4TV7A

Crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
460
structure length
431
Chain Sequence
TITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAALPDDLKEIHIWISFSHMDTDHFPIKSWFRCEQKAASRSYMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEDTRRTEQDILSHAAGLQLEIFGMSRFRPALIIGFARLKEEDIQEGVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the aminotransferase domain in Bacillus subtilis GabR, a pyridoxal 5'-phosphate-dependent transcriptional regulator
pubmed doi rcsb
source organism Bacillus subtilis 168
molecule tags Transcription
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 132
structure length 431
sequence length 460
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4tv7A01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4tv7A02
4BNCA 2RV8A 4F4EA 3ISPA 1ZOBA 3COGA 5D8LB 3WGIA 2QBTA 5D95A 1GXQA 3L44A 5EIGB 3T32A 2VMSA 3KP5A 4KIGA 3F8FA 4CYDA 3FXRA 4HAMA 1ZH5A 1R36A 4WCGA 2VI8A 2BIEA 1XD7A 1ELQA 5M46A 2FYFA 2VC0A 2YHKA 1ZARA 4ZSWA 1TOEA 2BKWA 1BKGA 4JF0A 3GEZA 1ZG5A 2QQ9A 4BXUA 3TOBA 1ODDA 1O3TA 3ECOA 2AXLA 3BC8A 3BPXA 3E6GA 4XRFA 1I43A 1M7YA 2FXAA 3D5LA 4GCVA 2W85A 1Z9CA 2AY3A 1F9NA 3QBOA 2LF7A 4XJMA 4OIPF 2DFIA 2WTEA 3F6OA 3CDHA 3UAKA 3NX3A 4N9HA 3ELKA 1AMQA 4XJLA 5E3KA 2Q8KA 2VBXA 1ZREA 2FA5A 2AEUA 4M2MA 5EFSA 5AIQA 1GD9A 1Z7UA 3G3ZA 1OHVA 2Z1YA 2ELHA 2LKPA 4PIWA 1PMMA 1KL1A 5CYVA 1S09A 1PP7U 4Y0DA 3RYRA 4O6ZA 2O0RA 3LWFA 1SD5A 2PB0A 1BJOB 2X5FA 2HOZA 1E5EA 2WK8A 5G2QA 3LFKA 2BEOA 3GETA 8AATA 3HMUA 1HW5A 4HOBA 3II0A 4YFXF 2Z3YA 2W8JA 5DCMA 1DUXC 4BMKA 3LSTA 1REPC 2E1CA 4XQ2A 1D7UA 2W8VA 3BJ6A 2YKYA 4ZAHA 1BI2A 4M6XA 4Z2YA 3W1HA 4OBVA 3JSPA 3KKIA 4L0ZB 4HV5A 3DXJF 1YG2A 6PAXA 2HUFA 2Y75A 1YW7A 1SD6A 4E1OA 1RVUA 3ZMTA 3AEPA 2VMZA 2H6CA 1MDXA 4LNLA 4LFUA 1QBJA 5E18F 4RB1A 2R5CA 5DB5A 2W7EA 2K4BA 2IA1A 1P2FA 3LVJA 1KQ9A 1ZN2A 2QZ8A 2VE9A 4L5IA 1WYTB 1FPQA 3EUHA 2VE8A 4AVPA 2QUFA 5DJ9A 4G7OF 2YRIA 2XVCA 3IL2A 4HVKA 4YG2F 4WK8F 4HF8A 5LRRA 2AY1A 3WGBA 1E2XA 3GZ5A 2A07F 2JJEA 4XBFA 3HOSA 4G94A 1R1UA 1XB4A 1M0NA 3EUCA 3OP7A 1YQAA 3ZMDA 2C0RA 4IHSA 4EMSA 4K2MA 1S7OA 1IN4A 1G6NA 3VK2A 2JSCA 2FEZA 2HZPA 1O7FA 4Q76A 3U9GA 3EETA 5FT4A 3TFUA 1OMIA 1YAAA 2EV0A 3GWZA 4LW2A 4F5FA 4IXOA 4BHCA 1KL2A 3PQJA 3FMSA 4U0YA 5AONA 1QJ3A 4CVQA 3DKWA 3EQLF 2V79A 3L00A 3EI7A 2CQKA 1C7OA 3CUQC 2F2EA 1PP8F 4ZDOA 1KMKA 2W25A 3E6BA 4XLPF 1BC8C 2XUBA 3BWOA 2FMLA 3B46A 3HUGA 2GXGA 4IXAA 1BJAA 3MAJA 4P7YA 1IXCA 1TNSA 1XCVA 4OC9A 2GSAA 4DBCA 2YKVA 3RKWA 2DQRA 3E2ZA 1T98A 4KFCA 1J59A 3TGNA 1JS3A 4P9FA 3F9TA 3MZHA 2CO5A 3LY1A 3SZPA 3HLMA 4Q75A 4LD5A 2W24A 4I09A 3A8UX 3M1EA 1NHAA 5LLQA 2PQ8A 2QLRA 3MKJA 1BM9A 3HRTA 5HOOA 1OYYA 1UKJA 3NEUA 2CJHA 3QP6A 3DP7A 2W8TA 1ASEA 1U3EM 2K7LA 1GXPA 1OHYA 5H6RA 4HLXA 2XAJA 4AD9A 2HUUA 4CGZA 1G4DA 2Y0MA 1BN5A 2HWVA 4CO8A 2X8UA 1T3IA 4ATPA 4S04A 2D64A 4RS8A 2PMUA 1FNNA 3GBXA 2FN6A 4M2KA 1IN8A 3T1BA 5LEKA 2VT3A 1F4KA 3HRUA 2DGKA 3V8KA 4QGRA 3TQNA 3HHHA 1KKPA 1B59A 1QITA 3BN1A 4GYGA 1G7WA 5L3CA 4WYCA 3GFJA 2YR2A 3BY6A 3FQ7A 1J0RA 3MFKA 1QIRA 2COMA 3ATHA 1LW5A 4UUVA 4WXBA 2D1HA 1FG3A 4HX7A 1TQIA 3ZRQA 4ZYHA 4CZZA 1B9NA 1HQCA 4EV0A 3EIAA 2VGWA 2M30A 1WSTA 4OIQF 2P7VB 5FD6A 3K2ZA 1GCKA 3R0AA 1JHHA 3M8FA 2AY7A 2NYXA 4P55A 3QPHA 5CLSA 4LK1F 2ISZA 1IXRC 2FNIA 3ELEA 4NOGA 4EU1A 4A72A 2GIVA 1ONVA 4G8XA 4XK1A 4ZH4F 2FNUA 1Z7DA 2IPQX 1TOIA 4UVBA 3KETA 5JFRA 2ESHA 1HBXG 3BP8A 2VLFA 5LBQA 5D4SA 3GSBA 2P6SA 4KUMA 3BV0A 5G2PA 1B6AA 2W7HA 3DXWA 2E7WA 4IXSA 5K5QA 1ARGA 3I0TA 2DPUA 3WTWC 4MEXF 2YKXA 3KE2A 4KA4A 4I02A 1YJSA 4KIFA 3MQ0A 4YIFA 5BPIA 1O3SA 4UVAA 3P1TA 2VYCA 3CJNA 4MTDA 2NAZA 4WXFA 2P5KA 4OMYA 4ZYDA 3IRQA 1LKCA 3AEMA 3E5QA 4PZJA 4L5JA 5D5SA 1YOOA 3I53A 3FVSA 2DAOA 4Q5SF 3QPTA 2M5WA 2FOKA 2O1BA 3WCNA 1O3QA 3KGXA 2Z1ZA 5LEJA 4EFFA 1BJNA 4E70A 4Y13A 1ZAOA 4OTLA 2XASA 1K79A 1O4SA 1H1CA 2NS0A 2VIAA 1ECXA 1DJ9A 1SMYF 4FT8A 4OYTA 1B1BA 5BMZA 4NQWA 2HZTA 2HOEA 4PFFA 2RVCA 4P3MA 3Q8NA 1BI0A 2P5LC 2DKJA 4IX8A 3I5UA 4ASNA 4LG0A 4ESJA 1VTNC 1BQDA 4HDVA 2BYLA 3REOA 4MGRA 2CB1A 4RAEA 3WTTC 4U7BA 4GDYA 1Z6TA 2ZC0A 3NRVA 3TO6A 1XN7A 1MDMA 2VMXA 5D6EA 3M7GA 4BQ0A 3QP5A 1QGNA 1U5TC 1FSHA 1UU0A 1W5TA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 4EGYA 4LB5A 1J5YA 2DKBA 4LW4A 4JEYA 3JW4A 3G0TA 2JRTA 4UNOA 2KIFA 1BOAA 3WU1B 3RYPA 4R5FA 4HW0A 4OOIA 2DGMA 3CAIA 3TO9A 1ZLJA 3QGUA 1JXSA 4CXQA 3FQ8A 5FFXA 2K02A 3JW9A 2MH2A 1IXSB 1UFMA 1MAQA 3A9YA 3I59B 5EEHA 3K1NA 4R2NA 1QJ5A 4B9BA 5EQCA 3P7NA 1P3WA 4JEWA 4EB7A 3RCHA 4TV7A 4N9IA 5ILUA 2G7UA 1RV4A 1D3YA 1BJ4A 4KT5C 2P4WA 1YNUA 1HSJA 4A0GA 5HDMA 1GEWA 1SFXA 3GXOA 2DO7A 2FBIA 3F6VA 1TOKA 4KMUX 1MDOA 1UU1A 3ZMVA 3I64A 3WE2A 2ORDA 4ZSYA 5F64A 2CG4A 4L9TA 2BWPA 2FQ6A 3TCMA 1S0AA 3ZMSA 5HXXA 1Z3ZA 4U88A 4UV8A 3Q9SA 4L9JA 1X3UA 2VMWA 5D5XB 3A9XA 2TDXA 4GSAA 1J2XA 5DD4A 1M6SA 4TN4A 1OYWA 1FLIA 1LDDA 2HTJA 1B8GA 1ASGA 1SZUA 1FY7A 3VP6A 1HW2A 1FBUA 4N0BA 1S06A 1DPRA 3ROUA 4Q48A 2HUIA 3TQXA 4ETSA 2W7GA 4ZM4A 1GBNA 5JAYA 2G6WA 2W7FA 1ASLA 1USSA 3T0YA 1MZBA 3G73A 3N5MA 2DOUA 1MGTA 5IT9Z 3PAAA 3ZP5A 1UU2A 3ZZJA 1C0WA 3C18A 3DXVA 1R7JA 2LNBA 5M49A 3HOTA 1T39A 3MCZA 2YSRA 4KIBA 1AJRA 3GZDC 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 4G7HF 2HS5A 2JJGA 4HBLA 4MNUA 3UE8A 2CYYA 1P6RA 1RZ4A 3R4KA 4A6TA 1QO0D 4WP0A 1CF7A 2L02A 2UWMA 4RITA 1CF7B 3CO7C 4AWXB 2E54A 1PG8A 3BDDA 2CW0F 3NU8A 3JSOA 1LVAA 1TATA 3F72A 4EM1A 2HR3A 1P4WA 3GFIA 3FD0A 4EJUA 2ZMEB 1TLHB 1KU7A 2E7XA 1CZEA 3AEJC 7AATA 2QWWA 4G9YA 3DR7A 2CSTA 1I48A 4I2OA 3JU7A 3I16A 2IW5A 1ARHA 2VMOA 2W7MA 2O03A 1C9CA 2PMHA 3E77A 4OBUA 2W7JA 3LQRA 4AIKA 1KU9A 3BWNC 4GGGA 1TQMA 1B4AA 3GZ6A 3Q5FA 3RIRA 1WKGA 2R7FA 3MZYA 1AMAA 5FFZA 1YYVA 2JPCA 4LLNA 1YIOA 1UB9A 3KP4A 2V1DA 3AEJA 1I27A 1AIAA 1V2DA 1RIOH 2A3SA 1G3SA 2O6GE 4W1WA 2VMUA 3TO7A 5E1WA 2HEOA 5FD5A 5TF5A 3DU4A 2L4MA 3Q9VA 3IC7A 3AAFA 5L3BA 4GE9A 3MAFB 5F8VA 2OA4A 1J9IA 3RJPA 3FM5A 3PD6B 2ZCWA 3GYHX 5DCFA 5KVRA 2O7CA 2GQNA 1KMJA 3O3KA 2W7KA 4GRXA 4Q6RA 2JTVA 3NUIA 2GMSA 4P9UA 2HQRA 5LHAA 1MGVA 4E3RA 2G7HA 4PGGA 4UHTA 2H94A 4EQQA 4JF1A 3QOPA 2VMRA 2A68F 1DJEA 3OOPA 1ON1A 2Q2EA 3I71A 3B8XA 3WTZA 4CXRA 4LGWA 1L3LA 4F5GA 1ASMA 5L3FA 3FDBA 4AZJA 3KEQA 2AY5A 2CJGA 3RQ1A 2ZFWA 3V4GA 3QM2A 1BJWA 1IUYA 1EH6A 1W23A 2D65A 3H14A 4PDKA 3RCHB 3SHFA 1H9GA 1W7NA 2VI9A 3VFZA 1UHWA 3VB2A 4M72A 5HVQC 1R1VA 2XROA 4KNYA 4A2UA 3ZMUA 2VIBA 4JBAA 4RAYA 3G7QA 1BW0A 1CQ7A 2ZYJA 1X0MA 3H3UA 3HSEA 1LQ1A 2L4AA 3T8TA 3QN6A 1D8JA 1LB2A 3QI6A 4IYOA 4M6YA 2MLGA 2WWYA 4RKCA 4XJOA 3I54A 3HHGA 2VBZA 2WKAA 2NMPA 1TPLA 3FZ8A 4HF1A 4CBSA 3QRFF 1XDSA 3TDZC 3EI8A 5JR3A 1KA8A 4NHJA 2KIUA 5M4BA 1ZODA 1M32A 3TOAA 1XSVA 2NNYA 2VOOA 4UHOA 2W8WA 4ENMA 1AY8A 4R79A 1SD7A 4F5LA 1LW4A 2ZXJA 3WTUC 3F3XA 3KZZA 3GFLA 4MHGA 1R23A 4A5NA 1WI9A 4Q31A 1SFFA 4QWQA 3GF2A 2STTA 4I98B 4UVCA 4EM2A 3FM3A 5E8IA 1V2EA 2DQLA 5JHUA 1IN6A 3HQTA 2YU3A 1UCRA 2M45A 1JGSA 4L18B 1ZG1A 1IBJA 3KP2A 5L3DA 3LV2A 2P7CB 4WB0A 5ICFA 2EZ1A 5JVTA 2MA3A 1YJZA 5FGMA 4QLCU 1Z91A 1IX6A 3KP3A 1MKMA 1B5PA 1ASDA 5ILVA 1ELUA 3JAMK 2EV6A 4MTEA 3LQQA 1W7PA 2L01A 4U1TA 2JZYA 2BYVE 4HDUA 3LVMA 4MKKA 1KYWA 4CICA 2P5VA 4FX4A 3HBXA 4E77A 1ZYRF 1J75A 1ZHFA 5DUIA 1GDEA 2BIAA 4EGZA 5D5VB 3AENA 2FF4A 1GEYA 3KP7A 2OQGA 3C1DA 4R5ZA 5ERIA 3V7RA 4A6RA 1N2TA 5DEQA 4DQ2A 1K7AA 3RI4A 5E17F 2A61A 1AWCA 5AX8A 5E1ZB 1CJ0A 4HZFA 1W3UA 3PDBA 4LLLA 4FL0A 1JG8A 4L9VA 2EFWA 2IRFG 2CANA 2HGCA 1I1SA 1V4RA 5EEGA 3I5TA 2RN7A 3E6MA 1S29A 1HKTA 5ICCA 1CQ6A 2O0YA 3N97A 1RNLA 4CHUA 1K78B 2MBFA 1M0OA 2F5FA 5G09A 2FMYA 1LC7A 1XI9A 3IKTA 1JS6A 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 1G4XA 4WXDA 3IRRA 3GR9A 4N0WA 3MADA 4B09A 1P4AA 5L3GA 1ASBA 3WGGA 4A5MA 5CVVA 3AV7A 1L0OC 2HOYA 4L9NA 4CBRA 2O61A 1IN5A 2BWNA 4RB0A 5E5IA 3SZTA 1FYKA 3WGCA 1SD4A 3LAJA 4A0YA 4M73A 5FB2A 2QA3A 3VAXA 2OZ6A 1B9HA 4EVIA 3WTSC 2DGLA 4ITXA 4ZZLA 2AATA 2BHXA 3W6KB 1X28A 4HX8A 3FVXA 1M0QA 3HSFA 1G3YA 3E5XA 3GWPA 3K7YA 4FHTA 3CQ4A 4IVNA 4RB3C 1S7AA 3EI9A 2MLKA 2EFNA 4A0XA 2EFOA 2EPJA 3EZ1A 1IAXA 2V1PA 2QQAA 3F21A 4ADCA 2FE3A 3L09A 5HS9A 2EB7A 2HFHA 3C7JA 5C6UA 5HDKA 4YIIA 4M71A 3HT4A 2V1UA 1C0NA 1MDMB 2X5DA 2G9WA 4BHBA 3FZ6A 1BQAA 1WQ2A 1T38A 4IRIA 1EQBA 2AEVA 2XV4S 1I29A 4UV9A 2BI3A 1E5FA 2OD5A 1LNWA 1Z05A 2Z5UA 3L8AA 1S6LA 2MD5A 3BWGA 2W7IA 2XAFA 1YS7A 4BYYA 1AHEA 3IWZA 3E6CC 4ITGA 2XAHA 2D7ZA 4WXCA 3JTGA 2W7DA 2VMPA 3FVUA 1EH7A 3WU0A 2A5YB 2STWA 1WKMA 1YTYA 4W5KA 5H6QA 3RTRA 1D5VA 3N0LA 5HLGA 2QQBA 1O3RA 1AX4A 3NYSA 3FMQA 1U5TA 3BPVA 1USTA 4YFNF 1BBYA 3RPQA 2M1BA 2LSOA 3P9IA 1ASAA 2KJBA 3CTAA 2PI0A 2EH6A 1M4NA 3GW2A 5EUDA 2VODA 1AHFA 5EUEA 3NNKA 2QLZA 5LGNA 1AY4A 4F5HA 2VMQA 1AOYA 3FQAA 1FP1D 2VGTA 4ZWVA 4JEVA 2D2WA 2K4JA 1PFFA 2PG4A 3DR4A 2OKKA 2ZJ2A 2EGYA 1YO5C 4ADDA 1IW7F 2XRNA 5ICEA 3WX9A 2F5DA 5EAVA 2R7DA 5D8KB 4ESFA 4JE5A 1O61A 1R58A 3ZZKA 2MH9A 1RVYA 4L0OA 3CUQB 3WTXC 3NYUA 4R8DA 3GX4X 5LHGA 3I58A 4IF4A 3CBFA 3F0HA 2GA1A 3ZRPA 1FC4A 1O7LA 3K69A 3KCCA 5LGTA 3K0LA 4S05A 1DGDA 2D66A 4MKJA 5K8BA 2DW4A 1WYVA 2VGSA 2DU9A 4DNCA 4G6QA 1DJUA 1K6OA 3NYTA 5LHHA 1IVRA 2OBPA 1R5GA 2XIGA 2L54A 5CVJA 3MEXA 4LB6B 2L3DA 4IXZA 2ZSMA 4BH9A 4M9XA 4BAYA 4RGXA 4RGSA 3LVKA 3DQVC 2JPBA 1Y4IA 5DDGA 1LDKB 1FSEA 4MEYF 4PGHA 1D2FA 4ATQA 2VLHA 1QISA 4CXFA 2HYGD 3ZN1A 4HQMA 1S08A 1AIBA 3ISLA 1B5OA 1AMRA 2DI3A 1DFOA 4JE5D 1ZG3A 2EFQA 2C44A 1KYZA 3FX3A 3IKVA 4KYWA 2JG2A 2E7JA 3B73A 1MLYA 1FWZA 3LWSA 4GXOA 3F8MA 4XLNF 1KGSA 3BCXA 5HLIA 2W84A 2ACJA 4O3MA 3WODF 1MLZA 1OHWA 1IX8A 3CLOA 2FQ3A 1WYUB 3EIBA 5FT8A 5DX5A 3F8NA 1WYUA 2EO5A 1EG5A 1JHFA 1W7LA 2HYFA 1BT4A 4JEZA 3SQNA 3PIUA 3BROA 4LC3A 3HL2A 1WSUA 3ERED 4Q47A 2EFPA 2F5CA 1I41A 3C3WA 1ASCA 2ZKZA 2Z9OA 4KXKA 3I59A 3K1PA 1ARIA 4UHMA 1AHXA 2PBIA 3IWFA 4ZDPA 4OCAA 2QB2A 3PJ0A 1U6GA 4K2EA 3K9TA 2DPDA 3DV8A 1B4XA 4IRHA 4Q4ZF 1DDNA 1HXDA 1XDUA 3EZSA 1IUGA 2KKOA 4M74A 5EAAA 2YOBA 2ZNYA 2EWNA 3MC6A 4KMFA 3TATA 2YCNA 1YW9A 3LA2A 1QZZA 3D0SA 4J5UA 2RQPA 3E2ZB 1ARSA 3F22A 1TOJA 2RNJA 3P9CA 4RAZA 3NRAA 4ZWMA 3WE3A 2OGAA 4HX4A 3OKSA 1TW3A 3R4TA 5ILSA 1AMSA 5D5WB 2K27A 1HW1A 5DV5A 4W1VA 2VXZA 1OATA 2AY4A 2WV0A 1H0MA 1F5TA 2VGVA 4M9ZA 5A2QK 3V7SA 2XKOA 3K40A 2Z33A 1DKAA 1BJOA 1GC0A 3H92A 2CJDA 4RGRA 1ASNA 2JJFA 2Z9XA 2BWOA 1AHYA 1Z6RA 1I1GA 3CO6C 4R8HA 5D5UB 5IT3A 1BI1A 1H0CA 3VODA 1KU3A 4A0HA 3HVYA 4UOYA 1CGPA 2XHKA 1ZRDA 1YW8A 4HA8A 4K2BA 2PJPA 2D61A 1V3FA 2IT0A 4ENJA 2H6BA 1FG7A 2AS5F 2QVOA 5D4RA 2VGZA 3B1DA 2PEXA 2JJHA 1Y0UA 3PPLA 4WXGA 1AKAA 2AY9A 1YJYA 1D7SA 3KLOA 3JTXA 4MQVA 4XAUA 3V7CA 4WXHA 2YX4A 2HTSA 4LNJA 4RB2C 3GLXA 3ECHA 4WF2A 2JISA 2ZJGA 2ISYA 2BBYA 2QB3A 2RFVA 2BIGA 1QNTA 2AY8A 3R0JA 4RIZA 1ZLKA 2PB2A 2OATA 4XSXF 2KRFA 1TNTA 3V8LA 5LH9A 5BJ4A 4M9SA 2DR1A 1MJ9A 3DFGA 1T0FA 3RKXA 3HYIA 2UZKA 4WWCA 3FKDA 3NQOA 1FX7A 3L9FA 1ZC9A 4U7DA 3EYIA 3GZCA 1U8RA 3ABUA 4RKDA 1YIYA 4GO1A 1S8NA 3A2BA 3HTSB 1J7KA 2P8TA 4ON0A 1JF9A 1WYTA 1TQPA 1BS0A 2TPLA 1YFHA 2JT1A 1B9IA 3N4MA 1STZA 3K1MA 3FXQA 3W6JB 3D6KA 1MJBA 2GA2A 3V8JA 2VT2A 2X0LA 2FM1A 4JEXA 4I0AA 2ZO4A 1QPMA 1DTYA 3L2CA 4AH3A 3VOMA 3PGYA 1IF1A 1C7GA 1MJAA 4EJVA 1TBXA 1M0PA 3OV8A 4LK0F 4Y0IA 5DYMA 4A6EA 4BA4A 2RDPA 2Z99A 3ML6A 1A04A 2EV5A 5F6FA 3ZPLA 2CFXA 2FBKA 2XGXA 1D7RA 2FU4A 3F6TA 1XEYA 3FFRA 4OT8A 4Y0HA 2DLLA 1PDNC 2EJRA 1E17A 2CSOA 4I8AA 2HKXA 4OIRF 1P4XA 5IWQA 3U1DA 1TW2A 2H09A 4A6DA 1SZKA 3G8MA 5ED4A 1WKHA 3T5XA 4J8LA 5HDNA 4AO9A 2F8JA 4B98A 3RPUA 3BB8A 4WLJA 2KJCA 5J8CA 1UHMA 1AHGA 3LVLB 4AO4A 2CH1A 1N31A 3QAHA 1PUEE 1FOKA 3CUOA 1W5SA 3GUDA 4JK1X 4ZZDA 4ADEA 2V9VA 3E6DA 1ZGAA 4XSZF 3LA7A 4A12A 1G4VA 3BCAA 4F5KA 1IN7A 4FFCA 3WG9A 4A00A 1EH8A 5EIGA 2A69F 1AY5A 3WZFA 4WYFA 3NDNA 3P9KA 4ZDLA 3BJAA 4A0RA 2Z61A 4WD2A 2YPRA 3DEUA 3H3ZA 4A6UA 2IA0A 3HSRA 2W7LA 2PN6A 3LAPA 4ISYA 1OXPA 4EJOA 1KKJA 2RKHA 1FC3A 4AZKA 1GEXA 1S3JA 5JI6A 1I6XA 4H0EA 2WC2A 4E3QA 4F5IA 3FCRA 2W8UA 2VMNA 3DZZA 2VGUA 2H27A 2ZNZA 1RUOA 1QZ9A 2ETHA 3ASBA 5LGUA 3W1JA 2DK5A 4ZYGA 1U5TB 1DP7P 1OR7A 4B8XA 2XAQA 2KIMA 2IA2A 3E97A 2YCPA 1AKCA 3CUQA 5K5RA 4ADBA 1IZ1A 3EI5A 5BJ3A 4FX0A 5E1XA 3WKRA 1XGMA 4DQ6A 1GVJA 2IJLA 5AIPA 2ZBKA 4WYEA 3R60A 2YKUA 4ZM3A 2Z9WA 1O69A 4MQ9F 5E20A 4I01A 1LK9A 3HDOA 2W57A 4O6JA 3DRDA 1WYVB 3COAC 2VONA 1IRFA 5IT9K 3MAUA 1SF2A 1ULYA 3ABTA 2DTRA 4GYIA 4IPAA 5LRSA 2PO3A 3PDBB 2HDCA 3RBLA 4ESBA 1G7XA 1ZRCA 3E2FA 2CY8A 4OIOF 5CJ9A 5DCMB 2UXXA 2NNNA 4XEWA 2FRHA 2RGVA 3RKYA 4UHNA 2P6TA 2V0YA 5BOXA 1W7PB 4O5VA 3P6KA 1HKQA 3SFZA 4ZYEA 1CL2A 1TOGA 2D5YA 3NTJA 4LLGF 1LC5A 1VP4A 3NU7A 4AOAA 1K78A 1AKBA 3GZDA 4P5OA 4HF0A 2VN2A 3KGWA 4R1HA 1SPAA 3BZ6A 2YX7A 3FHZA 1QGPA 5K1YA 3AOVA 3QHXA 1OKRA 4AIHA 2EK5A 1R00A 1BC7C 2VC1A 2J5OA 4ZLVA 5FLXK 4KICA 1BIAA 1AICA 1BIBA 2HOXA 2EA4A 1FT9A 4RJ0A 1S07A 3U2RA 1N8PA 1G3WA 3FTBA 2CFBA 1IJIA 2E7IA 3A9ZA 3ZMZA 1FBQA 4D0PA 4OMAA 3VK4A 4U0WA 2Q7WA 3M5UA 1VJOA 4W91A 2QBYA 5E4ZA 3BWNA 1KQ0A 5J6XA 4BA5A 3N75A 1CQ8A 5DJ1A 5FO5A 5DD8A 1R22A 2VBWA 2QMAA 2Z9VA 3EI6A 3FZVA 3H7FA 1I5ZA 2ZMEA 3ACZA 2IP2A 2R5CB 2V6CA 3QU6A 1C7NA 1P92A 1AAMA 3ULQB 1V72A 4KYOA 3FXUA 1J04A 1MAPA 1T6SA 4Y17A 2RC4A 3WY7A 1F1ZA 1SFEA 5ICGA 4W1XA 1D8KA 4DGTA 2OKJA 1CL1A 4WBTA 2GZWA 5CVRA 1EV7A 4MQRA 3BJOA 5FT5A 3MBBA 4U2HA 3DYDA 3K28A 1FBSA 2ADUA 3B02A 5FLXZ 3R6SA 3HRMA 2IVMA 1RUNA 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 3WLXA 1W4MA 3JTHA 2CH2A 4LG0B 2JGTA 3E9KA 4UQVA 3EYYA 4Y15A 2D45A 1T2KA 4EB5A 5HHYA 3UWCA 3O2PE 3FFHA 2GB3A 1XSDA 4IW7A 2DT5A 3ELPA 2B0LA 3RUYA 3FRKA 5HLHA 1OYIA 2AY6A 5E8GA 2C81A 1GC4A 4UXNA 2BI9A 2VBYA 1EJIA 3J7AO 1SMTA 1DPUA 2DBBA 3F8CA 3T8RA 4OINF 4EJWA 3KE3A 2OU2A 4LJZF 4HLYA 3B1EA 1R5HA 3DF8A 4ENNA 5TJJA 3GJUA 3J80K 3NUBA 3M9AA 1ZGJA 4W8IA 3BOQA 4OMZA 3WKSA 3VOEA 4H51A 2BV6A 4MQPA 3RI6A 1RV3A 4ENKA 2ZSLA 1QQIA 1H9TA 2PFBA 3ZRRA 4MY5A 3MEBA 2X4HA 1X2AA 3WTYC 1XCBA 4U0VA 4F5JA 2XBNA 1XGNA 3ASAA 5BPDA 2F5EA 3KFWX 1ASFA 3R9AA 5CVUA 1AAWA 2VMVA 1DGEA 4IJAA 4M2JA 1IAYA 2D1VA 4YFKF 1W7MA 2BE5F 3AEMC 4I0BA 1LDJA 4HF2A 1Q1HA 4RM1A 2PLYA 2XAGA 5I92A 2D63A 4IYOB 3TKYA 5HS8A 2K86A 4WLHA 1TTYA 1AJSB 2NRAC 4WYAA 1U78A 5F1RA 4RJYA 4NB5A 1MD0A 1MDZA 1YS6A 4RGUA 3O6BB 1J32A 4EJTA 1CS1A 2FSWA 3PDXA 3FMRA 2A6EF 4JQFA 5KK1A 2HORA 3LG0A 3WCOA 5F9SA 2CGPA 3B1CA 1HSTA 2GMUA 3HTUA 3USFA 4PCQA 5A2QZ 2Z9UA 5K5OA 2ZP7A 1ORDA 2Y48A 4KAMA 4F5MA 3QU3A 3LA3A 1PMOA 4MQQA 5J8FA 2R0TA 2OZUA 3AENB 1W7PD 5DUKA 3AOWA 1IAWA 2ESNA 5HS7A 4K2IA 3VEPA 2HP1A 4WB0B 1Z1DA 1IRGA 2R3SA 3IHJA 4OU0A 4ZASA 1V2FA 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 2WK7A 4BHPA 5EUNA 1U2WA 2VOPA 3E5UA 4IY7A 3JWBA 2CTZA 2LDUA 1OPCA 4LMYA 3AATA 3DPLC 1ON2A 4TMRA 1GC2A 1SAXA 2J5PA 1LEBA 9AATA 2D7YA 2O8XA 2HQNA 2V1XA 1LC8A 1FP2A 1C4KA 1JE8A 4G6DA 3MWMA 3F8BA 5D6FA 3BS8A 1XGOA 3JAMZ 2OQRA 3ECDA 3MC6C 1SVVA 2R2NA 4BQAA 5TRDA 3VK3A 2X3LA 2QENA 1O57A 2XKPA 1WWXA 1YLFA 2A6HF 1FYLA 4LNMA 4XJPA 3GO5A 3I4PA 3PD6A 2CINA 1LJ9A 5BS6A 3FSLA 3HRSA 5HDGA 3SXYA 3J81Z 3DC1A 3J80Z 1XGSA 2GAUA 5L3EA 2R5EA 4PFNA 4EM0B 3TFTA 4GE7A 2C6YA 2C7TA 2MC3A 4WYDA 2UXNA 2YRRA 5BQTA 2FNAA 3KZYA 2GWRA 5FT6A 3IHUA 3KLNA 1TASA 4MSOA 4G7ZF 3AEOA 2CWEA 4P96A 3RDIA 2Z20A 2M8EA 2O3FA 1CZCA 2XH1A 3I4JA 3F23A 3FZ7A 3IF2A 3RBFA 1GHCA 1X29A 1BI3A 1XMAA 4IRGA 1LEAA 1LS3A 3DODA 2AY2A 5G0AA 2BI5A 4WYGA 3FWEA 1ZRFA 2EZ2A 2M87A 2HKOA 2VMYA 5H20A 1VEFA 2Z67A 2VMTA 3DPTA 2EA2A 1IX7A 2E1NA 5M4DA 3R61A 2QBYB 1WRJA 3E2YA 5G4IA 1R1TA 4RLGA 3M8EA 2WK9A 2LF8A 3FF5A 3AELA 2BI2A 4HYEA 1QZYA 4BHDA 3TDUC 5J8QA 4EMYA 2GQQA 3CQ5A 2OQXA 1AJSA 1YIZA 4A0ZA 4GEBA 3MAFA 2QYOA 1D7VA 1XMKA 1O62A 4IHTA 1XSXA 3WTVC 1OXOA 2YCTA 3ZN0A 4A0FA 1GC3A 3PA9A 1TARA 3JZLA 1SZSA 3HIFA 3EDPA 2HP2A 2BI1A 3CQ6A 3JWAA 2OAZA 3PQKA 2ZUKA 1RI7A 2OGEA 3W1IA 4KN4X 4PVFA 1G3TA 3KEOA 3WGHA 4HQEA 3GVAA 5G4JA 4KDPA 3QPGA 3ZQ7A 2BYJA 3BCBA 4KN7X 1ARTA 4GE4A 4L0YB 1FZPB 3KP6A 1U08A 2E7UA 4F7ZA 2BGCA
chains in the Genus database with same CATH superfamily
3JRFA 4BNCA 2L7MP 1ETWA 2RV8A 4C2TA 1BR4A 4F4EA 3ISPA 1R5ID 1ZOBA 5GPCA 3COGA 2X1CA 5D8LB 3WGIA 4D7NA 2QBTA 5D95A 5LD2C 1GXQA 4HEA2 3L44A 5GAEJ 4OAZA 3I56I 5EIGB 3T32A 2EIJH 3ASNH 2VMSA 2XGCA 3KP5A 4KIGA 3F8FA 4CYDA 2XF5A 4G12A 3FXRA 4HAMA 1ZH5A 3IUOA 1R36A 3ZRGA 4WCGA 2VI8A 3A0BC 3S3MA 1XD7A 2BIEA 2K9QA 3TEDA 1ELQA 5M46A 5EGOB 2FYFA 2VC0A 2YHKA 1ZARA 3QQAA 4ZSWA 2XGDA 1TOEA 2BKWA 1BKGA 4A93J 4JF0A 4LIVA 3GEZA 1ZG5A 2QQ9A 3QYEA 4BXUA 2HI3A 1ODDA 3TOBA 1O3TA 1MSEC 1OLTA 5E3MA 3S1MJ 3ECOA 2AXLA 3BC8A 3BPXA 3E6GA 4XRFA 1I43A 2VIXA 4NBQA 1Y8RB 1M7YA 3GTJJ 3DWLE 2FXAA 3D5LA 4GCVA 2W85A 2X1EA 4GRIA 5EG0A 1Z9CA 2AY3A 2FJ1A 3BQYA 1F9NA 3QBOA 2LF7A 4XJMA 2E2JJ 3OR2C 4Z6YA 1DGWY 4ADCA 4OIPF 2DFIA 2WTEA 3JRIA 1E3HA 3F6OA 3CDHA 3UAKA 2E1OA 3NX3A 4N9HA 3ELKA 3HOYJ 1AMQA 4XJLA 5E3KA 2Q8KA 2VBXA 2XB5A 2X6XA 1ZREA 2FA5A 2AEUA 4M2MA 2KIQA 5EFSA 5AIQA 5FKKA 1GD9A 5CKTA 1Z7UA 3G3ZA 3I3LA 3G2BA 1OHVA 2Z1YA 1T95A 2ELHA 2LKPA 3L2WA 4PIWA 1PMMA 1KL1A 5CYVA 3CC2I 4RA2A 1S09A 1PP7U 1NH3A 4Y0DA 4NUBA 3RYRA 3RBLA 4O6ZA 1DP3A 2O0RA 3LWFA 1SD5A 5DS9A 2PB0A 1BJOB 2X5FA 3I4NJ 2HOZA 1E5EA 2WK8A 5G2QA 3LFKA 2BEOA 4YIRX 3GETA 4PJJA 8AATA 5HNHA 3KPHA 2R7WA 3HMUA 1HW5A 4HOBA 5CQEA 4RLFA 3II0A 1RR8C 4DBRA 4YFXF 1QHHD 2Z3YA 2W8JA 5DCMA 3TW7A 1DUXC 4BMKA 1E3PA 3LSTA 2ELKA 2M7BA 1REPC 4A3KJ 2E1CA 1D7UA 4XQ2A 2RQQA 1X3WB 4OWRB 1A6QA 2W8VA 3BJ6A 3V42A 2YKYA 4PK4A 4ZAHA 2BW3A 1BI2A 2QCOA 2WAQN 2DYSH 4M6XA 5J40A 4Z2YA 3TBIA 1JI8A 4BQNA 4OBVA 3JSPA 3DBRB 3KKIA 4L0ZB 3W1HA 4HV5A 3DXJF 1YG2A 2Z2SB 3PJRA 6PAXA 2HUFA 2Y75A 1YW7A 1SD6A 4E1OA 2E5ZA 1RVUA 3ZMTA 3AEPA 3A4CA 2H6CA 1MDXA 2X85A 3K4BA 2VMZA 4LNLA 4LFUA 1QBJA 1GDTA 2XPWA 5E18F 4RB1A 4RM3A 2R5CA 1ETQA 2OCEA 3FXJA 2CV2A 3OS0A 5DB5A 2W7EA 2K4BA 2M2EA 2QEXI 2IA1A 1P2FA 3LVJA 1KQ9A 1ZN2A 3JRAA 2QZ8A 1ZQ3P 2VE9A 2R7XA 4L5IA 1WYTB 1FPQA 3EUHA 2VE8A 4AVPA 2QUFA 3AG4H 5DJ9A 4G7OF 2ID3A 2YRIA 2XVCA 3BR0A 4II2A 1X2NA 2FUG2 4BKXA 3IL2A 4HVKA 3CMAI 4YG2F 4WK8F 4HF8A 5LRRA 2AY1A 3WGBA 1E2XA 3GZ5A 2A07F 1VQ7I 4XBFA 3HOSA 2JJEA 4G94A 1W5CC 4F52A 1R1UA 1XB4A 4NC7A 1M0NA 3EUCA 3OP7A 1YQAA 2DYRH 3ZMDA 2C0RA 2M3AA 4IHSA 2V9PA 2QSHX 4EMSA 3S1NJ 4K2MA 3K2AA 4BACA 1S7OA 3HPGA 1IN4A 1G6NA 3VK2A 2JSCA 4DYCA 2FEZA 1Z3XA 1FTTA 1O7FA 2KRHA 5F1JA 2HZPA 2KQRA 4Q76A 3U9GA 2XDVA 5F27A 3EETA 5FT4A 1HA8A 3I4MJ 3GMEA 5TISC 3ZQCA 3TFUA 1OMIA 3DEWA 3JREA 1YAAA 2EV0A 3CJTB 3GWZA 4LW2A 3AL0C 4F5FA 4IXOA 4BHCA 2ZJRF 1KL2A 3PQJA 3RQIA 1W1WE 3FMSA 3W2WA 3AL0B 4U0YA 5AONA 4UUSA 1QJ3A 4CVQA 3DKWA 3EQLF 2M0MA 2V79A 3L00A 3EI7A 2CQKA 4RBOA 2XGEA 5J4YA 1C7OA 3Q0VA 3CUQC 2F2EA 1PP8F 4ZDOA 1YX5A 2DFFA 2W25A 3E6BA 4XLPF 1KMKA 1BC8C 2XUBA 2KL4A 3BWOA 2FMLA 4IZZA 3B46A 3HUGA 4B4CA 1BOBA 1YRNA 2GXGA 4IXAA 3JR9A 3JRHA 1BJAA 2ECCA 3MAJA 4GDFA 1IXCA 1TNSA 1XCVA 4P7YA 4OC9A 2GSAA 1QA6A 4DBCA 2LBFA 2YKVA 3RKWA 1B72B 1D0XA 2DQRA 3E2ZA 4IX7A 1T98A 4KFCA 1J59A 3TGNA 1JS3A 1S7EA 3BG7A 4P9FA 3F9TA 3MZHA 4LITA 3PFYA 2BHZA 2WAQA 1GUUA 2CO5A 2GXAA 3LY1A 3SZPA 4E7LA 4A3MJ 3HLMA 2HPMA 1WJEA 2VPRA 4Q75A 4LD5A 2W24A 4I09A 3A8UX 3M1EA 1NHAA 1Z0XA 5LLQA 3DKXA 5JVGF 2PQ8A 4GFBA 1BA5A 1BW5A 2QLRA 3MKJA 1BM9A 2HZDA 3HRTA 5HOOA 1OYYA 2K3FA 1UKJA 3NEUA 2CJHA 3QP6A 3OYGA 3DP7A 2W8TA 1FIPA 1ASEA 2LYCA 1U3EM 2K7LA 3ASOH 1YJNI 1GXPA 1OHYA 1POGA 5H6RA 4HLXA 2XAJA 4AD9A 2HUUA 4CGZA 1G4DA 2CRGA 5DTDA 1ZTRA 2Y0MA 2CUJA 3DTKA 1BN5A 2HWVA 4MFDA 4CO8A 3OYKA 2X8UA 2L7KA 1T3IA 4S04A 4ATPA 2D64A 4RS8A 3BR1A 3ZCOA 2LREA 2PMUA 1FNNA 2UUZA 4EATA 3GBXA 2FN6A 2ZJQF 4M2KA 4HPQA 1IN8A 3T1BA 5LEKA 2VT3A 3BZCA 1F4KA 1K6YA 5IP9J 4XLFA 3HRUA 2M4GA 2DGKA 2PMZA 2EH3A 4JYKA 3V8KA 4QGRA 3TQNA 3CC7I 3HHHA 1KKPA 1B59A 1PUFA 1QITA 3BN1A 4GYGA 4HNUA 1G7WA 3H5RA 5L3CA 2ME6A 2E34A 4WYCA 3GFJA 2ZXHA 3BZKA 3BG5A 1J09A 2YR2A 3AG2H 3BY6A 3FQ7A 4UB6C 3GTOJ 1J0RA 3MFKA 1QIRA 2JRMA 2KISA 2COMA 3ATHA 1LW5A 4PSXA 1VQ5I 2CV0A 4UUVA 4WXBA 2LH9A 2BGCA 5HODA 1IRXA 2D1HA 1HLVA 2L7FP 1BW6A 1ZR2A 1FG3A 4HX7A 1FOYA 4DYQA 2N8GA 2VJIA 2XSJC 5IYDJ 1TQIA 2XF6A 1V5GA 3ZRQA 4CZZA 4ZYHA 1B9NA 1HQCA 4EV0A 3M4OJ 2VGWA 2M30A 3EIAA 3HBLA 1MBJA 4AU7A 1OCRH 1YE9A 3MKYB 1WSTA 4OIQF 4BJ5C 2P7VB 5FD6A 3K2ZA 1GCKA 3R0AA 1JHHA 1I3QJ 1GV2A 4BE2A 3M8FA 4XMYA 2AY7A 2NYXA 2CW7A 4P55A 2IS1A 5E3NA 3E0JB 3QPHA 5CLSA 4LK1F 2ISZA 1IXRC 2FNIA 3ELEA 4NOGA 4EU1A 4A72A 2GIVA 1ONVA 2JUGA 4G8XA 3DLAA 4BEHA 4XK1A 4B3AA 4ZH4F 2FNUA 1Z7DA 5J1RA 3LSRA 2VI6A 2IPQX 1TOIA 1MH3A 3GTQJ 4UVBA 3KETA 5JFRA 2ESHA 1HBXG 3BP8A 2VLFA 3HOVJ 5M5XJ 5LBQA 5D4SA 3GSBA 2P6SA 1E0EA 4KUMA 3G71I 3BV0A 1XG1A 5G2PA 1B6AA 2W7HA 3DXWA 2AQFA 2E7WA 2KRCA 4IXSA 5K5QA 1ARGA 2KLOA 3I0TA 4CA0A 2DPUA 2H8RA 3WTWC 4MEXF 2YKXA 3KE2A 1WGXA 5F04A 2A5WA 4I02A 2EZIA 5EF6A 4E6KG 4KA4A 1YJWI 1YJSA 4KIFA 1MNEA 3MQ0A 4YIFA 5BPIA 1O3SA 2VJ5A 2A6TA 4UVAA 2ICWG 3P1TA 2VYCA 1JTXA 5K7ZA 1WJCA 4FE7A 3RPUD 3OWTA 5GAGJ 5HLTA 3QYBA 5IYBJ 1S5LC 3CJNA 3O8HA 4MTDA 2NAZA 4WXFA 2P5KA 4FISA 4OMYA 4XONA 4XOPA 4ZYDA 3IRQA 1TWAJ 4FASD 1LKCA 4C3IJ 3AEMA 1ENHA 3E5QA 4A3DJ 2DA6A 4PZJA 4L5JA 1Y8QB 5D5SA 1YOOA 4MIMA 3I53A 2DN0A 3FVSA 2DAOA 2R7UA 1B72A 4QPQA 3HG9A 3QPTA 4Q5SF 3CCRI 2M5WA 2FOKA 2O1BA 1ITYA 3WCNA 5EDNA 1O3QA 3KGXA 2R5ZB 5LEJA 3CP8A 2Z1ZA 4EFFA 1BJNA 4E70A 4Y13A 1ZAOA 4OTLA 2E60A 2XASA 1K79A 1O4SA 1H1CA 2A05A 2NS0A 1MBKA 2VIAA 4A3CJ 1ECXA 4PJ0C 4F3QA 1D0YA 1A36A 1DJ9A 4D5CA 2HVSA 1SMYF 2DOEA 2OC6A 4FT8A 2DA1A 4OYTA 1VQ8I 1B1BA 5BMZA 4NQWA 2HZTA 3H0DA 1R71A 2HOEA 2PMZN 1SVOA 4PFFA 2RVCA 4P3MA 3Q8NA 3M1CA 1EKEA 4IL6C 1BI0A 2MFZA 3MMYB 2P5LC 3IH3A 2DKJA 3L2UA 4IX8A 3I5UA 1TT5B 4ASNA 1Z7LA 4LG0A 2LBFB 4ESJA 1VTNC 4HDVA 4AM3A 1BQDA 2BYLA 3DU5A 4MGRA 3REOA 2CB1A 4RAEA 2M7AA 3WG7H 3WTTC 4F92B 4U7BA 1Z6TA 1XS9A 2ZC0A 4GDYA 3NRVA 3TO6A 1XN7A 1MDMA 1UHSA 2VMXA 5D6EA 3M7GA 4BQ0A 3QP5A 1QGNA 1U5TC 2BZTA 1FSHA 1UU0A 1W5TA 1HKSA 2Q0OA 4I7HA 2QM3A 4WX9A 2M4KA 1T08B 4XOTA 1DU6A 4EGYA 4LB5A 1J5YA 2DKBA 4LW4A 3FKIJ 4JEYA 3JW4A 3OYBA 2M9HA 4NQWB 3G0TA 2JRTA 4BJTA 4UNOA 2VKEA 3ERMA 3LSJA 2KIFA 1BOAA 3WU1B 3RYPA 4R5FA 1QVTA 4HW0A 4OOIA 3A02A 5EEAA 1SANA 3CLQA 2DGMA 3CAIA 4XLEA 3TO9A 1ZLJA 3QGUA 4PSWA 1JXSA 4CXQA 3FQ8A 3OYCA 1A31A 1WH7A 1V5FA 5FFXA 4KISA 2K02A 3HOUJ 1IC8A 3JW9A 2MH2A 2OCCH 1IXSB 1UFMA 1MAQA 4NNJA 3A9YA 3I59B 5EEHA 2XSDC 3K1NA 4R2NA 2WA0A 1QJ5A 4B9BA 5EQCA 3P7NA 2RAEA 4M3DA 1P3WA 1X1AA 4JEWA 4EB7A 3RCHA 2K9NA 2F48A 4TV7A 4N9IA 5ILUA 2G7UA 1RV4A 1D3YA 3MVPA 3BTJA 1BJ4A 3PDBB 4DZJA 4KT5C 4BS9A 2K40A 2P4WA 3FXKA 1YNUA 1HSJA 4A0GA 2DA7A 5HDMA 1OCCH 1R4NB 5BNGA 1GEWA 1FOXA 1SFXA 3GXOA 2DO7A 3SZGA 2FBIA 3F6VA 1TOKA 4KMUX 1MDOA 3RSNA 4LIUA 1UU1A 3ZMVA 4ZC3A 3OYJA 4AYBA 3I64A 3WE2A 2ORDA 4ZSYA 1M1EB 5F64A 1X1DA 2CG4A 2IS4A 5DM6F 4L9TA 2BWPA 2FQ6A 3TCMA 1S0AA 3ZMSA 3RKQA 5HXXA 1Z3ZA 4U88A 3VYRB 4UV8A 5JLXA 3Q9SA 2R7SA 4DJAA 3U1KA 4L9JA 3S2HJ 1X3UA 3Q0UA 2VMWA 5D5XB 3A9XA 2TDXA 4GSAA 4BJ6C 3S3OA 1JUPA 1J2XA 5DD4A 1M6SA 4TN4A 1OYWA 1FLIA 1LDDA 2HTJA 2VQGA 1ASGA 1B8GA 1SZUA 1FY7A 3HKZN 3VP6A 3FDYA 2ZMEC 1FBUA 5IOZA 1HW2A 4N0BA 3H9GA 1S06A 1DPRA 3ROUA 4Q48A 1QVUA 3BQZA 2HUIA 5EGOA 5B1AH 2WB1A 3TQXA 2XB0X 3K4KA 1X1CA 4ETSA 2W7GA 4ZM4A 1GBNA 5JAYA 2G6WA 2W7FA 1ASLA 4N4OB 1USSA 3T0YA 1MZBA 3G73A 3CESA 3TP0A 3N5MA 3OIQA 2DOUA 1MGTA 5IT9Z 3K4LA 3PAAA 3ZP5A 1UU2A 3ZZJA 1C0WA 1JJ8C 3C18A 2LKXA 2Z16A 3DXVA 1ORKA 1R7JA 1B8IA 2LNBA 3D5RC 4I6ZA 5M49A 3HOTA 1T39A 3MCZA 2YSRA 4KIBA 4A3EJ 2V7FA 1AJRA 4B44A 2DT6A 3GZDC 2JVGA 4CCKA 1FYMA 4AIJA 3J81K 2GXBA 2FBHA 1S9HA 2WY7Q 4G7HF 2HS5A 2JJGA 4HBLA 4MNUA 3UE8A 2CYYA 1P6RA 1RZ4A 2KMUA 3PSFA 3R4KA 1Y1WJ 4A6TA 1QO0D 4WP0A 1CF7A 1CQTA 2CUFA 3JRDA 2L02A 1YHQI 2UWMA 1LUJB 4RITA 1TT0A 5B1BH 1CF7B 3CO7C 4AWXB 2JA6J 4D5FA 2E54A 3ABKH 3CMEI 1PG8A 3BDDA 2CW0F 4UUTA 3NU8A 1BJZA 3JSOA 1LVAA 1TATA 3F72A 4CSWA 4DBQA 1WJFA 4EM1A 3ESWB 2HR3A 1P4WA 2G0EA 4OAYA 3OYMA 3GFIA 4A3FJ 3HB9A 2GLOA 4L5EA 3FD0A 4EJUA 2ZMEB 1TLHB 1KU7A 2E7XA 1CZEA 3AEJC 7AATA 2QWWA 1P9QC 4G9YA 2CSTA 1I48A 3DR7A 2K3PA 4I2OA 3JU7A 1I3AA 3I16A 2IW5A 3GTGJ 1ARHA 4BY1J 3S16J 3OYDA 2VMOA 5KAIC 1ETVA 2W7MA 2O03A 1C9CA 2PMHA 3CF2A 3E77A 3FIWA 4OBUA 2W7JA 3LQRA 4AIKA 1KU9A 3BWNC 4GGGA 1TQMA 1B4AA 3GZ6A 2NXNB 3Q5FA 4C30A 3RIRA 1WKGA 2R7FA 4Y3OA 4I76A 4CZCA 3MZYA 1AMAA 5FFZA 1YYVA 3L1PA 2JPCA 4FCYA 4LLNA 3OYEA 4JX5A 1YIOA 1APLC 4IQ4A 3CD6I 1UB9A 3KP4A 2V1DA 3AEJA 3K70C 4J00A 1I27A 2CS3A 1AIAA 3QODA 1V2DA 1RIOH 1A5JA 5J1UA 1ZELA 2A3SA 1G3SA 2BXZA 2O6GE 5CQGA 4W1WA 1GVDA 2VMUA 1T0FC 3TO7A 2EBIA 5E1WA 2HEOA 5CPRB 5FD5A 5TF5A 3DU4A 2X6OA 2F6CA 2L4MA 3IC7A 3Q9VA 2WB1N 2L2OA 3AAFA 2LD5A 5L3BA 2OF7A 4GE9A 3ZQFA 3MAFB 5F8VA 2OA4A 2GM4A 4FTHA 5FLMJ 1J9IA 2VQHA 3RJPA 3I55I 3FM5A 3PD6B 2ZCWA 3GYHX 1XC5A 3MZ8A 1IDZA 5DCFA 2EIMH 1ZR4A 5KVRA 2O7CA 2GQNA 1UG2A 1KMJA 3LMMA 3O3KA 2W7KA 3IV5A 4BBSJ 4GRXA 4Q6RA 2JTVA 3NUIA 2EQRA 2I8DA 2GMSA 4P9UA 2HQRA 5LHAA 1MGVA 4E3RA 2G7HA 4PGGA 4UHTA 2H94A 2VKHA 3PL8A 4EQQA 4JF1A 2K9MA 2Y9YA 1JKRC 1HF0A 4C9YA 2HQAA 3QOPA 4D1QA 2A68F 2VMRA 4JX6A 4A3JJ 1DJEA 3OOPA 1ON1A 3HUGB 1XX5A 2Q2EA 3I71A 2HDWA 2LOOA 3B8XA 3WTZA 1X4PA 4V2GA 4CXRA 4LGWA 5GADJ 2NS8A 1R49A 1L3LA 4F5GA 1IV8A 5L3FA 1ASMA 3FDBA 4AZJA 3KEQA 2AY5A 2CJGA 3RQ1A 2ZFWA 3V4GA 5EG0B 3QM2A 5FKLA 2JQ7A 1WI3A 1BJWA 1IUYA 1EH6A 3HJEA 1W23A 2D65A 3H14A 3BR2A 4J01A 2XPVA 4PDKA 3RCHB 3SHFA 1H9GA 1W7NA 3MKZA 1Z21A 2VI9A 3VFZA 1UHWA 2OJED 2D5VA 3VB2A 4M72A 5HVQC 1SFOJ 1R1VA 2XROA 1VQPI 4KNYA 2Y30A 4A2UA 3ZMUA 1IO2A 4JBAA 2VIBA 4RAYA 3G7QA 2MG4A 2DTZA 2CMPA 1BW0A 1CQ7A 3D5SC 2ZYJA 3RCOA 1X0MA 3H3UA 2V1NA 3HSEA 3H9JA 3S17J 2P81A 3TMOA 1OCOH 1LQ1A 2L4AA 3T8TA 2IS6A 3QN6A 1D8JA 4II3A 1LB2A 3QI6A 3ZQHA 3E7LA 4IYOA 1JKOC 1Y6IA 4XORA 4M6YA 2L9SA 2MLGA 2WWYA 4RKCA 4XJOA 3I54A 3HHGA 2VBZA 2WKAA 2NMPA 1TPLA 1MSFC 3FZ8A 4HF1A 4CBSA 2ZSIB 3QRFF 1XDSA 3TDZC 2TCTA 3EI8A 1D1AA 5JR3A 1KA8A 4NHJA 1MMNA 2KIUA 5M4BA 1ZODA 3TP3A 1M32A 3TOAA 1XSVA 2NNYA 2VOOA 4UHOA 2W8WA 2KT0A 4ENMA 1AY8A 4R79A 1SD7A 4F5LA 1LW4A 2ZXJA 3ONQA 3WTUC 3F3XA 3KZZA 3GFLA 4MHGA 1R23A 3CMMA 3LFUA 4A5NA 5GTIC 1WI9A 4Q31A 3F9KA 1SFFA 4ANJA 4QWQA 4BGDA 3GF2A 2STTA 4I98B 4UVCA 4EEFG 2W82A 3FM3A 4EM2A 2JN6A 5E8IA 2ME0A 3GLLA 1TL8A 1V2EA 2DQLA 5JHUA 1IN6A 2L0KA 3HQTA 4A3GJ 4XICA 2NOGA 2YU3A 1UCRA 2M45A 1JGSA 2BOLA 3CCQI 1ZG1A 4L18B 1IBJA 3KP2A 5L3DA 2R92J 3LV2A 3PM1A 2P7CB 4WB0A 1QZEA 5ICFA 2EZ1A 5JVTA 2MA3A 1YJZA 5FGMA 3CQZJ 3J7AY 4QLCU 1Z91A 3CJQB 1IX6A 1G2HA 3KP3A 2B7EA 4XM3A 1MKMA 1B5PA 1ASDA 5ILVA 1ELUA 3JAMK 2EV6A 4MTEA 3LQQA 1W7PA 2L01A 4I99C 2EIKH 3BR3A 4U1TA 2JZYA 2BYVE 4HDUA 3LVMA 1VQMI 1JTYA 4MKKA 3HEFA 1KYWA 2DFHA 4CICA 2P5VA 4FX4A 3HBXA 4E77A 4A3IJ 2QGUA 1ZYRF 1J75A 4CCLA 1ZHFA 5DUIA 1GDEA 2BIAA 4EGZA 5D5VB 3AENA 5FKOA 2FF4A 1HDDC 1GEYA 3KP7A 2OQGA 3C1DA 4R5ZA 4HNVA 2UV1A 5ERIA 2VASA 2LY9A 3V7RA 4A6RA 4MFEA 1N2TA 3SDBA 3DTIA 5DEQA 3H35A 4MO7A 4DQ2A 1K7AA 5F0FA 3RI4A 5E17F 2A61A 1AWCA 4PJNA 5AX8A 1ZK8A 2PJRA 5E1ZB 2GOXB 4HZFA 2X51A 2L9VA 1CJ0A 3JCUC 1W3UA 3PDBA 4LLLA 3DCFA 4FL0A 1JG8A 4L9VA 3DEEA 4B48A 4IEJA 4XRSA 2EFWA 2IRFG 4IQJA 2CANA 2F5VA 2HGCA 1I1SA 1V4RA 5EEGA 3I5TA 2H1KA 2RN7A 3E6MA 3NARA 3S8PA 1S29A 2XC7A 1HKTA 5ICCA 1CQ6A 4UY8I 1TWHJ 3SJMA 2O0YA 3CCUI 1UJ8A 3N97A 4ZJZA 1RNLA 4CHUA 2BVLA 1K78B 1R6RA 2MBFA 1M0OA 2DDBA 2F5FA 2KDOA 5G09A 2FMYA 3CDIA 1LC7A 1XI9A 3IKTA 5J4VA 1JS6A 3GFMA 2FNPA 3S2WA 5LHIA 2DK8A 1G4XA 4WXDA 3IRRA 3GR9A 4N0WA 2B63J 3MADA 4B09A 1P4AA 2K85A 2CFOA 4IHYA 5L3GA 2OV7A 1XPXA 1ASBA 3WGGA 4A5MA 5CVVA 3AV7A 1L0OC 1WVRA 1Y1VJ 4RAFA 1JUSA 3AG3H 2HOYA 1P7JA 4L9NA 4DZPA 4CBRA 2DFEA 2O61A 1IN5A 2BWNA 4E7KA 1VZ0A 4RB0A 5E5IA 2K9LA 4LOCA 3SZTA 1FYKA 3WGCA 1GV5A 1SD4A 3LAJA 4A0YA 4M73A 3BT9A 5FB2A 2QA3A 3S2DJ 5M3FJ 3VAXA 2KZVA 2OZ6A 1UZCA 2F4MB 1B9HA 4EVIA 3X2QH 3WTSC 2DGLA 4ITXA 2O7OA 4ZZLA 2R4GA 2AATA 1BR2A 2MYSA 2BHXA 4YEJA 3W6KB 1X28A 4HX8A 3FVXA 1M0QA 3HSFA 1OCPA 1G3YA 3E5XA 3GWPA 3K7YA 4FHTA 3CQ4A 1Z3YA 4IVNA 4BE0A 4RB3C 1S7AA 2NVYJ 4NDLA 3EI9A 4S0HB 2MLKA 2EFNA 3S15J 3RQ4A 2X9DA 1D1CA 2ECBA 4A0XA 3PO2J 2EFOA 2EPJA 3EZ1A 1IAXA 2V1PA 5B3SH 1IUFA 2QQAA 2H1LA 1SFKA 3F21A 5KCMA 1Q1VA 3OSFA 2FE3A 2FQ4A 3L09A 5HS9A 2EB7A 2HFHA 3C7JA 5C6UA 5HDKA 3VSLA 4YIIA 4M71A 3HT4A 1JT6A 2V1UA 1C0NA 1FIAA 1MDMB 1LE8B 3M07A 3VWBA 2X5DA 2G9WA 4BHBA 3N05A 4BQOA 3FZ6A 3IAS2 1BQAA 1A6IA 3AKZA 4XN3A 1WQ2A 1T38A 4IRIA 1EQBA 2AEVA 2XV4S 1I29A 4UV9A 4CCOA 2W00A 2BI3A 1JT0A 1E5FA 2OD5A 1KONA 1LNWA 1Z05A 2Z5UA 1OCZH 3L8AA 2R5YA 1S6LA 3GTLJ 3BWGA 1Y0NA 2MD5A 2W7IA 3A2KA 2DJIA 1YS7A 2O5RA 2XAFA 4BYYA 2VLAA 1AHEA 3IWZA 3E6CC 4ITGA 3HM5A 2XAHA 2Y9ZA 4CCNA 2L7ZA 2D7ZA 4WXCA 3JTGA 2W7DA 2VMPA 3FVUA 1EH7A 5M5WJ 3WU0A 2A5YB 2STWA 1WKMA 2IAIA 1YTYA 1VQ9I 3W2AA 3NAUA 4W5KA 5H6QA 3RTRA 1D5VA 4ITVA 3N0LA 5HLGA 2QQBA 4PJMA 1O3RA 2VXDA 1AX4A 2MD0A 1V5EA 3NYSA 2JUCA 3FMQA 1U5TA 3BPVA 1USTA 4Y4RA 2DA3A 5IPAA 4YFNF 4UUSB 1BBYA 2HDDA 4V19K 2YS9A 5GTHC 1WHUA 3RPQA 2M1BA 2LSOA 3P9IA 1EF4A 1ASAA 2KJBA 3CTAA 2PI0A 2EH6A 5GAHJ 1M4NA 1YIJI 3GW2A 5EUDA 2VODA 1AHFA 3GTMJ 4XKBA 5EUEA 2W1OA 4QTRA 5FROA 2DMUA 3NNKA 2QLZA 5LGNA 1AY4A 4F5HA 2VMQA 1AOYA 3FQAA 1FP1D 2VGTA 2TRTA 3G4SI 4JEVA 1X3ZB 4ZWVA 2D2WA 2K4JA 1HOMA 1PFFA 2PG4A 3VDXA 3ZQIA 1VQOI 1EJ9A 3S14J 3DR4A 3OY9A 1RKTA 2OKKA 1UMQA 2ZJ2A 1MW7A 2EGYA 1YO5C 2QQ8A 4ADDA 5E3OA 1IW7F 2XRNA 3DPUA 5ICEA 3WX9A 2F5DA 4AVZA 5EAVA 3M3YJ 2R7DA 5D8KB 4ESFA 3LNQA 1O61A 2BY2A 1MMSA 1R58A 4JE5A 3ZZKA 2MH9A 2Y31A 3GBGA 1RVYA 3WU2C 3CF5F 4L0OA 3CUQB 3QWLA 3WTXC 3NYUA 2XF7A 3GCMA 4R8DA 3GX4X 5LHGA 1LKXA 3I58A 3JRGA 4IF4A 3CBFA 2BY1A 2GA1A 4KITB 3F0HA 3ZRPA 1FC4A 1O7LA 3K69A 1ZKGA 2DA4A 1IV6A 3KCCA 5LGTA 1TC3C 3K0LA 4S05A 1DGDA 2D66A 4MKJA 5K8BA 1X58A 2DW4A 1WYVA 2VGSA 1V55H 2DU9A 4G6QA 4DNCA 1DJUA 2JVHA 1K6OA 3NYTA 5LHHA 3G1LA 1OFCX 1IVRA 2OBPA 4B47A 2ZFUA 1R5GA 1DQUA 2XIGA 2L54A 3TL4X 2DOFA 2OUMA 5CVJA 3MEXA 1VQLI 1MNDA 2L3DA 4LB6B 3MN2A 4YELA 4IXZA 2ZSMA 4BH9A 3S1QJ 4M9XA 4BAYA 2L9NA 4RGXA 4RGSA 3A01A 3LVKA 3OOUA 3DQVC 3G1OA 2WY8Q 2JPBA 3W3CA 1P7IA 1Y4IA 5DDGA 1LDKB 1FSEA 4MEYF 4E7IA 4PGHA 1FJLA 1D2FA 4HSTA 4ATQA 1T8IA 2VLHA 3EUHC 2VKVA 3BTCA 4RM2A 3VYTB 1QISA 2FD5A 4CXFA 2HYGD 3ZN1A 4XIDA 4HQMA 5C4XJ 5KAFC 1S08A 1AIBA 1YOVB 3ISLA 1B5OA 4JOMA 1AMRA 2DI3A 1DFOA 4JE5D 1ZG3A 2EFQA 1WJAA 3A03A 3QYFA 2C44A 1KYZA 5IP6A 3FX3A 1W36C 2WV1A 3IKVA 4KYWA 2IBDA 2IS2A 2JG2A 3DKYA 2E7JA 3B73A 3LOCA 1MLYA 4IKFA 1FWZA 2QKLB 3LWSA 1NTCA 4GXOA 3F8MA 4XLNF 5F08A 1I50J 1KGSA 3JRCA 3BCXA 3CCYA 5HLIA 2W84A 2ACJA 4O3MA 3WODF 2HVQA 1MLZA 1K4TA 5IOYA 1SEUA 3U21A 2VUMJ 1OHWA 1IX8A 3CLOA 2FQ3A 3FXOA 1WYUB 3EIBA 5FT8A 1OCTC 1QPIA 5DX5A 3F8NA 2HOTA 1WYUA 3W2VA 1EG5A 1JHFA 2AO9A 1W7LA 2EO5A 2HYFA 1BT4A 4JEZA 3SQNA 3PIUA 4G6TB 4P1WA 3BROA 4LC3A 3HL2A 4Q47A 1PYVA 2EFPA 4W1UA 3ERED 1WSUA 3FHNA 4HG2A 1ETKA 2F5CA 1I41A 3FBIB 3PNTA 3C3WA 4ZYAA 2RNGA 3CCEI 1ASCA 2ZKZA 3SFIA 2Z9OA 4KXKA 3I59A 2CUEA 3K1PA 1ARIA 4UHMA 5F0HA 1AHXA 2PBIA 2X1DA 2HYJA 2E1MB 2HOSA 4NC8A 3IWFA 4ZDPA 1U9NA 2QB2A 4OCAA 5B66C 2XPUA 3PJ0A 1U6GA 1VNDA 1WZ2A 4K2EA 3K9TA 3S93A 1OJLA 3DV8A 3UR3C 3CCVI 1AKHB 2DPDA 1B4XA 4IRHA 3KYDB 4Q4ZF 5FRMA 3FK6A 1WCMJ 2KPMA 1DDNA 1HXDA 4B43A 1X1BA 4MLOA 2AXTC 1XDUA 3EZSA 1IUGA 2KKOA 4M74A 2VB6A 2V9KA 3HOXJ 2Y69H 2YOBA 5EAAA 3DTEA 2ZNYA 2EWNA 3MC6A 2E19A 1RKWA 4KMFA 3TATA 2KZGA 4C2MJ 2YCNA 1YW9A 3LA2A 5FLVA 1QZZA 2JA7J 5E79C 3D0SA 4J5UA 2RQPA 3LSGA 2KDZA 1SVLA 1HDPA 5C4JJ 3E2ZB 1ARSA 3F22A 1TOJA 3UKGA 2WADA 1WJDA 2RNJA 3P9CA 2ELJA 4M3FA 4RAZA 3NRAA 3VYUB 3M8JA 4XLAA 4ZWMA 3WE3A 2OGAA 3S3NA 2VKDA 4HX4A 3OKSA 1TW3A 3R4TA 4KT6A 2B9SA 4LG3A 2Z1DA 3H1CA 5ILSA 1AMSA 5D5WB 2K27A 1HW1A 2LK2A 5DV5A 4W1VA 2NVQJ 2VXZA 1OATA 2AY4A 2WV0A 1LVKA 1H0MA 2OPTA 3QPLA 1QHGA 1F5TA 2VGVA 2EPFA 4M9ZA 1F36A 5A2QK 3V7SA 2E1MC 2XKOA 3K40A 4ZTJA 2Z33A 1DKAA 3W6VA 1BJOA 2LLKA 4AUXA 1GC0A 3H92A 2CJDA 4RGRA 4PJLA 1ASNA 2JJFA 2Z9XA 3OYFA 2BWOA 1S72I 2LVSA 1AHYA 1Z6RA 1I1GA 3CO6C 4R8HA 4CH7A 5D5UB 5IT3A 1BI1A 1W0UA 2Y2ZA 4BE1A 1BR1A 2CQ7A 1H0CA 3VODA 1N75A 1KU3A 2EZKA 3HVYA 4A0HA 4UOYA 1CGPA 1PVEA 2XHKA 1YJ9I 1MNMC 1ZRDA 1YW8A 4HA8A 4K2BA 2PJPA 2NVXJ 2D61A 1V3FA 2IT0A 4ENJA 1K61A 3CCLI 2H6BA 3FXMA 1FG7A 1N77A 2QVOA 5D4RA 2AS5F 3GZNB 2VGZA 5EJCA 5E3LA 3B1DA 2EINH 4XRSG 2PEXA 3PIOF 3CCJI 1MIJA 1Y0UA 3BR6A 2ZJPF 4M3GA 2JJHA 3PPLA 4WXGA 4X6AJ 2E2IJ 1I6HJ 1AKAA 2AY9A 3OR1C 1YJYA 1D7SA 3KLOA 4E4HA 3KIOA 3JTXA 2IGNA 4MQVA 1ZGWA 4XAUA 3V7CA 4WXHA 3VYSB 2DODA 1MMDA 1LFUP 2YX4A 2HTSA 4LNJA 4RB2C 3GLXA 3ECHA 1MBGA 4WF2A 2JISA 2ZJGA 2X6WA 2ISYA 2BBYA 2QB3A 2RFVA 1F43A 2BIGA 1QNTA 2AY8A 3PSIA 2LKSA 3A01B 1ERDA 2LTPA 3R0JA 4RIZA 1ZLKA 3CP2A 2E71A 3LSPA 1RRJA 2CQNA 2HXOA 2QKMB 2PB2A 1HC8A 2OATA 4XSXF 5KNLA 2BHYA 2KRFA 1H8AC 1H88C 1TNTA 4X1EA 2E5NA 3V8LA 5LH9A 1E3OC 4M9SA 5EZHA 3KYCB 2DR1A 1MJ9A 5BJ4A 1WH5A 2YU9J 2R7OA 3DFGA 4DGWB 1T0FA 1X1PA 3RKXA 3HYIA 2UZKA 4WWCA 3FKDA 2CQQA 4M6VA 2EZLA 3NQOA 1JKQC 3B6AA 3H0GJ 1FX7A 4QPOA 4B1RA 3L9FA 2IGKA 1ZC9A 3CZ6A 4U7DA 3EYIA 5K7HA 3GZCA 1U8RA 3ABUA 1JUMA 4RAGA 4CCJA 1YIYA 4GO1A 1S8NA 1IDYA 2WBMA 3FK7A 1J7KA 2P8TA 3HTSB 3A2BA 4ON0A 1JF9A 1WYTA 1TQPA 2NVTJ 1BS0A 2TPLA 1YFHA 2GIZA 4E7HA 3VSKA 3L2RA 2JT1A 1D5YA 1RESA 1B9IA 3N4MA 1STZA 3K1MA 3FXQA 2CU7A 3W6JB 3D6KA 1MJBA 1X4OA 2GA2A 2VT2A 3V8JA 1VQKI 1LPQA 2X0LA 2ZXIA 2FM1A 4JEXA 4I0AA 2DMQA 3OIPA 2ZO4A 1QPMA 1DTYA 4XLHA 3L2CA 1YRNB 3VOMA 3PGYA 4AH3A 1IF1A 1C7GA 3EPZA 4ZASA 1MJAA 4EJVA 1TBXA 1M0PA 3OV8A 4LK0F 4Y0IA 5DYMA 4A6EA 4BA4A 2RDPA 1X2MA 2Z99A 4RKDA 4A3BJ 3ML6A 1WJ5A 2R0QC 1A04A 1EA3A 2EV5A 3PIPF 2R5ZA 2Q1ZB 5F6FA 2CFXA 2FBKA 3ZPLA 2XGXA 1D7RA 2FU4A 3F6TA 1XEYA 3FFRA 4OT8A 4CUGA 4N4NB 3FBNB 4Y0HA 2DLLA 1PDNC 2MC4A 2EJRA 1R4MB 1E17A 2CSOA 4I8AA 3PNVA 2HKXA 4NC6A 4OIRF 1P4XA 1RPWA 5IWQA 3U1DA 3HZJA 1TW2A 2H09A 4A6DA 3EUAA 1SZKA 3OS2A 2DMPA 3G8MA 5ED4A 1WKHA 2VQLA 3LSMA 1MH4A 3P5JA 1Y56A 3T5XA 5HDNA 5JLWA 2F8JA 4J8LA 3RPUA 4AO9A 1JGGA 2QA4I 4B98A 3BB8A 4WLJA 2KJCA 1D1BA 3LSHA 5J8CA 4DIQA 3L2QA 1UHMA 2R7ZJ 1AHGA 1G59A 3LVLB 3IP4B 1W36D 4AO4A 2CH1A 1N31A 3CCSI 3QAHA 1PUEE 1FOKA 3CUOA 3DBLB 3GUDA 1W5SA 2BY0A 4JK1X 4ZZDA 4ADEA 2V9VA 3E6DA 4CYCA 4BDZA 1ZGAA 4XSZF 3LA7A 3BCAA 4A12A 1G4VA 1U8BA 2R7VA 4F5KA 3C2BA 3L2VA 2HPIA 1IN7A 2HXIA 1G8XA 1SVMA 2CH0A 2LY1A 1SC7A 1A35A 4FFCA 2LC2A 4ZTFA 3H36A 3WG9A 4A00A 1EH8A 3VPRA 2OTLI 5EIGA 2XAUA 2A69F 2IEKA 5K7FA 1AY5A 3WZFA 1MBEA 3SEZA 4WYFA 4ZDLA 2V26A 3P9KA 3BJAA 3NDNA 4A0RA 2Z61A 3OS1A 4WD2A 2YPRA 3G1MA 3DEUA 2R5YB 4PUSA 3H3ZA 4XQFA 4A6UA 2I10A 2IA0A 3HSRA 2IGOA 1UELB 1OISA 2W7LA 2PN6A 1WFXA 3CMYA 3G6EI 3LAPA 1RC9A 4FETA 2Y0SN 3BR5A 4ISYA 1OXPA 4EJOA 1Z77A 1RR7A 1KKJA 2RKHA 1FC3A 4AZKA 1GEXA 1S3JA 5JI6A 1GT0C 1I6XA 4KJZA 4H0EA 2WC2A 4E3QA 4F5IA 1Y39A 5J1YA 1LE8A 3FCRA 2LP0A 2W8UA 2EZHA 2VMNA 3DZZA 2VGUA 2K9SA 4F93B 3OYIA 4RLQA 2H27A 2ZNZA 1RUOA 1QZ9A 4XLCA 2ETHA 1MMGA 5LGUA 3ASBA 2DK5A 3W1JA 2JK3A 4ZYGA 1Z67A 1U5TB 3GTKJ 1DP7P 1FTZA 4XRMA 1OR7A 2ZC2A 4B8XA 2XAQA 2KIMA 1BL0A 2IA2A 3E97A 2X48A 3OL4A 1AKCA 3CUQA 5K5RA 2YCPA 1IZ1A 4ADBA 3EI5A 5BJ3A 1MBHA 4FX0A 5E1XA 3C2HA 3WKRA 1XGMA 4DQ6A 1GVJA 2VQCA 2IJLA 5AIPA 2ZBKA 4WYEA 3R60A 3A1YA 2YKUA 2ZB9A 3HDDA 4ZM3A 2Z9WA 4F55A 1O69A 3CDLA 4MQ9F 5E20A 4I01A 1LK9A 3HDOA 2W57A 1AA7A 4O6JA 2MABA 3DRDA 1NG7A 1WYVB 2VJJA 3COAC 3A0HC 3K7AJ 3H5AA 2VONA 1IRFA 3NWTA 1YITI 5IT9K 1ACIA 1SF2A 1FOWA 1OR7C 1ULYA 1MBFA 3ABTA 2DTRA 2W4SA 4GYIA 4IPAA 5EZGA 5LRSA 2PO3A 2AQEA 2HDCA 2LMDA 4ESBA 1ZRCA 3E1SA 1G7XA 2QSGX 4OIOF 2CY8A 3E2FA 5CJ9A 1UG0A 5DCMB 2UXXA 2MGQA 2NNNA 3H3VK 4XK4A 4XEWA 2FRHA 2RGVA 3RKYA 4UHNA 2P6TA 2V0YA 5BOXA 1W7PB 4O5VA 3P6KA 1HKQA 3SFZA 4ZYEA 1CL2A 1TOGA 5DM7F 2D5YA 3NTJA 4LLGF 1LC5A 1VP4A 3NU7A 1SAUA 4AOAA 1K78A 2R7RA 1AKBA 3GZDA 4Y52J 4P5OA 3BLYA 4HF0A 2VN2A 2JSPA 4BXXJ 3KGWA 4R1HA 3MKLA 1SPAA 3BZ6A 3SEQA 2LFBA 2YX7A 3FHZA 1QGPA 5K1YA 3AOVA 3CCMI 3H9QA 3UNGC 3QHXA 1OKRA 4AIHA 1IJWC 2EK5A 2PX9A 3PO3J 1R00A 2W7NA 5JHFA 5FRNA 1BC7C 2VC1A 3WHCA 3IAM2 2J5OA 2QF7A 4ZLVA 4Y33A 5FLXK 4KICA 1BIAA 2E2HJ 1AICA 1BIBA 3HOZJ 2HOXA 2EA4A 3BG6A 3I9V2 5FKMA 1FT9A 3PNYA 2LRDA 4RJ0A 1S07A 3U2RA 3WHBA 1N8PA 1G3WA 3FTBA 4BY7J 2L5QA 2CFBA 2VJ4A 1IJIA 1U0JA 4FQGA 2E7IA 3K10A 3A9ZA 3ZMZA 1FBQA 3K4NA 3ZOBA 1FEXA 3ABLH 4D0PA 4HNTA 4OMAA 2MW8A 5C3EJ 4RDUA 3QPSA 3VK4A 4U0WA 2Q7WA 3M5UA 1VJOA 3DLLF 3MKWB 3HGGA 2QBYA 4W91A 5E4ZA 4AYBN 4IOAF 4XKCA 3BWNA 2DMNA 1KQ0A 5J6XA 4BA5A 3N75A 1CQ8A 5DJ1A 5FO5A 5DD8A 1R22A 2VBWA 3O8GA 4BXFA 2QMAA 2Z9VA 3FZVA 3EI6A 3H7FA 1I5ZA 1JKPC 2ZMEA 5J3LA 3ACZA 2IP2A 2R5CB 2V6CA 3QU6A 4C3JJ 2VPLA 1XTAA 1C7NA 2CQXA 1LFPA 1P92A 1AAMA 3ULQB 1V72A 2MSYA 2O9LA 3J7YJ 4KYOA 1HCRA 3FXUA 2NOJB 1J04A 1MAPA 1T6SA 3AG1H 3H5NA 4Y17A 2RC4A 1WPKA 4M3EA 4CCMA 3WY7A 1JJ6C 1F1ZA 1SFEA 2BW3B 5ICGA 4W1XA 1MMAA 1D8KA 2QSFX 4DGTA 2OKJA 3K4CA 1CL1A 4WBTA 3LSIA 2OTJI 2GZWA 1TWFJ 2DMTA 5CVRA 1EV7A 3ZQGA 4MQRA 2CW8A 3BJOA 2HQ5A 5FT5A 3MBBA 5IYCJ 4U2HA 3DYDA 3K28A 1AHDP 3K70D 1FBSA 2BXYA 3HOWJ 2ADUA 3B02A 5FLXZ 3R6SA 3HRMA 5J47A 2IVMA 4DYRA 1FMVA 1RUNA 1KQ8A 4HV6A 3L7WA 5CVIA 3PFIA 4BDYA 3WLXA 1W4MA 3FXLA 3JTHA 2CH2A 4LG0B 2WAFA 5IP7J 3LL7A 2JGTA 1NG6A 4BQQA 3IH4A 4Y7NJ 3E9KA 4PFOA 4UQVA 3EYYA 1X19A 4Y15A 4CYCB 1OQYA 2D45A 1T2KA 4EB5A 5HHYA 3UWCA 3O2PE 3FFHA 2P0WA 2GB3A 1XSDA 4IW7A 2DT5A 2CV1A 2B0LA 3ELPA 3RUYA 1I39A 3FRKA 5HLHA 1OYIA 2AY6A 2KP6A 2GOMA 4U87A 5E8GA 3DU6A 1GC4A 2C81A 4UXNA 4XKVA 2BI9A 2VBYA 1TWGJ 1EJIA 3J7AO 1SMTA 3IH2A 1DPUA 2DBBA 3F8CA 3T8RA 2DXIA 2LG4A 4OINF 2V4JC 4EJWA 3KE3A 2OU2A 4LJZF 4HLYA 3B1EA 3Q0WA 4B3XA 4C3HJ 1R5HA 4XL9A 3KEYA 3DF8A 3OYHA 4ENNA 1O4XA 5TJJA 3GJUA 3J80K 3NUBA 3M9AA 1ZGJA 4W8IA 3BOQA 4OMZA 3WKSA 3VOEA 4H51A 2BV6A 4MQPA 3RI6A 3OSGA 1RV3A 4ENKA 5TGTA 2ZSLA 2EILH 3CC4I 1QQIA 1H9TA 2O8KA 2DDAA 5LFAA 4QIWN 3ZR8X 2PFBA 3ZRRA 4MY5A 2VL8A 3MEBA 2X4HA 1X2AA 4M3BA 3K4MA 2X6YA 3WTYC 1DGRM 1TWCJ 1XCBA 4U0VA 4F5JA 2XBNA 1XGNA 3ASAA 5BPDA 2W48A 2JA8J 2F5EA 2HVRA 3KFWX 4BL0B 2H8WA 4X0GA 1ASFA 5CVUA 4YRVA 3R9AA 1GLNA 1AAWA 4XKWA 1DGEA 4IJAA 2VMVA 4M2JA 2NS7A 1IAYA 2D1VA 4BUPA 4YFKF 1W7MA 2BE5F 2DA2A 3Q3SA 3AEMC 4I0BA 5B5EC 1LDJA 2ZSHB 1ETYA 4HF2A 3ZXSA 2F4IA 3LSKA 1Q1HA 4RM1A 2PLYA 2XAGA 4J19A 1IG7A 5I92A 4XN0A 3S1RJ 2D63A 4IYOB 1VQNI 3TKYA 5HS8A 2K86A 3K4JA 4WLHA 1TTYA 4A69C 1AJSB 1RETA 3BTLA 4RMNA 2NRAC 4WYAA 5FJ8J 1U78A 5F1RA 4RJYA 4NB5A 2DT7B 4JP0A 5IY5H 1MD0A 1MDZA 2WAEA 1YS6A 3B6CA 3EUKL 4RGUA 1VQ6I 3RZOJ 3O6BB 1J32A 5KHDA 2ZXWH 4BBRJ 4EJTA 2HOAA 9ANTA 5HNFA 3K6GA 2R93J 1CS1A 2FSWA 3OYLA 3PDXA 3FMRA 4DOZA 2A6EF 4JQFA 5KK1A 1H89C 3TW6A 2HORA 3LG0A 2R7QA 2CJJA 3WCOA 5F9SA 2CGPA 3B1CA 3GTPJ 1HSTA 1VI0A 2GMUA 3HTUA 5GP9A 1R9TJ 3QOEA 2ID6A 3USFA 4PCQA 2M0CA 5A2QZ 5K5OA 2Z9UA 5GPAA 2ZP7A 1ORDA 2Y48A 1TP4A 1YX3A 4KAMA 4ABZA 4F5MA 4HRIA 3ZQLA 3QU3A 3MAUA 3LA3A 4FE4A 1PMOA 4XR6A 4MQQA 5J8FA 2R0TA 1T33A 2OZUA 3AENB 3C2GA 1W7PD 5DUKA 3AOWA 1IAWA 1DU0A 2ESNA 4UB8C 5FKNA 1TZLA 3BG9A 5HS7A 4K2IA 3VEPA 4V2FA 2HP1A 4WB0B 2BVMA 1Z1DA 4AIDA 2R3SA 3D1NI 4OU0A 1IRGA 1V2FA 3E3VA 4CDGA 1B9MA 1KU2A 1SFUA 2WK7A 4BHPA 5EUNA 1U2WA 2JA5J 2M8GX 4JX4A 3E5UA 2VOPA 2GBYA 4IY7A 3JWBA 2CTZA 2LDUA 4IHWA 1OPCA 4LMYA 3AATA 3DPLC 1ETOA 1ON2A 4TMRA 2JWTA 1GC2A 1SAXA 2J5PA 1LEBA 3BG3A 4IO9F 2M34A 3IHJA 9AATA 5H2FC 1IGNA 3OIOA 2D7YA 2O8XA 2HQNA 2V1XA 3BTIA 2NVUB 3HKZA 1LC8A 1FP2A 2AHQA 2I5UA 3JRBA 1C4KA 3HXLA 1JE8A 4G6DA 3MWMA 3F8BA 5D6FA 3BS8A 1XGOA 3JAMZ 2OQRA 3HGYA 4DW6A 1NK3P 3ECDA 3MC6C 1SVVA 2BY3A 2LR8A 2R2NA 4E7SA 5TRDA 4BQAA 1FMWA 3VK3A 3PUBA 4A3LJ 2PJRB 2X3LA 2FOWA 1D0ZA 2QENA 4PFPA 1O57A 2XKPA 3ZGKA 1WWXA 1YLFA 2A6HF 1FYLA 4LNMA 3PUFA 1VFCA 4XJPA 3GO5A 3I4PA 3FKJA 3RZDJ 2RREA 3MD2A 3PD6A 2CUZA 2CINA 3OMYA 1LJ9A 4XNFA 1KZHA 5BS6A 4HSRA 4E7ZA 2XRLA 3HRSA 3FSLA 5HDGA 1UAAA 3SXYA 4BEHB 3J81Z 3J80Z 1XGSA 2GAUA 5L3EA 2R5EA 3DC1A 4PFNA 3KYLA 4EM0B 3TFTA 4GE7A 2C6YA 2C7TA 4IOCF 2MC3A 4WYDA 2UXNA 2YRRA 5BQTA 2FNAA 3KZYA 4BU2A 2GWRA 5F0CA 3IHUA 5M3MJ 5FT6A 3KLNA 1TASA 4MSOA 2JMWA 4G7ZF 1VQ4I 3AEOA 2CWEA 2JJ7A 4P96A 3RDIA 2Z20A 2M8EA 3F0CA 2O3FA 5EYRA 1CZCA 2XH1A 3I4JA 3F23A 4C2UA 3FZ7A 2L9RA 4E7JA 4D7MA 3IF2A 3RBFA 1GHCA 1X29A 2COBA 1N78A 1B8IB 1BI3A 1XMAA 4IRGA 1N25A 3J7ZI 1LEAA 1LS3A 3DODA 2AY2A 5G0AA 2LY2A 1K4SA 3DBHB 2BI5A 1K83J 2DA5A 4WYGA 3FWEA 1ZRFA 2EZ2A 2M87A 1LFBA 2HKOA 3AFHA 5H20A 4D9JA 2VMYA 1NK2P 1VEFA 2Z67A 2VMTA 3HC7A 3DPTA 2K5CA 3KX2A 2EA2A 3HPHA 1VF9A 1QU3A 3ZQQA 3OYNA 1IX7A 2E1NA 5M4DA 3SYTA 3R61A 2QBYB 2E36A 1WRJA 3E2YA 2HNHA 5G4IA 3S32A 1R1TA 4RLGA 3M8EA 1PJRA 2WK9A 2LF8A 2JA2A 3FF5A 2BI2A 4HYEA 3OYAA 3AELA 1QZYA 4BHDA 1QRYA 3TDUC 2DOAA 2HU9A 5J8QA 4EMYA 2E35A 2GQQA 2Q2EB 2OQXA 1AJSA 1YIZA 2IXSA 4A0ZA 4F91B 3CQ5A 4GEBA 3OL3A 3MAFA 2QYOA 1D7VA 1U9OA 1XMKA 2KFDA 1O62A 2V6EA 4IHTA 1XSXA 3WTVC 4AC0A 1OXOA 2YCTA 3KZIC 3ZN0A 5C44J 1IRZA 4A0FA 1V54H 1GC3A 3PA9A 2YUSA 1T56A 2DCEA 1TARA 3JZLA 2FX0A 1AU7A 1SZSA 3HIFA 3EDPA 2HP2A 2BI1A 3CQ6A 3JWAA 2OAZA 1PUFB 3PQKA 1AKHA 1RI7A 2OGEA 2ZUKA 2KHMA 1YI2I 3W1IA 4KN4X 4IHVA 4PVFA 1G3TA 1XMXA 2DJNA 3SDGA 3KEOA 3WGHA 5M5YJ 4W97A 2Y0SA 3CJRB 4HQEA 3GVAA 1W0TA 5G4JA 2R7TA 4KDPA 3QPGA 3ZQ7A 2F4OB 2BYJA 3BCBA 3FISA 4KN7X 3NWSA 1WJBA 1ARTA 4GE4A 4L0YB 1ETXA 3ABMH 3KP6A 1FZPB 1U08A 4H4KC 4QSHA 2E7UA 4F7ZA 4IHXA 2IGMA
chains in the Genus database with same CATH topology