUC 3EDPA 4G7OF 3WKSA 4ABZA 2DCEA 2CQKA 3U1KA 4NB5A 2OCCH 3V42A 3F8BA 1PP8F 1YJZA 2EIKH 3EI6A 4K2IA 3ABMH 3MZ8A 1P3WA 2VLFA 4E1OA 3S17J 4XNFA 5DM7F 2IRFG 3ECDA 1RI7A 3FM3A 1GXQA 3RZDJ 1K4SA 1REPC 3HOUJ 2RVCA 4HNVA 3WU0A 5LEJA 3A01B 1T95A 2XAGA 5D5VB 3QPHA 3HOXJ 3HDOA 4XJPA 4HG2A 4RLQA 2HTJA 3TO6A 1QVUA 2P7CB 2Z9OA 2R7DA 2GIVA 5FD5A 3K4KA 2EFQA 1I29A 5M49A 3KZYA 5DJ9A 3HXLA 3WTYC 2D1HA 2WBMA 1WJFA 4N4NB 3GZDA 1QIRA 4MO7A 2ZXHA 1KZHA 1CL1A 3C18A 4PFOA 1O4SA 4AD9A 1ACIA 2XB0X 2YKYA 2OC6A 2V9KA 2JUGA 5BNGA 2VUMJ 3RQIA 3MKWB 3E2YA 2Z67A 1FG3A 3BWNC 1DQUA 3I4MJ 3OOUA 4CGZA 2D5VA 2OTJI 4A5NA 3SFIA 2HDWA 2BW3A 2H6BA 2C7TA 4V19K 2W7FA 2Y30A 1ASDA 2AHQA 2D64A 3I3LA 5F6FA 1R9TJ 1IX7A 3I5TA 3AAFA 3AEPA 1XC5A 4HEA2 2VJ4A 2CV2A 1S09A 3E2FA 1IJWC 3A1YA 3TMOA 4EJVA 3VP6A 3MADA 3WGBA 5ILVA 2Y69H 3MAUA 3HEFA 4A0FA 3W6JB 3IAM2 2E1MC 4RLFA 4HA8A 2Z2SB 1S06A 1BKGA 3CUQB 3CCRI 5E17F 3FXOA 1W5SA 2VXZA 2F2EA 3RQ4A 3AELA 5D5UB 2CWEA 5EDNA 4M2JA 1F1ZA 4JP0A 4M6VA 3PIPF 3I56I 2AS5F 2E1CA 2PB0A 3FVXA 4O6JA 2LC2A 4YIFA 1BI1A 3D5LA 3DU5A 3BS8A 3JTGA 1B9IA 2NOJB 2DW4A 3CC2I 5GADJ 4L18B 3TFTA 5LRRA 2GXGA 4A3GJ 5J8QA 3MC6A 1FNNA 5DS9A 4RGUA 1FTZA 1NG7A 4LIUA 3CF5F 3HRSA 4GGGA 4BEHA 4Y7NJ 2CUZA 1OMIA 3ECOA 2X6WA 3ZMVA 4F52A 3JRFA 4KT6A 3NUBA 3ZQ7A 4PIWA 1FIAA 3HHGA 1SAXA 4KISA 3R0JA 1HW2A 1IN4A 3Q9VA 5GAEJ 3FBIB 1HC8A 1W7PD 2KIQA 2WAFA 3PQKA 2ZC0A 4WXFA 4ETSA 1IV6A 3A8UX 3B1DA 5LGNA 2A6HF 2PEXA 1W5TA 3ZQLA 3IH3A 1WGXA 5EF6A 2YHKA 4EQQA 4PJJA 3DBLB 1TOEA 2NNNA 1ZR4A 1RETA 2WAEA 2DGLA 4W1XA 2IP2A 1ZGWA 1GEXA 5HDNA 4XOTA 4X1EA 3EI7A 5BOXA 3BWGA 1O3TA 2EPFA 2XASA 3CESA 1Z3YA 2Z20A 2K9QA 2DMQA 3WTVC 2EBIA 3KPHA 9ANTA 3U1DA 2ZJPF 1T39A 4IXZA 4AH3A 4RAZA 1QHHD 4XRMA 3BZ6A 1ULYA 3HKZN 1RVUA 4DQ6A 3VK4A 4HLXA 2RN7A 2P5LC 2FM1A 1MSFC 1NK2P 1H9TA 1F43A 4FETA 3K70D 2QKLB 2L3DA 2WV1A 2BXYA 3BPVA 3LA7A 4P5OA 2AXTC 5D4RA 1H88C 3S1MJ 1WPKA 3DZZA 3VK3A 3O6BB 3P9CA 1ENHA 2K86A 4MIMA 2VI8A 4GRXA 4WYDA 2YS9A 1AJSB 3I71A 1YS7A 4HW0A 3GX4X 2EWNA 4A5MA 4E3RA 3ABLH 5CLSA 3ZMSA 3LV2A 3NWSA 2P81A 3AEMC 1ODDA 3KIOA 4RB2C 2Z99A 1MW7A 1KU9A 3VOEA 2W00A 3LSRA 3HOWJ 1R71A 1AHXA 1HSTA 5L3CA 3VB2A 1E2XA 4XLFA 4A3LJ 2JJFA 2LLKA 2P7VB 4ZSWA 3QYFA 2ZC2A 4LNMA 5FT6A 1D3YA 1ASMA 3DU4A 4Y0HA 2KP6A 3UNGC 4BS9A 2O8KA 3FD0A 4BQNA 4N0BA 2DA6A 2DFHA 2FBHA 2W1OA 4IVNA 4ZASA 3L1PA 4C2MJ 2FD5A 2V9VA 2EIJH 2EZIA 3BDDA 1DDNA 2MC3A 2FYFA 4ZSYA 4DQ2A 4BHDA 2ZB9A 2KDZA 3FISA 5EG0B 2NVUB 4E7SA 3CCJI 3DYDA 4F92B 4LG0A 3ABKH 2OUMA 5DD8A 1UHSA 1TBXA 1VI0A 4DBRA 4CZZA 2XH1A 2MSYA 5L3BA 4Y0IA 4U2HA 2UUZA 4HF8A 3NYUA 5TF5A 3G73A 2V1NA 1O7LA 1ZAOA 2QQ9A 2E2IJ 3F8CA 3ASOH 1OCTC 4IY7A 1KQ0A 2ESNA 4GRIA 3ASBA 5LBQA 4MY5A 2E2HJ 1YE9A 3TOBA 4XLEA 2DOAA 1B72A 2GZWA 1K7AA 2I10A 2VE9A 3FM5A 1IRFA 2FJ1A 3D1NI 4S04A 1S7AA 1IZ1A 4U0WA 2TCTA 3JSPA 1Z7UA 3T8RA 3FWEA 4AOAA 3TQXA 2W57A 2KHMA 3PD6B 5BJ3A 4XN0A 1U08A 1P4WA 2W8TA 1I6XA 5D95A 2YX4A 2V0YA 3OKSA 2WB1A 4JEYA 2MG4A 4A3EJ 1M0NA 1S07A 4DNCA 5G2PA 2F5DA 2MD5A 4LFUA 3BCXA 2DMNA 3HSFA 3KLNA 1WHUA 2FA5A 4LJZF 1M6SA 2ETHA 1G8XA 1VTNC 1XX5A 4GEBA 4HQEA 4BBSJ 2W7JA 3P6KA 1VJOA 5JAYA 2EPJA 5E8IA 3BQZA 3OIOA 1ELQA 2NS7A 2HYFA 2K9NA 4W1VA 1SD5A 1DP3A 1AMQA 1MLZA 3E0JB 2X9DA 2E1NA 1B4XA 1X58A 1WZ2A 2QMAA 3ZRQA 2QSHX 4BYYA 2E35A 1JJ8C 4Q6RA 3QU6A 3EUAA 2JJHA 3MAFA 2IBDA 4UQVA 1Q1VA 2ZSHB 1AKAA 4NNJA 5E8GA 1WYTA 2O7CA 4IHYA 3A2BA 2E2JJ 3L2WA 1XPXA 4MQ9F 5FD6A 1AIAA 1YJWI 2H1KA 3AEJA 4YFNF 1LJ9A 4BE1A 4XQ2A 1X4OA 3MFKA 3I54A 2BI2A 3I4JA 1RUNA 4KIBA 2WK8A 1WJCA 1SFUA 2C6YA 3FCRA 3KEQA 1B5PA 2W82A 4IW7A 1G7WA 2M4GA 3DBRB 1MDMA 4GYIA 5IT3A 4HX7A 3QODA 2QQ8A 4B09A 1GDTA 3J80K 1UU0A 5EZGA 1W7MA 1B9NA 2X6OA 3QAHA 4G6QA 1T2KA 2NYXA 1A31A 2QBYB 1PG8A 4JEVA 1Z7LA 3CUOA 2XPVA 2H94A 3HDDA 3P1TA 1ZGJA 3AG3H 2XSJC 2Z33A 1BIAA 1QRYA 1XMXA 2N8GA 2O8XA 1I48A 1YS6A 2IXSA 3A4CA 2K27A 3K9TA 3OMYA 1JGGA 1X3UA 3KE2A 1LQ1A 4CCKA 3FKJA 4B3AA 3RUYA 2R5YB 4ADDA 4YFXF 2YCPA 3W6KB 2W7NA 4XIDA 2QB3A 3RQ1A 4D5CA 5ICFA 1DGWY 3T0YA 3DP7A 1FTTA 2HQ5A 4F5IA 1G4XA 2DFFA 2RNGA 2EA2A 3GBGA 1GEYA 2KRCA 2HQRA 2QA4I 1QHGA 1KMJA 2XSDC 4L9NA 4ADCA 3WGIA 1IUYA 2FMLA 1DTYA 3DF8A 2R5ZA 3CF2A 2EFNA 3ZXSA 2BOLA 2VGWA 3E6GA 3T8TA 4CYDA 2DA1A 1V4RA 2QCOA 2UXXA 4XMYA 1LS3A 1LPQA 4NOGA 1XDSA 2R3SA 3KZIC 1XSDA 3GZ5A 1R1TA 3VDXA 1S6LA 2PN6A 2IJLA 4XQFA 3V8JA 3FKIJ 4L9TA 3TBIA 3NYTA 2EFOA 2ZP7A 3FF5A 3BCAA 3G0TA 1I3QJ 3F21A 1NK3P 2KKOA 4CO8A 1Q1HA 3DBHB 1YYVA 2OKKA 2JTVA 1OFCX 1IAWA 3SEQA 4XRSG 5DTDA 3NNKA 4P96A 4PJ0C 3U9GA 4F3QA 3H5NA 3FDBA 2NS8A 3CP8A 1X2AA 4LMYA 1BM9A 3L7WA 4AYBN 1TQPA 3BG7A 3GF2A 3QPTA 4ZYHA 2H8RA 5FLVA 4E7ZA 2CUFA 2QEXI 3TATA 2ID6A 5GPAA 1AKCA 3LG0A 2LY1A 4B8XA 3FTBA 5BQTA 3H5RA 1G7XA 3NU7A 2R5YA 1USSA 1CF7B 3OYHA 2BKWA 3EI8A 1SMTA 2L7KA 2E7JA 2BI1A 3L00A 1IX6A 4A0YA 2VGSA 3PDBB 4A3CJ 1J09A 1I5ZA 3LNQA 3TDZC 2ZXWH 1EJ9A 4IHXA 1F36A 4A0XA 1W3UA 3K1PA 4Y15A 4RAYA 2OGEA 4RB0A 1QVTA 2K3FA 2OU2A 4WLHA 3PIUA 1GC3A 2HP2A 1TNTA 2EB7A 2JMWA 2HORA 4F5HA 4ENKA 2VBWA 2FNIA 1GVJA 1FYKA 1HDPA 1XGSA 5J47A 3MEXA 3W2VA 3F9TA 3DXWA 4G7ZF 5LD2C 2L4MA 3OY9A 3NQOA 2VMWA 3HZJA 2QQBA 2DOUA 2OQGA 4L0YB 2UZKA 5GAGJ 4Q48A 2DA3A 4OAYA 3LWFA 2A68F 1JKOC 1ERDA 1V72A 3VYRB 2VMQA 3S3OA 4JK1X 3W2AA 1IDYA 1Y0NA 3DU6A 3H36A 3IKTA 1FJLA 2OCEA 1LW5A 2EZKA 3GO5A 4B44A 4FT8A 4BACA 1Y1WJ 1AU7A 3QQAA 3RCHA 4LB6B 3ZP5A 5HNHA 1ARSA 3FXKA 1O57A 1Z1DA 1OHWA 2GB3A 4ZM4A 3VPRA 2KIMA 5H2FC 2DQRA 5F04A 4KXKA 2X85A 3H3ZA 3B6AA 4Y17A 3ZQFA 4MTEA 4BH9A 5JFRA 3PDBA 2NOGA 5EFSA 2Q8KA 3BZKA 3KP5A 2WY8Q 1LK9A 4RBOA 4AO4A 4OIQF 4JE5D 4OIRF 5EYRA 3GEZA 5KAIC 5CPRB 2IS4A 4BQ0A 3AOWA 2V1PA 4BQQA 4YELA 2AXLA 2P5KA 2NAZA 1VQ7I 4EATA 2AEUA 1QJ3A 3F0CA 2M30A 3G71I 3RYRA 1HKTA 3DCFA 4WB0B 3ESWB 3L09A 2K40A 2Y0SA 1FG7A 3O8HA 2LKSA 3IP4B 4Z2YA 1M4NA 2V1XA 3VODA 2GIZA 4QIWN 5B5EC 1ZH5A 3ACZA 1SD6A 3TO7A 5DX5A 4KN4X 4M9SA 1APLC 3RBLA 2VXDA 3IH4A 2M87A 1MBJA 2L7FP 3BCBA 3V8LA 2DDBA 4IRIA 4OMYA 3AEOA 3ZQQA 1GC0A 3RYPA 3PO2J 2RV8A 3VSKA 1VQKI 5E1WA 3QP6A 1D5YA 2KMUA 4UNOA 4DIQA 1YIZA 2PMUA 1OLTA 4EM0B 3JRHA 2Z16A 4CXQA 2STWA 2QLZA 2VMZA 5EUNA 2W7KA 1SZUA 4M6YA 1DJUA 1SC7A 2XHKA 1T38A 4AM3A 1R5GA 2G9WA 3NAUA 5GAHJ 2LKXA 2DAOA 4A6TA 2QQAA 5AONA 3GYHX 1YJSA 1V5EA 2K4JA 1E17A 4WXGA 4LD5A 2E5NA 5GP9A 5CVRA 3J81K 2DA2A 1EH8A 1FP2A 3HT4A 5J4YA 2EINH 2EFPA 4PVFA 3AOVA 3W3CA 4F5MA 2GA2A 1V55H 2J5OA 2O0RA 5FB2A 3DODA 2CS3A 3E5UA 3WG9A 4IYOA 2RREA 2DI3A 3JRDA 2V79A 3TCMA 2RQQA 2DFEA 2HPMA 1IN5A 1R36A 1PVEA 3CZ6A 4GCVA 2DLLA 4MTDA 1AWCA 3HB9A 2DA7A 3NEUA 4LNLA 2RKHA 3RSNA 4HOBA 1ARHA 2DT6A 2E7WA 4DGWB 1IXSB 2WKAA 4PUSA 4DW6A 5DYMA 2JPCA 1J59A 4FASD 3OR1C 2UWMA 1HOMA 3WTZA 2JRMA 2JA6J 4F5FA 2ZSLA 4GE7A 4QPQA 2LDUA 4HZFA 4C3JJ 3R4TA 3W1HA 1QU3A 3G6EI 4L5JA 5TJJA 3H3VK 2E36A 2FNAA 2W7DA 4ANJA 3QHXA 1DU6A 1G3WA 3VEPA 1MMSA 1TASA 1MD0A 3IRRA 4EV0A 2VQCA 5FKLA 4IO9F 3EETA 1LUJB 2VMXA 4D0PA 3BG9A 3H0GJ 2CANA 1KU3A 4EB5A 3L44A 4HX4A 4F5KA 2VMSA 3CCYA 1NHAA 2WK9A 4IZZA 4AIJA 1AHFA 4R79A 2MLGA 1JKQC 2O1BA 1A35A 2L0KA 1Z9CA 2VMPA 4A3IJ 2VLAA 3GZNB 1U8BA 2LKPA 3DKXA 4Z6YA 5FKMA 2A5WA 2V6EA 1KL1A 2C81A 4F5GA 5DD4A 4D9JA 1E3OC 4HDVA 3RKQA 5JI6A 4CICA 5FGMA 5IT9Z 1C7GA 5FLMJ 2TPLA 1YLFA 5KHDA 2PMHA 2GMUA 5FKNA 3CCMI 1XD7A 5TGTA 3BQYA 3LVLB 4RA2A 1GLNA 1FMVA 1OHVA 4AWXB 1RV4A 1UKJA 4JX6A 1V2FA 2CU7A 4JX5A 4BXUA 4KFCA 2HXIA 3BR2A 3WLXA 2PBIA 3CC7I 1SZSA 2KFDA 1TARA 4EU1A 2QB2A 3L2RA 3BJAA 3PIOF 3PFIA 2Q0OA 4XSZF 1AIBA 3S3MA 5FROA 1P7IA 2COBA 1FY7A 3IH2A 1I3AA 4O3MA 3CC4I 5E20A 4B4CA 1BJAA 2HR3A 4D7NA 2ZJRF 5EAVA 4K2EA 5J1YA 2M5WA 1HDDC 4C2UA 1WJAA 1ORKA 3TDUC 3V7CA 3QP5A 4ENNA 4JF1A 5B1AH 1UB9A 4A0ZA 4HRIA 5F0CA 3BB8A 3FVUA 3JWAA 1B8IA 4XJMA 2LREA 3FK6A 1N77A 2DGMA 2DO7A 2VONA 3R61A 3JREA 1RESA 2HVQA 3I4NJ 2XKPA 2E7UA 1TC3C 3C2BA 3CDIA 3ROUA 4A69C 2JJGA 1ZREA 1P9QC 2J5PA 4M3DA 3GR9A 4F93B 2H09A 4GE4A 1D0YA 3R6SA 1BW5A 1ZTRA 2NVYJ 4I01A 1TW3A 2L4AA 2HZPA 2HTSA 2MC4A 4KT5C 1KU7A 3ABTA 2P4WA 5HHYA 1LKCA 2PLYA 4WYFA 1DUXC 1UJ8A 3TW7A 4XN3A 2O6GE 4J5UA 3SZPA 2A5YB 1IN6A 2CJJA 5E79C 4AUXA 4YIIA 4OC9A 2LVSA 2BW3B 3HBLA 3BG6A 2DOEA 3BTJA 4X0GA 1DP7P 3MMYB 2Z61A 5G09A 2M8EA 3LAPA 4MQQA 5JVTA 2L5QA 1ZG3A 2OF7A 4W5KA 5K8BA 2EZLA 4XRSA 1TQIA 4CCJA 2JSCA 4LLNA 3PM1A 4ZDPA 3I9V2 3R4KA 1ETKA 2E5ZA 2UV1A 2OBPA 3OL3A 4M3BA 4RM2A 3J7AO 3ZMZA 1IGNA 4OMZA 1VQ6I 1KQ8A 3DWLE 3FFHA 4UOYA 4B47A 1JKRC 4AYBA 3WGGA 4XK4A 2OV7A 4I99C 2DXIA 4RGRA 3CCVI 1MJBA 4HF2A 2X5DA 2X8UA 2CV0A 2M0CA 2YCNA 1X1PA 1X3ZB 4MEYF 3HOYJ 3L2UA 4WXBA 5EAAA 3GWZA 2D7ZA 5B3SH 3LQQA 3CQZJ 3WTUC 3K4LA 1ASCA 1ETOA 3K4CA 4DBQA 3HTSB 4LC3A 2G6WA 5H20A 1GCKA 1ASBA 4Y0DA 3VYUB 3LVJA 1MAPA 4ZLVA 4HQMA 1LKXA 3D6KA 3HBXA 3CMMA 1AY4A 5DCMB 4P9UA 2YRIA 3MWMA 2HNHA 3LOCA 4UHTA 1CQTA 3CMAI 4BEHB 5FT8A 3ASNH 3JW9A 4UB6C 4A3KJ 4A6EA 2RDPA 4BE0A 2XUBA 2M1BA 1LVKA 1J04A 5D6EA 1GV5A 4HF0A 1DGEA 3BY6A 3DTKA 4UVAA 3BWOA 1RUOA 3N4MA 2BYLA 5LGTA 3P9IA 1WI3A 4OIPF 4ESBA 1O62A 5F27A 4C3HJ 1YHQI 1POGA 5E3LA 3PPLA 2IW5A 3NTJA 5EEHA 4UY8I 1GDEA 4KAMA 5EGOA 4HNUA 3OYAA 2VMOA 2Y2ZA 3FZ6A 3IWZA 1G3SA 2XGCA 4ASNA 4DYCA 5DV5A 2ZJ2A 4HSTA 1BR1A 5HLIA 4J19A 2R4GA 3MQ0A 4QWQA 5CQEA 3X2QH 1QPIA 2YCTA 1HSJA 3ZRRA 2A05A 3HQTA 2OGAA 1LC5A 2R5CA 4BGDA 1IW7F 2X0LA 4ADEA 1YJNI 1UELB 3OYCA 1M0QA 2XBNA 5M5XJ 4AIHA 2W8WA 3LA2A 3HRTA 1OCOH 4NC6A 3O3KA 3FSLA 2ORDA 1Z91A 4E3QA 3HYIA 3C2HA 4DJAA 3WTWC 1JT6A 1YFHA 3PJRA 1W36C 3HPHA 5CKTA 2IT0A 2PB2A 4IF4A 4ZJZA 5DCMA 1OCCH 2DMPA 2RGVA 2VN2A 3MZHA 2Z1YA 1C9CA 2EH6A 1AMSA 2R0QC 3TFUA 1LW4A 2CFOA 5FLXZ 2ZSIB 2EGYA 2XF5A 2VBXA 1MGTA 5I92A 4L0ZB 4HX8A 5IPAA 3LVMA 4RITA 3LL7A 1R5ID 3M7GA 2JA5J 2E7XA 2E54A 3IHUA 4DZPA 1W5CC 1J5YA 5DUIA 3HOTA 3PSIA 2PJRA 4MFEA 4EVIA 1X19A 2XAQA 1QA6A 1OCZH 3BG5A 3N0LA 3VFZA 2HYJA 2M2EA 1YX3A 1QGPA 4B43A 5M46A 1AAWA 3FQAA 2BZTA 5A2QZ 2FUG2 2K85A 4EGYA 2ZJGA 5ED4A 4V2FA 3J7AY 3CO7C 3WTXC 3K40A 4RM3A 2K02A 1YG2A 1R23A 3HUGB 2BXZA 3CCSI 4LG0B 1U5TC 4Q31A 1R6RA 5CYVA 4M72A 3F6TA 3NYSA 4MQPA 1H8AC 1BR2A 4AO9A 2VKEA 4A3JJ 2IAIA 5HNFA 3CCQI 1W7LA 4IOCF 4I6ZA 2DKJA 2EILH 4CVQA 3ELKA 5AIQA 1YITI 1STZA 2HOEA 4R8HA 2Z3YA 5LHIA 3LSGA 3D5SC 1AHDP 4UXNA 1B72B 1FYLA 1B6AA 2VIBA 2XRLA 2BVMA 2VQLA 4ATQA 2MBFA 5J40A 1G59A 2I8DA 1VQ5I 3GTGJ 3ZRPA 3UKGA 2F4OB 1ZN2A 1LNWA 4XORA 2F5EA 4MFDA 1Z7DA 2ME6A 1U3EM 1WJBA 1G4VA 1V2DA 2IS6A 2BY2A 4A0GA 1B4AA 4QTRA 1FSHA 3WX9A 4O5VA 1H89C 4PCQA 3FZVA 1WI9A 3RPQA
chains in the Genus database with same CATH