4TV7A

Crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
460
structure length
431
Chain Sequence
TITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAALPDDLKEIHIWISFSHMDTDHFPIKSWFRCEQKAASRSYMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEDTRRTEQDILSHAAGLQLEIFGMSRFRPALIIGFARLKEEDIQEGVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the aminotransferase domain in Bacillus subtilis GabR, a pyridoxal 5'-phosphate-dependent transcriptional regulator
pubmed doi rcsb
source organism Bacillus subtilis 168
molecule tags Transcription
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 132
structure length 431
sequence length 460
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4tv7A01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4tv7A02
1T0FA 1K7AA 3V7CA 4R5FA 5CVJA 3HTUA 3W6JB 3RI4A 2DTRA 2K7LA 2PI0A 4ZZDA 1JGSA 3PAAA 3K1NA 1IW7F 4KA4A 3R61A 2YRIA 2QQBA 2CSTA 3MC6C 3P9CA 5IT9Z 2VMZA 2EFWA 1FYLA 4UQVA 4B9BA 3WTZA 2PB0A 1EV7A 1LK9A 1DKAA 2RFVA 1U3EM 4R8DA 2PJPA 1C7OA 3ML6A 3ZMVA 2BI5A 2FM1A 2M5WA 2QMAA 2RVCA 2BI9A 3O6BB 1Z3ZA 3DXJF 4HF8A 3BWGA 4HZFA 3CBFA 2L4MA 4IJAA 5K5OA 5DCFA 2IA1A 5IWQA 4MHGA 2CH2A 4RLGA 1T39A 2W7HA 4I01A 3V8LA 1X29A 4IVNA 3GSBA 3MAFA 4KT5C 2LF8A 4UHNA 4WYFA 2AY9A 2TPLA 1IUYA 2P6TA 2X8UA 4A6RA 3FQAA 2Z9VA 2YPRA 1S08A 3HBXA 1ASNA 3RPUA 3L09A 1K78A 1GEYA 1T6SA 4ZYDA 2JJEA 4BA4A 3WCOA 3CJNA 2R7DA 1LW4A 2DQLA 3AENB 4EMSA 1DJ9A 3F6TA 3B8XA 4MEXF 1WYTB 3CLOA 2P5VA 1XI9A 4O6JA 3WCNA 2E1CA 2UXNA 2WC2A 2CB1A 4YIFA 4LLGF 3T32A 3HOTA 3HQTA 3FZ6A 1C9CA 2YKUA 2V1PA 4WB0A 2Z5UA 1HKTA 2KIUA 3HHHA 3W1HA 1AJSA 4JEYA 1USTA 5EUEA 1F5TA 4L0OA 4ZDOA 2JPBA 2QBTA 1MDMA 2GMUA 2QBYB 1AHYA 2EWNA 2VYCA 2IA2A 4A6DA 1QZZA 2EFQA 2HZTA 3L7WA 4D0PA 2Z9XA 2XKOA 4EM1A 2Y75A 3ABTA 1BKGA 3BCBA 1Z05A 2BWPA 3SZPA 3QI6A 1P4AA 3J7AO 1BJ4A 4F4EA 3HYIA 1FYMA 5BPDA 2OATA 3ASBA 5AIPA 3REOA 1IX7A 2VBZA 3Q9SA 1U8RA 3JU7A 2FXAA 1PMOA 1ZG5A 1GC0A 5E4ZA 4HW0A 4OOIA 5J8FA 2FA5A 1O7LA 1O69A 1C4KA 1X2AA 2NMPA 3PGYA 1R7JA 4IXZA 1XGNA 1TASA 1G4XA 5CVRA 3TFTA 3QP5A 2W8VA 4M9ZA 4AH3A 5KK1A 2VOPA 1BQAA 1XD7A 3OP7A 1YNUA 3ELPA 3NUBA 3JW4A 4KN4X 2WWYA 3EI8A 1R58A 3VK3A 1DDNA 1IXCA 2D63A 1WWXA 4JF0A 1W7MA 1GDEA 2ZSMA 1BS0A 4PDKA 4KIBA 4MNUA 2XAQA 4HV5A 3TO7A 1CF7B 1FP1D 2DGKA 3DQVC 2VMRA 3KP4A 4UNOA 4BAYA 2DT5A 2ZUKA 2W7JA 1R1VA 3CQ5A 3NRAA 1YQAA 2A5YB 3T8RA 4MEYF 3MZHA 1HKQA 4PIWA 2BYJA 2YKYA 1B9MA 5EEGA 4WB0B 3L44A 4EJTA 4F5MA 1YTYA 2D66A 3I59A 4P5OA 4K2BA 3CUOA 1SD5A 2MD5A 3H3ZA 1W7PB 3FZVA 3E2ZA 2QBYA 3NTJA 5A2QK 3HIFA 2NNNA 3VODA 5DD4A 1SVVA 3RBFA 4P3MA 3BPXA 2AATA 4BXUA 2E7UA 4A0HA 3KGXA 1KKPA 4U0YA 4CZZA 2FSWA 5JVTA 4Q48A 3TDUC 4EVIA 2H6BA 2VC1A 2TDXA 2VLHA 3P9IA 1BN5A 3PQJA 3T0YA 1GEWA 4IW7A 4A0YA 4F5JA 2UWMA 1RV4A 2R3SA 2E54A 2RKHA 3BJOA 1V2FA 1WYTA 2K4JA 4OBVA 4BHPA 3JW9A 3BROA 3WY7A 1D2FA 1SZKA 4GDYA 2EFPA 3WTUC 5M49A 3RIRA 3E97A 2JJFA 2A07F 1ARSA 2OKJA 2DR1A 4K2EA 1KYZA 5LHGA 3CAIA 1ELUA 2E7JA 4KNYA 4GSAA 4R2NA 4Q47A 1UB9A 4A5MA 1LS3A 5L3FA 5C6UA 3KFWX 3OOPA 1AWCA 3ZMUA 2VT2A 1WKHA 3W1JA 5LHHA 1WSUA 3E6BA 3WU1B 1YIOA 4WBTA 3FF5A 2OGEA 3ZZJA 5HDGA 4AO9A 4G9YA 4MQ9F 1SFEA 4P7YA 5LEKA 5BPIA 4JBAA 1AHGA 2O1BA 4TV7A 2K86A 3F8NA 3HHGA 4WX9A 1KL2A 2FMLA 2VMQA 4HF2A 3FM3A 4RJ0A 5G0AA 4MQVA 1EG5A 5DCMB 1DJEA 3ECHA 2QA3A 1YW7A 4AZJA 3ASAA 5K8BA 2RQPA 3MAJA 1RIOH 1KU9A 3E2YA 2HYFA 1HW5A 2DW4A 2XROA 1KU2A 3HL2A 2HKOA 1TNTA 3RDIA 1BC8C 2W24A 1BJNA 5I92A 3DKWA 5KVRA 4IYOA 2WTEA 1XDUA 2Q2EA 3S2WA 1W7PD 1LDKB 2M45A 2FN6A 2F2EA 4U7DA 2ACJA 4ZWMA 2HQNA 2W57A 1OMIA 1OXPA 4Y13A 4E77A 3K69A 1OHVA 1EH7A 3BP8A 3O2PE 1W7NA 4KICA 4PCQA 1TQPA 3T1BA 3EYYA 5HHYA 2IW5A 3F72A 1G7WA 4WLJA 3DYDA 5EEHA 2UZKA 2P6SA 4OMYA 1IAYA 4JEZA 1O3RA 2GA2A 3USFA 3CUQB 4H0EA 1MAPA 1WQ2A 2ESNA 1H9GA 2VONA 2D64A 4BH9A 4IY7A 1QITA 4I02A 1AX4A 4KFCA 3LWSA 2HQRA 1F1ZA 5LGUA 1GBNA 2E7XA 3NYUA 3M1EA 1KU3A 2G7UA 4AIJA 5FFZA 1Z9CA 1J2XA 2BI1A 2EK5A 5ILVA 1S09A 2C0RA 3EZ1A 3WGHA 4A0RA 1B4AA 3EI9A 3A2BA 3LAPA 3VB2A 3QP6A 1J59A 2ZYJA 4LNLA 5LGNA 3E6DA 4E70A 2XVCA 1D8JA 2HR3A 4G6DA 3B46A 2CFBA 2AS5F 4ENKA 2FRHA 3VEPA 1IN5A 4LK0F 1DUXC 5ICGA 1WYUB 1ZN2A 5FLXK 3WTXC 3TQNA 5ICEA 1B1BA 1MGVA 4OIRF 2NRAC 4LNJA 1CL2A 3LA3A 4WYEA 3GW2A 5G09A 2RV8A 1JF9A 3SXYA 2W7FA 1JHHA 4KMFA 5IT3A 3KEOA 5M4DA 1M0QA 4RITA 2CW0F 2Q8KA 4A00A 3MQ0A 2VE8A 2O8XA 2VMTA 5L3BA 1N8PA 1VTNC 2OA4A 4WK8F 3WGIA 1AMQA 2OQGA 3ACZA 4ADBA 3EUHA 1ON2A 4GYGA 1V72A 1BJOA 2A69F 5AONA 3BZ6A 4Q31A 1J5YA 4RAEA 4N9HA 4WYDA 4FHTA 4IYOB 4XLPF 2J5PA 2V6CA 4RS8A 1G6NA 2PMUA 3RJPA 5CVUA 3DV8A 1R00A 4U1TA 4CBRA 4PGHA 4UXNA 2AY7A 1GC4A 2XHKA 2B0LA 5ICCA 3GWZA 1LQ1A 2D65A 3GJUA 2QZ8A 1AKAA 2DLLA 4OT8A 2ESHA 4UVCA 2W8WA 5D95A 3MEBA 1Z91A 3E6MA 3A9XA 3ZMDA 2FYFA 3IHUA 1TQIA 1MDXA 5EAVA 3LFKA 1F9NA 3K9TA 4ZDPA 2HOYA 4ESFA 3MWMA 2ZMEB 3G8MA 4J8LA 4ADCA 2RGVA 2Z1ZA 3TOBA 4IXSA 1AHFA 3RCHA 4IF4A 4O3MA 4LD5A 5HVQC 3C18A 3LSTA 2Y48A 1GXQA 1BT4A 1M7YA 1AIAA 3COGA 2VGZA 5DEQA 1XEYA 2GQQA 3E77A 3GUDA 4FL0A 1D7RA 5DJ9A 3R4TA 2XH1A 3FTBA 4MTDA 5LH9A 3E5XA 1N2TA 3ZN0A 2CANA 2E7WA 3KP2A 2ZP7A 4K2MA 1ZH5A 1P4WA 2CTZA 5EUNA 3WZFA 2DK5A 2R5CB 4ZSWA 1FOKA 1R5GA 4U0VA 1TOEA 4LW2A 2F8JA 4DQ2A 3HSRA 2V1XA 4U2HA 3N97A 2QM3A 3QN6A 1B5PA 2FQ6A 2HP1A 2W7LA 3HLMA 1H0MA 4CBSA 4Y0IA 1CQ7A 1LW5A 3RQ1A 5H20A 3BC8A 1CJ0A 4N9IA 3Q8NA 2K27A 3I5TA 3WGCA 4BHCA 4R5ZA 1XSVA 1B6AA 3EYIA 4OU0A 1OYWA 1LC7A 1J75A 4HX7A 3GO5A 2D7YA 5M46A 4UV8A 3EZSA 2W7KA 3V7SA 1G3WA 4BNCA 4YFXF 5CLSA 3RYPA 4GCVA 2COMA 1O3QA 3FQ7A 2MH9A 3U1DA 3HRSA 1P2FA 1U2WA 1W7PA 1HW2A 2FU4A 4M2KA 4GGGA 3MKJA 1IN8A 5DD8A 2VGVA 5FFXA 4W1VA 2P7VB 4ZLVA 2AY1A 1E5EA 3BOQA 2XAFA 2ORDA 2QB2A 3VFZA 3WGGA 1PDNC 4NHJA 3R0JA 3CUQC 4F5FA 3P1TA 2EA2A 4I7HA 3ZP5A 3CTAA 3EI6A 1DGDA 1IRFA 4U0WA 1IX6A 4R8HA 1CZCA 3IL2A 1ASBA 3ISLA 1W7LA 4G7OF 1R5HA 1CS1A 5J8CA 3F8FA 4IXOA 1IX8A 4F5HA 5ED4A 2FMYA 3SQNA 4HLYA 2F5CA 2DU9A 2AY8A 3F9TA 2R5EA 3I5UA 2LDUA 2BYLA 1P92A 2ISZA 3E6CC 1U78A 2HGCA 1KGSA 1KL1A 3DPLC 1O3SA 3KEQA 3RCHB 5M4BA 3F3XA 3KP5A 3L9FA 1M4NA 4CXQA 3ERED 2ZMEA 4BQAA 1STZA 4LGWA 5D4SA 4IX8A 3CQ6A 1M32A 1RV3A 5JI6A 3GLXA 4KUMA 3V7RA 3J80K 2L02A 1HSTA 3ZMSA 3ATHA 2X3LA 2GWRA 4Y0DA 1LNWA 2YCNA 1XGOA 4BYYA 3AEJC 1QO0D 3ZQ7A 2HZPA 3NX3A 5K1YA 1O57A 1FBUA 4WXFA 1I1GA 4XLNF 2GA1A 5H6RA 4Q4ZF 4KDPA 4HV6A 3BCXA 4ZAHA 2C44A 3HRTA 2J5OA 3FXUA 2BIAA 1K79A 1ECXA 2QB3A 2FBIA 1ZRDA 1Z1DA 1MLZA 1BJOB 4JK1X 3N0LA 4IXAA 1XN7A 1KQ9A 1OPCA 2JSCA 4OCAA 5LHAA 2H94A 1FY7A 4RM1A 2DQRA 5ICFA 2V0YA 1TPLA 3G7QA 2VMWA 4EJOA 5JAYA 2IJLA 4LNMA 4LB5A 3WX9A 3IKVA 5ILSA 1S7OA 3K40A 2NS0A 2OQXA 3NUIA 4Q6RA 1YIZA 3MFKA 2WV0A 4OIPF 2YCPA 1E17A 2QWWA 2A6EF 2X5FA 3EQLF 3PFIA 4CICA 2IPQX 4GE7A 2XASA 1W3UA 5BOXA 3K1MA 2DFIA 1M0NA 2RNJA 2QENA 3JTGA 1REPC 4A6TA 4TN4A 3OKSA 3PIUA 2W7IA 1D7VA 1JG8A 4G7ZF 3VP6A 1UU0A 5F64A 1TBXA 2QQ9A 5D8LB 1M0OA 2VXZA 4IRIA 4M2JA 4EGYA 1S06A 1AAWA 3ZRPA 1MZBA 4M2MA 3L2CA 4M6XA 4JEVA 4WXHA 5BQTA 3A8UX 4MY5A 3QM2A 3BV0A 1TNSA 3JSOA 3TO9A 3EI7A 5BJ4A 3QRFF 1UU2A 1SMYF 5EFSA 5FB2A 1M0PA 2QUFA 4CVQA 4AZKA 4BHDA 2NYXA 2JGTA 1OYYA 1QZYA 3CDHA 1AKCA 1T38A 3GZ6A 5G4IA 5L3DA 1HSJA 4GRXA 4XSZF 4EM0B 4MQPA 3IF2A 4UHMA 1U5TC 2VLFA 2M8EA 4PVFA 2GSAA 2VC0A 4WXBA 1H9TA 1BI2A 3BDDA 1WYVA 1S29A 4S05A 2HUUA 4B98A 4QLCU 2C7TA 4Y0HA 3ECDA 3IC7A 3LG0A 4ASNA 1IVRA 4F7ZA 4IHSA 4RGSA 3WKSA 2D45A 3F8CA 1A04A 4ZYHA 2OU2A 5E18F 2HOZA 3FFHA 1KMJA 1B4XA 2FF4A 5D5UB 2VGUA 3E5UA 2KJCA 4XQ2A 2CG4A 2DKBA 2X4HA 4LG0B 3ZZKA 3QGUA 1ASGA 3G3ZA 2BBYA 3I53A 3PDBA 2OQRA 2WK9A 2MH2A 2VGSA 5EAAA 2O7CA 2YR2A 2F5EA 2YX4A 3DFGA 3GBXA 2RN7A 1L0OC 2EV6A 5E3KA 1KA8A 3TATA 5DJ1A 4MQRA 1DGEA 4DNCA 4CYDA 3F23A 4WLHA 1BIAA 5BMZA 5CJ9A 4M6YA 3BCAA 4TMRA 2HOXA 2CY8A 4DQ6A 2HWVA 4FT8A 4EV0A 4P9UA 3J80Z 2GXBA 2RC4A 2ZJ2A 1U08A 3GF2A 2CSOA 1OATA 2VE9A 3GYHX 3ISPA 3WTWC 5HDMA 5LHIA 4JQFA 2EH6A 2P8TA 1ZAOA 1FLIA 3GZCA 1TTYA 3EIAA 1IN6A 4KXKA 1R36A 4E1OA 3D5LA 2ZFWA 4RKDA 2P5LC 2CYYA 8AATA 3HDOA 1QJ5A 1YS7A 3QPTA 2OGAA 5E17F 4MQQA 4Y15A 1KU7A 2BV6A 2F5DA 4BA5A 3CO6C 4ETSA 3GVAA 4HYEA 4LG0A 2CH1A 4XK1A 1OKRA 1B9HA 1GC2A 4G7HF 1TOGA 5HS7A 3LVJA 4LB6B 2OBPA 1FP2A 2EA4A 1M6SA 1RVYA 2ZSLA 1D3YA 3QBOA 4EGZA 3GXOA 1KQ0A 1XSXA 1RI7A 3KE3A 1UU1A 3ZRQA 4RGUA 3I4JA 3E9KA 4EM2A 5JFRA 1D5VA 4A0ZA 1C7GA 4XEWA 3FX3A 3I71A 3R9AA 4ZH4F 1ZRCA 4YG2F 1FSHA 2D1VA 4KMUX 1XGMA 2BEOA 4IPAA 5FO5A 2XUBA 3HVYA 5FT5A 4ZASA 2XAHA 4LLLA 3LY1A 2GIVA 2L01A 5E5IA 3WTYC 3IRRA 3FFRA 5DUIA 3TQXA 2BGCA 3JTHA 3U9GA 3BPVA 3FVSA 5AIQA 1S7AA 5H6QA 2VIAA 1L3LA 5FT4A 1AIBA 5HS9A 1OXOA 3KZZA 3Q5FA 2KIFA 3LAJA 3M7GA 1CF7A 3FXRA 4FFCA 2ZXJA 1ARIA 3SZTA 1WRJA 5FLXZ 1ASMA 1DP7P 2Z9OA 1I27A 2A6HF 3KKIA 3RYRA 2WK8A 1LDDA 1O3TA 1ZGAA 2D1HA 3OV8A 1YS6A 3N75A 3CUQA 2C6YA 2P7CB 3PD6A 2C81A 1SFUA 1FYKA 2KRFA 3A9ZA 1JS3A 2D7ZA 1ASAA 3QU6A 4S04A 5D6EA 4UUVA 5D6FA 3C1DA 3P9KA 4DGTA 4ZYEA 1YFHA 5EUDA 1YJSA 3FVUA 3HOSA 4YFNF 4WXGA 1I41A 3N5MA 5JR3A 2EO5A 1Y0UA 1BW0A 1D7UA 2IRFG 4XJOA 4IHTA 5BJ3A 1ZYRF 4ESJA 3VOEA 3F22A 3NDNA 3MEXA 3GZ5A 4NB5A 3EETA 1LEAA 1IZ1A 1XMAA 3M8EA 2EFNA 2ZJGA 3NU7A 1QBJA 2CGPA 1WYVB 2YSRA 3NRVA 4F5KA 3T8TA 1GEXA 1SMTA 1SD4A 5D5WB 4ATQA 3IWZA 1AJSB 3K0LA 4A5NA 5TJJA 1GC3A 5E1ZB 3PJ0A 2PG4A 3RUYA 3EDPA 3DEUA 4I0AA 4PZJA 4JF1A 2HTJA 4A0FA 1EH6A 3HTSB 1HBXG 1EJIA 3VK2A 1J7KA 1SZSA 2VMSA 2DPUA 1FBSA 3II0A 3AEPA 4G8XA 4CO8A 4A6UA 1ODDA 2HKXA 4Q75A 1I6XA 3EIBA 3ZRRA 2EZ1A 5LRSA 2GMSA 3I4PA 2DKJA 3WLXA 1PG8A 4EJUA 5JHUA 4IRHA 1MLYA 4L9VA 1HQCA 2Z1YA 1D8KA 4ATPA 1XMKA 4XJPA 1GD9A 3LA2A 1ZODA 4EB7A 3PA9A 1TOIA 3BWNA 2XBNA 1ON1A 1HW1A 2CFXA 1SFXA 3J81K 3AEMA 4EQQA 3F0HA 3TFUA 4EJVA 4H51A 3UAKA 3W1IA 1IXSB 1BIBA 1B9IA 3DP7A 1XB4A 3E3VA 3LQRA 4HDVA 2QLRA 2IVMA 1EH8A 2KIMA 1IBJA 4R79A 4ZWVA 3R0AA 1ARTA 2L54A 4M9SA 3RTRA 1S3JA 1LJ9A 2K02A 5DYMA 2MBFA 4AWXB 2K4BA 4GE4A 5J6XA 4E3RA 3FM5A 4AOAA 3O3KA 2CWEA 1RVUA 2JJHA 2MC3A 3E2FA 1QZ9A 2EZ2A 2JTVA 3MC6A 4HBLA 2VGTA 1S6LA 2FE3A 1HXDA 3H92A 1AAMA 1X0MA 3JWAA 4FX4A 3GFJA 3LVMA 3WG9A 2BI2A 2PB2A 2WK7A 1BJWA 3NEUA 4PGGA 4A0GA 3GX4X 4EMYA 1USSA 3I54A 1UKJA 3WGBA 3U2RA 2VMVA 1V4RA 1IRGA 1RUNA 1W4MA 3F6OA 1I29A 2WKAA 2MLKA 4XJMA 1ONVA 4ENJA 1Y4IA 3JZLA 4F5GA 1JXSA 1ASCA 2OZUA 5E1XA 5HLIA 1FWZA 3D0SA 1UHWA 1IUGA 2QLZA 3J81Z 4AIHA 1YW8A 5EIGA 1ELQA 1SD6A 4RB0A 4RGRA 4RB2C 3V8JA 2HDCA 3TOAA 3E6GA 3MCZA 2FNAA 3B1CA 5DX5A 5BS6A 3LV2A 3JSPA 1HKSA 4M74A 5DUKA 2VBXA 2PBIA 1KYWA 2BIGA 3DU4A 3DZZA 2JZYA 2JG2A 2EV5A 2AY4A 2CO5A 1AHXA 4RGXA 2VMNA 3FMSA 2IA0A 3QAHA 4BHBA 2NAZA 2H09A 2XV4S 4WWCA 1G3TA 2Z67A 2QQAA 4P55A 4N0BA 2VN2A 3LVLB 1AY8A 4Q76A 2JRTA 5E8GA 2G9WA 3KP6A 2HUIA 3IHJA 4XRFA 1AMSA 2DGLA 1MGTA 1MDMB 3QPGA 7AATA 4RIZA 3FKDA 4HQMA 3L00A 4OMZA 1LDJA 1Z7UA 1QJ3A 2BKWA 5D5XB 2X5DA 4L9JA 1WI9A 3MADA 4WXCA 1GHCA 3ZMZA 2O6GE 1ASLA 3HRUA 2BI3A 3TKYA 3KP7A 4F5IA 2FNIA 4HVKA 1JE8A 1S8NA 4W91A 2XKPA 1VJOA 3N4MA 1FBQA 3DXVA 1G3YA 3RI6A 2KJBA 2ELHA 2IP2A 4YFKF 1AKBA 3M5UA 3K28A 3I0TA 1NHAA 1ULYA 4CHUA 2CINA 2HORA 2EB7A 3TCMA 3I58A 5HS8A 1I43A 1OR7A 1ZOBA 4W8IA 5LLQA 2AY3A 2QYOA 1YAAA 1QGNA 4I09A 2AY6A 3ECOA 2LKPA 3TO6A 1RZ4A 4BQ0A 3P7NA 1E2XA 2O03A 1LKCA 2X0LA 4LFUA 1Z7DA 2L3DA 3FXQA 2XIGA 4OIQF 2W7EA 3BN1A 1O61A 4ZM4A 4LK1F 2VMOA 3FWEA 4AD9A 3M8FA 3F21A 5G2QA 2D61A 4ZYGA 1MAQA 4GXOA 1XCVA 1B59A 4RKCA 1I5ZA 4QGRA 2BE5F 4WD2A 5CVIA 3MBBA 2FQ3A 3K7YA 4LLNA 1BI0A 3ROUA 1FG3A 1SF2A 2FNPA 1LB2A 1FZPB 5IT9K 2E1NA 4G94A 2LNBA 2W7GA 1O62A 2Q0OA 3E5QA 3WE3A 1C0NA 5DB5A 1YO5C 4XAUA 1AMAA 5K5RA 1GCKA 3C3WA 2Z9WA 2MLGA 4P96A 2W7DA 4WP0A 3K1PA 1JS6A 4CXFA 1PP8F 5HLHA 2ZCWA 4L0ZB 5E1WA 3ZN1A 3DXWA 3MZYA 1ZHFA 3GEZA 1QPMA 2DPDA 1PP7U 5F8VA 1CL1A 1H1CA 2VMPA 2F5FA 2PEXA 2YHKA 5G4JA 1Z6TA 2YOBA 2ETHA 2AY5A 2G7HA 2PMHA 1IF1A 4W1WA 2ADUA 5DDGA 4XSXF 4CDGA 3BS8A 4HAMA 1TATA 4EU1A 3HSFA 2KKOA 1W5SA 2EGYA 1YOOA 1SPAA 5DV5A 1AJRA 2A3SA 2XAJA 3IRQA 2Z61A 3PDBB 5G2PA 1H0CA 2DGMA 4A2UA 1YW9A 5L3EA 4W5KA 2GAUA 2CJDA 5F6FA 3TGNA 2VGWA 4CGZA 4ESBA 1J9IA 2O0YA 2EPJA 3BWNC 4M71A 2FBKA 1BQDA 2Z3YA 3NQOA 3FMRA 2M1BA 1FT9A 1VEFA 2V1UA 3B1EA 3MAUA 2HS5A 3HRMA 2RDPA 1AOYA 3R6SA 5HDNA 2W7MA 3G73A 2VBWA 1TW3A 5LGTA 2AEUA 4HA8A 4L9NA 1I48A 2W8UA 4NQWA 3A9YA 4Q5SF 3RBLA 4LJZF 1R1TA 2A68F 2OZ6A 3BWOA 1FPQA 4WXDA 2CQKA 3PPLA 2H6CA 2BIEA 4WYGA 2VI9A 1IN4A 1LVAA 1LC5A 2V79A 5D8KB 3IKTA 1Z6RA 1XDSA 3ZMTA 4OTLA 3KE2A 4ZDLA 2G6WA 1ZG3A 2FBHA 1O7FA 1XCBA 4ITXA 4JEWA 1WKMA 1UCRA 1TLHB 4HF1A 1MD0A 1O4SA 4WYAA 5FD5A 4AVPA 3ELKA 1XGSA 4YIIA 4CXRA 3FHZA 1J32A 1SFFA 5D5SA 1AICA 2FEZA 2UXXA 1X28A 3KGWA 3QU3A 3WTTC 1QNTA 4B8XA 3I16A 3GZDA 1P3WA 4A0XA 1C0WA 3VK4A 3AEOA 1QISA 3WTSC 4HOBA 2HFHA 3KZYA 5ILUA 5HOOA 5EIGB 4HQEA 1W5TA 4N0WA 1ARGA 3VAXA 1PFFA 1BI1A 4QWQA 2NNYA 2HUFA 3LQQA 1K6OA 3E2ZB 2VIBA 4J5UA 2OD5A 6PAXA 2JJGA 3I59B 1AY4A 5HXXA 4ISYA 4UHOA 2YU3A 2JPCA 3AELA 1ZLJA 3LA7A 2DK8A 3CO7C 1DPRA 1PMMA 1ZREA 5LBQA 2Q7WA 4UVBA 1KKJA 1T98A 4WCGA 5D4RA 3FRKA 4JE5A 3PQKA 1P6RA 2W25A 3UWCA 4B09A 5A2QZ 2M30A 2DO7A 1ZRFA 1DFOA 1G4VA 4FX0A 1BM9A 4RAZA 2ZBKA 4IRGA 1YYVA 3H14A 9AATA 4P9FA 1UHMA 1JHFA 1U6GA 4KIFA 1QGPA 3FZ7A 1RNLA 3NU8A 1LC8A 2EJRA 1ZGJA 4HLXA 2P5KA 3F8BA 4LW4A 3C7JA 2ISYA 2PO3A 4PFFA 1C7NA 5E20A 4UVAA 5FD6A 2JT1A 2Z9UA 3GETA 3FCRA 1TQMA 2STTA 4Z2YA 5FT8A 1FX7A 4OBUA 4NOGA 4BMKA 4HX8A 4ZZLA 3HUGA 3AEJA 1YJYA 3DPTA 3KP3A 2DBBA 1ZC9A 3COAC 1OHWA 4Y17A 1V2DA 2HOEA 4I98B 5F1RA 3FVXA 4MSOA 2HP2A 1ASEA 3ZPLA 2W8JA 4OMAA 4DBCA 4ENMA 3Q9VA 3LVKA 2W8TA 2VOOA 3SFZA 4I0BA 1BBYA 4L5JA 1ARHA 3FSLA 2PLYA 4UV9A 1MJAA 1TARA 3QPHA 1ORDA 4L18B 2Z20A 2VT3A 1GVJA 2AEVA 3H3UA 4AIKA 3GR9A 1KQ8A 4JEXA 5FT6A 1B5OA 1BI3A 4GO1A 2ZNZA 4ZM3A 1G4DA 3AEMC 5HDKA 1KMKA 4ADDA 4L9TA 3GFLA 3D6KA 1DTYA 4UHTA 4WYCA 3JTXA 2STWA 2XAGA 3HT4A 2LF7A 4WF2A 4GEBA 1FC3A 4A6EA 1FG7A 3RKWA 5K5QA 1E5FA 1MJ9A 1FC4A 4GE9A 3R60A 2YRRA 3HSEA 4MKKA 2A61A 2CJGA 3AV7A 2R5CA 1TOJA 3DODA 1YG2A 1T2KA 4JE5D 1TW2A 2R2NA 3DR4A 1K78B 3EUCA 1W23A 2VODA 4OIOF 3BY6A 1SZUA 2Z33A 1VP4A 3GFIA 1IAWA 2VI8A 4MTEA 1YLFA 2HYGD 4U88A 5CVVA 5ERIA 1GXPA 1QQIA 1D7SA 2BHXA 4XJLA 3NYSA 4A12A 2Y0MA 3JAMZ 2HEOA 3V4GA 3DRDA 3K2ZA 2W85A 3FQ8A 1YJZA 4RJYA 3AOVA 2YX7A 3B02A 3B1DA 1G7XA 5D5VB 3L8AA 4U7BA 3WTVC 3KLNA 4M9XA 3PD6B 4UOYA 2XGXA 3AAFA 4EB5A 1F4KA 1B9NA 2GZWA 1Q1HA 4ZSYA 3BJAA 4PFNA 1TOKA 2ZC0A 5J8QA 4KYWA 3F8MA 3NYTA 3F6VA 3RKYA 3ULQB 2JISA 3LWFA 4RAYA 1OYIA 2GB3A 2R7FA 4F5LA 3BJ6A 1U5TA 4I2OA 1MJBA 2O61A 4ON0A 2H27A 1J04A 2BWOA 2V9VA 2CJHA 3NNKA 2LSOA 3M9AA 5EQCA 1BJAA 5TRDA 1N31A 3G0TA 4KIGA 3WU0A 3DF8A 2DI3A 2D2WA 3JAMK 4AO4A 1X3UA 4KYOA 1WSTA 2OKKA 1EQBA 2BWNA 5L3CA 4MKJA 4HX4A 4R1HA 4O5VA 3DC1A 1MDOA 1ASFA 2DAOA 2V1DA 5CYVA 3FZ8A 4I8AA 1DJUA 3H7FA 4OINF 4L0YB 1I1SA 2YCTA 1J0RA 3R4KA 3RKXA 2ZKZA 5E8IA 3P6KA 3AENA 2VBYA 5L3GA 3KETA 2AY2A 1CQ8A 4KAMA 1ZARA 4E3QA 1UFMA 5FGMA 1R1UA 2EV0A 1V3FA 3FMQA 1ZLKA 3TDZC 4A72A 3I64A 3VOMA 4RB3C 1WKGA 4XBFA 3V8KA 2FNUA 3HMUA 4G6QA 3DR7A 3MAFB 3SHFA 1B8GA 1LEBA 1SD7A 2OAZA 2M87A 1P4XA 3B73A 1XSDA 2IT0A 2QVOA 1QIRA 4HF0A 4RB1A 3RPQA 1IAXA 4EFFA 2O0RA 2O3FA 3T5XA 1AHEA 1WYUA 5AX8A 3KCCA 4ITGA 4O6ZA 5LRRA 3FDBA 4LMYA 1R23A 2YKVA 1IJIA 3WKRA 5F9SA 4GYIA 1CGPA 5LEJA 1AY5A 1MDZA 3WODF 2HTSA 4HDUA 2MA3A 1T3IA 2PN6A 1CZEA 1OHYA 3IWFA 3JWBA 4LC3A 4MGRA 2R0TA 1IN7A 3GWPA 2VMYA 2GQNA 5TF5A 2VMUA 3WE2A 3GFMA 1ASDA 3QHXA 3AOWA 3UE8A 1BC7C 2W84A 1RUOA 2L4AA 4M73A 5HLGA 3BB8A 1BOAA 2E7IA 3ELEA 1SAXA 2ZO4A 2D5YA 4K2IA 4ADEA 2PQ8A 2XRNA 3FD0A 1PUEE 3CQ4A 1IXRC 2GXGA 1FSEA 2DOUA 1V2EA 3AATA 4EJWA 1YIYA 2EFOA 2VMXA 3GZDC 3W6KB 4OYTA 4W1XA 1S0AA 1DPUA 2YKXA 1MKMA 3KLOA 4OC9A 4ENNA 3EI5A 4KN7X 5DCMA 2P4WA 4M72A 3PDXA 1FNNA 2PFBA 2Z99A 1G3SA 1ZG1A 2BYVE 3ABUA 1R22A 3QOPA 2FOKA 2ZNYA 4L5IA 1AMRA 1CQ6A 1S07A 1U5TB 2AXLA
chains in the Genus database with same CATH superfamily
1T0FA 3HJEA 1K7AA 2OJED 3V7CA 4R5FA 2VXDA 5CVJA 3HTUA 3W6JB 3RI4A 2DTRA 4AYBN 2K7LA 2PI0A 4ZZDA 2P81A 1JGSA 3PAAA 3DBRB 3K1NA 1IW7F 4KA4A 3R61A 2YRIA 2QQBA 2VKDA 2CSTA 3MC6C 3P9CA 5IT9Z 2VMZA 2EFWA 2XPUA 1FYLA 4UQVA 4B9BA 3QYEA 3WTZA 4IL6C 2PB0A 2EBIA 1EV7A 1BW5A 1LK9A 4PJMA 4NC8A 1DKAA 2RFVA 1U3EM 2DJIA 4R8DA 4XR6A 2PJPA 1C7OA 3ML6A 3ZMVA 2BI5A 3CCLI 2YS9A 2M5WA 3E7LA 2FM1A 1SEUA 4M3EA 3DU6A 2CQQA 2QMAA 2RVCA 2BI9A 3O6BB 1Z3ZA 3DXJF 4HF8A 3BWGA 4RM2A 1WI3A 4HZFA 3CBFA 2L4MA 4IJAA 5K5OA 5DCFA 4BJTA 4A3MJ 1QRYA 2VI6A 2IA1A 3CQZJ 3ZQFA 2VUMJ 5IWQA 4MHGA 2CH2A 1B72A 2BHYA 1T39A 4RLGA 5JHFA 1APLC 3BTLA 2W7HA 4I01A 3V8LA 4KITB 4IVNA 1X29A 3GSBA 1JKPC 4KT5C 3MAFA 2LF8A 4UHNA 3CCYA 4WYFA 1GVDA 2AY9A 2TPLA 1IUYA 2P6TA 2X8UA 4A6RA 5K7ZA 2Z9VA 3FQAA 2YPRA 1S08A 2CU7A 3HBXA 1ASNA 3RPUA 3PFYA 1CQTA 3L09A 1K78A 2LKXA 1GEYA 1T6SA 4ZYDA 4LIUA 2JJEA 1LPQA 4BA4A 4I99C 3WCOA 3CJNA 1N25A 2COBA 3ZQLA 2R7DA 2XSDC 1LW4A 2DQLA 3AENB 4EMSA 3E1SA 3DLLF 1DJ9A 4JOMA 5M5YJ 3B8XA 3M8JA 3OSGA 4MEXF 3CLOA 1WYTB 3F6TA 1D1CA 2P5VA 3SEQA 1DU0A 3DTIA 5CKTA 2IS6A 3BTJA 1XI9A 1X2MA 2MC4A 4O6JA 4BDYA 3WCNA 1SVMA 1HCRA 1W0TA 2E1CA 2UXNA 2WC2A 2CB1A 4YIFA 1XPXA 4IHVA 4LLGF 2XF6A 3RQ4A 5DM7F 2DA4A 2HQ5A 4LITA 3T32A 2QKMB 5IPAA 3HOTA 3HQTA 3FZ6A 1C9CA 3OYEA 2YKUA 1IO2A 2V1PA 4WB0A 2RQQA 2WB1N 2Z5UA 1HKTA 1JI8A 5HODA 4PUSA 1WGXA 2KIUA 3CMMA 1PYVA 3HHHA 3W1HA 5B5EC 1AJSA 4JEYA 1USTA 3A01A 3DCFA 5EUEA 3OSFA 3K4LA 1F5TA 4L0OA 1JUSA 4ZDOA 2JPBA 5FKLA 2DOAA 2QBTA 3QPLA 1MDMA 2GMUA 2LR8A 2QBYB 1POGA 1AHYA 2EWNA 3ZR8X 2VYCA 2IA2A 4A6DA 5FLVA 1QZZA 2EFQA 2HZTA 5EGOB 3L7WA 4D0PA 2Z9XA 2XKOA 4LIVA 4EM1A 2Y75A 3ABTA 3BCBA 1YITI 1BKGA 4IHXA 4D7MA 1Z05A 2BWPA 3SZPA 2LRDA 3QI6A 3I9V2 1P4AA 3S93A 2R7OA 1YRNA 4RDUA 3J7AO 1BJ4A 4B4CA 4F4EA 3HYIA 4HPQA 5FKMA 1YI2I 1FYMA 2X85A 3G1LA 5BPDA 2OATA 2ELKA 3ASBA 1JTYA 5AIPA 3REOA 3CCQI 2VBZA 3Q9SA 1U8RA 4UUSA 4BY1J 1IX7A 3JU7A 4IOAF 2FXAA 1PMOA 1ZG5A 1ACIA 1GC0A 4CCKA 3H0DA 5E4ZA 4ZC3A 4HW0A 4OOIA 5J8FA 2FA5A 1O7LA 4C9YA 1O69A 2K85A 3VWBA 1C4KA 1X2AA 2NMPA 3PGYA 2XB0X 2HDWA 1R7JA 4IXZA 1XGNA 1TASA 2Y31A 1G4XA 5CVRA 4E4HA 1ETKA 3TFTA 3QP5A 2W8VA 1SVLA 3BR3A 1AKHA 2GLOA 2G0EA 3PNYA 4M9ZA 5F0CA 4AH3A 5KK1A 2VOPA 1BQAA 2BW3B 1XD7A 2VL8A 3OP7A 1YNUA 3ELPA 2QCOA 1N75A 3RCOA 3NUBA 3PUFA 3RPUD 3IUOA 3JW4A 4KN4X 2WWYA 3EI8A 1K4SA 1R58A 3VK3A 1DDNA 4XKWA 2YU9J 1IUFA 1IXCA 2D63A 4PFPA 1WWXA 4QPOA 4JF0A 1BA5A 3TL4X 1W7MA 1GDEA 2ZSMA 5HLTA 1BS0A 4PDKA 2YUSA 4KIBA 2XAQA 4HV5A 4MNUA 3TO7A 1FP1D 4E7JA 3DQVC 1CF7B 2L7MP 2VMRA 3H1CA 3KP4A 4UNOA 4BAYA 2DT5A 1R9TJ 3HOZJ 2W7JA 1R1VA 2ZUKA 2L7KA 1YQAA 2A5YB 3T8RA 3CCEI 3CQ5A 4MEYF 2E2HJ 3MZHA 4BDZA 1YRNB 5FKOA 3PSIA 3LSRA 1HKQA 2Y0SN 4PIWA 2BYJA 2YKYA 1B9MA 5EEGA 4IHYA 3L44A 4EJTA 4WB0B 4F5MA 3DBLB 3LSKA 1NTCA 1X2NA 3I59A 4P5OA 1YTYA 4PJLA 2D66A 5HHYA 4K2BA 1ZR2A 2JJ7A 5J47A 3MD2A 2DMPA 3CUOA 4A3KJ 1SD5A 2MD5A 3H3ZA 1W7PB 3FZVA 4FE7A 3S3MA 3RZOJ 3A03A 3E2ZA 2QBYA 3JRBA 3NTJA 5A2QK 2BY3A 3HIFA 2NNNA 1LFUP 3VODA 5DD4A 1UJ8A 5EYRA 1SVVA 1A36A 1QZEA 4AM3A 3RBFA 4P3MA 3BPXA 2AATA 1TP4A 3PDBB 2VJJA 3FXLA 4BXUA 4E6KG 2E7UA 4A0HA 5EJCA 1I3QJ 1KKPA 3KGXA 1UG2A 4U0YA 4XN3A 2IBDA 1V55H 4CZZA 2VJIA 2FSWA 3K4KA 5JVTA 2NOGA 4Q48A 4W97A 2WV1A 3TW6A 1YJ9I 3TDUC 2QSGX 4EVIA 2H6BA 2VC1A 1TL8A 2TDXA 2VLHA 3P9IA 1BN5A 3PQJA 3T0YA 3S1MJ 4F93B 1GEWA 4JP0A 4IW7A 4A0YA 4NDLA 2HYJA 4F5JA 2UWMA 1RV4A 1Z0XA 2R3SA 2RKHA 3BJOA 3HOXJ 1V2FA 2K4JA 2TCTA 1WYTA 3QYBA 4BHPA 4OBVA 3JW9A 3H9QA 1R71A 3BROA 3WY7A 2ZJRF 3BQZA 1D2FA 1SZKA 4GDYA 2EFPA 3WTUC 5M49A 2E54A 3RIRA 3E97A 2JJFA 2A07F 1ARSA 2OKJA 2DR1A 1OCPA 2Q1ZB 4XLFA 4K2EA 1KYZA 2KP6A 5LHGA 3CMAI 2DDBA 3CAIA 1ELUA 4X0GA 4C2UA 2E7JA 2HI3A 1RESA 1MNEA 1JJ8C 4A0RA 5EEAA 4KNYA 4GSAA 4R2NA 4Q47A 3PSFA 1UB9A 4A5MA 1LS3A 3OIOA 5L3FA 4XNFA 1Z67A 3KFWX 3OOPA 1IRZA 2XF5A 3S14J 1AWCA 3ZMUA 5C6UA 2VT2A 2OCEA 1WKHA 2WAQA 3W1JA 1WJ5A 1Z3YA 3OYIA 2JA7J 1T33A 5LHHA 1WSUA 3LSHA 1XG1A 3E6BA 1ORKA 3WU1B 4XKBA 1YIOA 1YX5A 4WBTA 3FF5A 2OGEA 3ZZJA 5HDGA 4AO9A 4G9YA 4KT6A 4MQ9F 4QSHA 1TT0A 1SFEA 3FKJA 2EZHA 5H2FC 4P7YA 5LEKA 5BPIA 4JBAA 2FUG2 1AHGA 2O1BA 4TV7A 2K86A 3F8NA 3HHGA 3LL7A 1TZLA 4WX9A 4XLAA 1KL2A 2FMLA 2VMQA 4HF2A 3FM3A 4RJ0A 1OR7C 5G0AA 1XTAA 3GTMJ 1OCCH 4MQVA 1EG5A 5DCMB 2MD0A 1X1AA 1DJEA 3ECHA 2DN0A 1YW7A 2QA3A 4AZJA 3ASAA 5K8BA 2RQPA 2WAQN 3MAJA 3QYFA 5F0FA 1DU6A 1RIOH 1KU9A 3HM5A 3E2YA 3AG3H 2HYFA 1HW5A 2DW4A 4W1UA 2XROA 3S15J 3OL3A 1KU2A 3HL2A 3EZ1A 1MIJA 2HKOA 3BZKA 5B66C 1TNTA 2JA8J 3CC2I 3RDIA 1BC8C 2W24A 3M4OJ 1BJNA 3KYDB 2WBMA 5I92A 3DKWA 5KVRA 4IYOA 2ECBA 4XL9A 3GTGJ 2WTEA 1BL0A 1XDUA 2Q2EA 3S2WA 2CQXA 1W7PD 4DBQA 3AKZA 1FOYA 1LDKB 2M45A 2FN6A 2F2EA 3AG4H 4U7DA 2ACJA 4ZWMA 2HQNA 3IH3A 2W57A 1ENHA 1OMIA 3JR9A 1OXPA 4Y13A 3AG2H 4E77A 3K69A 3DPUA 1OHVA 1EH7A 3BP8A 3O2PE 3ZQHA 1W7NA 2IS2A 4KICA 4PCQA 1TQPA 3T1BA 1MH4A 1JUMA 1MBEA 2IW5A 1EKEA 3EYYA 1Z21A 3F72A 3WHCA 3CC4I 1G7WA 3DYDA 1FOWA 1E3PA 5EEHA 3EUHC 2UZKA 4WLJA 1MBGA 2P6SA 4PJNA 2O8KA 4OMYA 2WB1A 1IAYA 1ZKGA 2HU9A 4JEZA 1O3RA 2GA2A 3USFA 2JA2A 3CUQB 3OYFA 1QPIA 4H0EA 2E71A 3JCUC 2M7BA 3FDBA 3RQIA 1MAPA 1WQ2A 2ESNA 1H9GA 2VONA 2DOEA 2D64A 4MIMA 4BH9A 4IY7A 1QITA 5C4XJ 4I02A 1AX4A 4KFCA 3LWSA 2HQRA 4QIWN 1F1ZA 2AHQA 3G1OA 5LGUA 1GBNA 2O5RA 2E7XA 3NYUA 3M1EA 1KU3A 2D5VA 4GRIA 3J7AY 1WJEA 2K9MA 2G7UA 3OYCA 5FFZA 4AIJA 1Z9CA 1J2XA 1IV6A 2HVRA 3K70C 2CQ7A 2BI1A 2EK5A 5ILVA 3PM1A 1S09A 2C0RA 5F27A 3WGHA 4J01A 1SANA 1B4AA 5B1AH 1S5LC 3A2BA 3LAPA 3VB2A 3EI9A 3QP6A 1J59A 2ZYJA 2PX9A 5GPCA 4YELA 4PJJA 4LNLA 5LGNA 3E6DA 4E70A 2XVCA 1D8JA 2HR3A 4G6DA 3B46A 3VDXA 2CFBA 3FDYA 2AS5F 3DLAA 4ENKA 2X1CA 1VQKI 2FRHA 4B48A 3VEPA 4M3GA 1IN5A 4LK0F 1VF9A 1DUXC 2X51A 1D1AA 5J3LA 2W7NA 1JKQC 5ICGA 1ZK8A 1WYUB 2GM4A 1ZN2A 5FLXK 3WTXC 3TQNA 3CCSI 5ICEA 1B1BA 1MGVA 4OIRF 2NRAC 3BR1A 3K6GA 3GTQJ 4LNJA 1CL2A 3ZXSA 3IAS2 3LA3A 4HNTA 3D1NI 3L2WA 1TWGJ 3GW2A 4WYEA 5G09A 3C2GA 5CQEA 4RAGA 1XS9A 4NNJA 2RV8A 1SVOA 1V5GA 1JF9A 3SXYA 2W7FA 1JHHA 2DA2A 1W1WE 3AFHA 2VLAA 1H88C 2BHZA 1VQ4I 4KMFA 5IT3A 3RKQA 3KEOA 5GADJ 5M4DA 1M0QA 4RITA 1WJBA 2CW0F 2Q8KA 4YEJA 4A00A 5IOZA 3MQ0A 1Z7LA 2VE8A 3JRGA 2O8XA 2VMTA 5L3BA 1N8PA 1VTNC 2OA4A 4WK8F 3WGIA 3OL4A 3A0HC 1AMQA 2BVLA 1V54H 2OQGA 1D5YA 3ACZA 1IC8A 3EUHA 1ON2A 4GYGA 1V72A 4ADBA 3MKZA 1BJOA 2R0QC 2A69F 2KZGA 4BQQA 5AONA 3BZ6A 2JVGA 4Q31A 1J5YA 2FJ1A 3EUKL 4RAEA 4N9HA 4WYDA 3HPHA 4FHTA 5F1JA 4IYOB 4XLPF 3QODA 2J5PA 2V6CA 4AU7A 3CCUI 3S3NA 4RS8A 1G6NA 2PMUA 3RJPA 5CVUA 4II3A 3DV8A 1R00A 4U1TA 4CBRA 1SC7A 4PGHA 3CZ6A 3B6CA 3HG9A 4UXNA 2DA3A 2AY7A 2W48A 5JVGF 1UMQA 2XHKA 1GC4A 2JMWA 2B0LA 1WH7A 2F48A 2OF7A 3GWZA 5ICCA 5TISC 1LQ1A 2D65A 4NC6A 3GJUA 2QZ8A 4HNUA 1AKAA 2DLLA 4OT8A 2ESHA 4UVCA 2W8WA 5D95A 1OQYA 1Z91A 3E6MA 3MEBA 4C3HJ 3A9XA 3ZMDA 2FYFA 2HOTA 3IHUA 1TQIA 1MDXA 5EAVA 3LFKA 1F9NA 1LFBA 3K9TA 4ZDPA 2HOYA 4ESFA 3MWMA 1ETXA 2ZMEB 4Y4RA 3G8MA 4J8LA 4ADCA 1ZELA 2AO9A 2RGVA 2Z1ZA 2KFDA 3TOBA 2DYSH 4IXSA 1AHFA 3H5NA 3RCHA 2KT0A 4IF4A 2HVQA 4O3MA 1XMXA 4LD5A 5HVQC 4OWRB 3C18A 3LSTA 3CF2A 3OS2A 1JKOC 2Y48A 1GXQA 2ELJA 1BT4A 1M7YA 1AIAA 4CYCB 3COGA 4CCMA 2DJNA 5DEQA 5IYBJ 2VGZA 2A5WA 2LFBA 2KDZA 2LH9A 2R7VA 1XEYA 2GQQA 3OR2C 3AL0B 3GUDA 3E77A 4FL0A 2KPMA 5J4YA 4FTHA 1D7RA 3PO3J 3R4TA 5DJ9A 2XH1A 3FTBA 4FISA 4MTDA 5LH9A 2MFZA 3E5XA 1ETOA 4B47A 1N2TA 3ZN0A 2CANA 2E7WA 2HQAA 3KP2A 2ZP7A 1ZH5A 4K2MA 4F91B 1P4WA 2CTZA 5EUNA 2W82A 3WZFA 2DK5A 2R5YA 2R5CB 4CH7A 2LTPA 5EZHA 1FOKA 4UUSB 4ZSWA 4D5CA 1GT0C 1R5GA 4U0VA 1TOEA 2VKEA 3OOUA 4LW2A 1N78A 2F8JA 4DQ2A 3HSRA 2V1XA 3VYSB 3OIQA 3SDBA 2CV1A 4U2HA 3N97A 4FCYA 4DYQA 2QM3A 3QN6A 5FKKA 1B5PA 4I6ZA 2FQ6A 3C2BA 1VQOI 2HP1A 2W7LA 3HLMA 1H0MA 4CBSA 4Y0IA 4II2A 4XICA 1CQ7A 1LW5A 3RQ1A 5EDNA 3BC8A 5H20A 2EZKA 1CJ0A 2DMNA 4N9IA 3Q8NA 2K27A 3I5TA 3WGCA 4BHCA 2EPFA 4R5ZA 1XSVA 1B6AA 3EYIA 4OU0A 5KNLA 2PMZA 1OYWA 3VYTB 2HNHA 5C4JJ 4A3EJ 1LC7A 1J75A 1HDDC 2VASA 4HX7A 3A4CA 3GO5A 1W36D 2D7YA 5M46A 4UV8A 1T8IA 3EZSA 3I4MJ 4JYKA 2R7TA 2W7KA 2HXOA 2O7OA 2JK3A 4XORA 3V7SA 1G3WA 4QTRA 4BNCA 4YFXF 5CLSA 2VQLA 3A02A 2K3PA 2COMA 4GCVA 3RYPA 1O3QA 3FQ7A 2MH9A 3Q0UA 3U1DA 4E7SA 3HRSA 1P2FA 3PUBA 1U2WA 1W7PA 5JLXA 1HW2A 2FU4A 3Q0VA 2WY7Q 1FEXA 4M2KA 3EUAA 4GGGA 4JX5A 2OUMA 3MKJA 1IN8A 3HB9A 5DD8A 2VGVA 5FFXA 1G59A 2P7VB 4W1VA 4ZLVA 2AY1A 2E5NA 2F4OB 3S2DJ 3BOQA 1E5EA 2XAFA 2ORDA 2QB2A 3VFZA 3WGGA 1PDNC 1WPKA 4NHJA 1MMDA 1OCRH 4FETA 3R0JA 3CUQC 1BW6A 4F5FA 3P1TA 2EA2A 1E3OC 4I7HA 3ZP5A 3CTAA 3EI6A 1DGDA 1IRFA 2OPTA 4U0WA 4R8HA 1IX6A 1CZCA 3IL2A 1ASBA 3ISLA 1W7LA 4YIRX 1V5FA 3K7AJ 4G7OF 2X6OA 1VQ8I 1H89C 2PJRA 1R5HA 4BEHA 1CS1A 1P7IA 3F8FA 5J8CA 4IXOA 1IX8A 2V9KA 4F5HA 4AVZA 3HPGA 5ED4A 1U0JA 2FMYA 3SQNA 2IXSA 2M4KA 4HLYA 2F5CA 2DU9A 5KCMA 2AY8A 3F9TA 2R5EA 3I5UA 2DMQA 2DXIA 4RMNA 2LDUA 4CYCA 2BYLA 1P92A 2DFEA 2DA6A 1LE8A 2ISZA 3E6CC 1U78A 2HGCA 2K9SA 1KGSA 2WAFA 3L2VA 3DPLC 1V5EA 1JJ6C 1KL1A 4RA2A 1O3SA 3KEQA 3RCHB 5M4BA 3F3XA 3KP5A 1U8BA 3HKZA 3H9JA 2V4JC 3L9FA 4V2GA 1M4NA 1IV8A 2KIQA 2XC7A 4CXQA 3ERED 2ZMEA 1Q1VA 4BQAA 1STZA 4LGWA 4E7ZA 1VNDA 5D4SA 4IX8A 3CQ6A 1M32A 1RV3A 5JI6A 2KQRA 3ZQIA 1ZGWA 2HPIA 3GLXA 4KUMA 1I6HJ 3V7RA 1BR1A 3J80K 3GCMA 2K3FA 2L02A 1HSTA 1IG7A 1TWAJ 3ZMSA 3ATHA 2X3LA 2GWRA 4Y0DA 1LNWA 1AA7A 2WAEA 1MBHA 2YCNA 1XGOA 4BYYA 3AEJC 5EGOA 1QO0D 3ZQ7A 2HZPA 1FMWA 4A93J 3NX3A 5K1YA 1O57A 1FBUA 4WXFA 1I1GA 4XLNF 2GA1A 5H6RA 2CRGA 3ZOBA 1Z3XA 2NVXJ 4Q4ZF 4KDPA 4HV6A 2IS4A 2OCCH 3BCXA 4ZAHA 3DU5A 3H3VK 2C44A 3HRTA 3FK7A 3A01B 3HGGA 1YOVB 2J5OA 3B6AA 3FXUA 5IYCJ 2BIAA 1K79A 1ECXA 2QB3A 2FBIA 2VJ5A 3WHBA 1NK2P 3HXLA 1ZRDA 1Z1DA 2EIMH 1MLZA 3GTJJ 1BJOB 4JK1X 4EATA 3N0LA 2CJJA 4A3FJ 3GMEA 4IXAA 1XN7A 3C2HA 1KQ9A 1OPCA 2R7XA 1AU7A 2JSCA 4OCAA 5LHAA 2H94A 1FY7A 3M1CA 4JX4A 2BOLA 3KPHA 4RM1A 2Y0SA 2DQRA 5ICFA 2V0YA 1TPLA 2PMZN 4E7KA 3G7QA 2VMWA 4EJOA 1K61A 2IJLA 3ASOH 5JAYA 4LNMA 2OC6A 3BTIA 4LB5A 3WX9A 3IKVA 5ILSA 1S7OA 3NAUA 2NS0A 5IP6A 2OQXA 3K40A 3VPRA 3NUIA 4Q6RA 1X3WB 1YIZA 3MFKA 2WV0A 4OIPF 2YCPA 1E17A 2QWWA 2A6EF 2OV7A 2OTJI 1P9QC 2X6WA 3EQLF 3PFIA 2X5FA 4CICA 2IPQX 4GE7A 2XASA 1W3UA 5BOXA 3K1MA 4MO7A 5KAFC 2DFIA 2LG4A 2RNJA 1M0NA 3JRDA 2QENA 3KX2A 3JTGA 4GFBA 2R7UA 2K40A 2BZTA 2MABA 3BZCA 1REPC 3HOUJ 2XGEA 4UB8C 4A6TA 4TN4A 3OKSA 3PIUA 2JSPA 2W7IA 1D7VA 2ECCA 1A6QA 1JG8A 4G7ZF 3VP6A 3BG5A 1UU0A 5F64A 1VQNI 1TBXA 2QQ9A 2ME0A 1D0XA 5D8LB 3S1NJ 1M0OA 2VXZA 5GTHC 4E7HA 4DIQA 4IRIA 4M2JA 4EGYA 1S06A 1YX3A 4YRVA 1AAWA 3ZRPA 1MZBA 3OYHA 4M2MA 1ETWA 3L2CA 4M6XA 4JEVA 4WXHA 5BQTA 3A8UX 4MY5A 3QM2A 3BV0A 1TNSA 2H1KA 4KJZA 3JSOA 3TO9A 2GOMA 3EI7A 2F4IA 3JRCA 5BJ4A 3QRFF 1UU2A 1SMYF 3K4MA 3S1RJ 1RKTA 5FB2A 5EFSA 5F04A 3JRIA 1FTTA 2QUFA 1M0PA 2VQGA 2ZJPF 4AZKA 4BHDA 2NYXA 4CVQA 2JGTA 1OYYA 1QZYA 1RPWA 3CDHA 2EINH 3WU2C 3N05A 1W36C 2WADA 3DTEA 4UUTA 1T38A 1AKCA 2JQ7A 3GZ6A 1XC5A 3D5RC 2LP0A 3BG3A 1NK3P 5G4IA 5L3DA 1HSJA 1IDYA 4GRXA 4XSZF 4ZJZA 1VQMI 4EM0B 4MQPA 1OJLA 3IF2A 2P0WA 1VQPI 4CCJA 4UHMA 1LKXA 1U5TC 2VLFA 2M8EA 4PVFA 2GSAA 2VC0A 4WXBA 3SZGA 1BI2A 1H9TA 4JX6A 2V6EA 2DCEA 3NARA 3BDDA 2CMPA 2X9DA 1WYVA 1S29A 4S05A 2HUUA 4B98A 3ABMH 1T95A 1R49A 4QLCU 4IEJA 2FX0A 2HVSA 5K7HA 2C7TA 4Y0HA 3ECDA 1FIPA 2E1MC 3IC7A 2MGQA 4ASNA 3LG0A 1IVRA 2JA6J 4F7ZA 4IHSA 4RGSA 3WKSA 2D45A 3F8CA 1Y0NA 2E1MB 4HEA2 1A04A 4ZYHA 2OU2A 5E18F 2HOZA 3FFHA 2Q2EB 1KMJA 4BE0A 1B4XA 2FF4A 3KYCB 2X1DA 5D5UB 2VGUA 3E5UA 2F5VA 2KJCA 1Y8QB 2CG4A 2DKBA 4XQ2A 2X4HA 4LG0B 3ZZKA 3QGUA 2R92J 1ASGA 1DP3A 2I10A 3G3ZA 2BBYA 3I53A 3G1MA 2VQHA 3OMYA 3PDBA 4RLFA 2LK2A 2OQRA 2GXAA 3HOVJ 2WK9A 1WCMJ 2MH2A 1RR7A 2VGSA 5EAAA 2O7CA 2YR2A 4P1WA 4ITVA 2F5EA 2YX4A 3DFGA 4BBSJ 3GBXA 2RN7A 1L0OC 2NOJB 2EV6A 5E3KA 1KA8A 3TATA 5DJ1A 4MQRA 1DGEA 3BQYA 4DNCA 4CYDA 3F23A 5F0HA 4WLHA 1BIAA 2B7EA 3OS1A 5BMZA 5CJ9A 1MBKA 4M6YA 3VYUB 3BCAA 4TMRA 2HOXA 2CY8A 4DQ6A 2DOFA 3SDGA 2HWVA 4FT8A 4EV0A 4P9UA 3J80Z 2B9SA 3OYJA 2RC4A 2GXBA 2ZJ2A 1T08B 1U08A 2KHMA 3GF2A 2CSOA 4J00A 2XGDA 2VE9A 1OATA 3GYHX 2W7GA 4A3JJ 4OAYA 3ISPA 3WTWC 3ZQCA 2FD5A 5HDMA 3L2UA 5LHIA 2NS8A 4JQFA 2EH6A 2P8TA 1ZAOA 5F08A 1FLIA 3GZCA 1A5JA 1TTYA 3KYLA 3EIAA 1IN6A 1B8IA 1R36A 4KXKA 2UV1A 3UNGC 4J19A 4E1OA 3A1YA 3D5LA 2ZFWA 3GTPJ 3G2BA 4RKDA 1XX5A 2P5LC 2CYYA 8AATA 3HDOA 1QJ5A 1YS7A 3K70D 2HXIA 3QPTA 4LG3A 2OGAA 1FMVA 1H8AC 5E17F 1Y39A 4MQQA 2LC2A 4Y15A 1FOXA 1KU7A 2BV6A 2F5DA 4BA5A 3CO6C 1X1CA 4ETSA 2KLOA 3GVAA 4HYEA 4LG0A 4B43A 2CH1A 1FJLA 2CFOA 4XK1A 1OKRA 5GP9A 1B9HA 1GC2A 4G7HF 1TOGA 5HS7A 1Y8RB 3LVJA 2AQFA 4LB6B 2OBPA 3UR3C 4B3AA 1IDZA 1OISA 1HDPA 1FP2A 2EA4A 2ZSIB 2RREA 1MW7A 1M6SA 3I3LA 1RR8C 1RVYA 2ZSLA 1D3YA 3QBOA 3FISA 4EGZA 3GXOA 1KQ0A 1XSXA 1RI7A 3KE3A 5C3EJ 1UU1A 3BR6A 3ESWB 1G2HA 1S72I 3IV5A 3ZRQA 4RGUA 3PIPF 3I4JA 3E9KA 1IRXA 1MBJA 3WG7H 4CSWA 4A0ZA 4CUGA 3ABKH 4EM2A 5JFRA 4A3BJ 1D5VA 3CLQA 2R7SA 1C7GA 1D0ZA 4D1QA 4XEWA 1X4OA 1U9NA 3FX3A 3I71A 3R9AA 4F3QA 3CJTB 4ZH4F 1RC9A 1ZRCA 4YG2F 1FSHA 4V19K 2D1VA 2Z16A 4KMUX 1XGMA 2BEOA 2L2OA 4IPAA 2XUBA 5FO5A 3BG9A 3HVYA 5FT5A 4ZASA 3M3YJ 4XM3A 3HC7A 2XAHA 1DQUA 1ZR4A 1MNMC 4BXXJ 4LLLA 3LY1A 2GIVA 2L01A 5E5IA 2X1EA 3WTYC 3IRRA 2X48A 5DUIA 3FFRA 3TQXA 1ZTRA 2BGCA 2JRMA 3JTHA 3U9GA 3BPVA 3FVSA 4BUPA 5AIQA 1S7AA 5H6QA 2VIAA 1L3LA 5FT4A 5E79C 1D0YA 1AIBA 5HS9A 1OXOA 2CUFA 3KZZA 4IZZA 1DGRM 2JWTA 3Q5FA 2KIFA 3LAJA 2AXTC 3ZQQA 3M7GA 1CF7A 3FXRA 4FFCA 2XRLA 2ZXJA 1ARIA 3SZTA 4XRMA 1TWFJ 5E3MA 2R5ZA 5J40A 4DZPA 1WRJA 5FLXZ 1ASMA 1DP7P 3MVPA 2Z9OA 1I27A 2Y2ZA 5FJ8J 3CJRB 2BW3A 2A6HF 3KKIA 4NUBA 3RYRA 1AKHB 3DKXA 2WK8A 4DBRA 2E2JJ 1LDDA 3HUGB 1O3TA 1ZGAA 2D1HA 2L9VA 1YS6A 3OV8A 5J1UA 3N75A 1OCOH 3CUQA 3FHNA 2C6YA 2P7CB 3PD6A 2C81A 1SFUA 1FYKA 2EQRA 1WJDA 1A6IA 2KRFA 1FTZA 3A9ZA 2E35A 1JS3A 2D7ZA 1ASAA 3QU6A 1WHUA 4S04A 5D6EA 2ZXHA 4UUVA 5D6FA 3C1DA 3P9KA 4XLCA 4DZJA 4DGTA 4ZYEA 1YFHA 3CDLA 5EUDA 1YJSA 4MLOA 3FVUA 4XLHA 3HOSA 2HOSA 4YFNF 2LY2A 2HDDA 1Y56A 2WY8Q 4S0HB 5KHDA 1I41A 4WXGA 3N5MA 5JR3A 2EO5A 3OS0A 1Y0UA 1BW0A 2DFFA 1D7UA 2IRFG 2ICWG 4XJOA 4IHTA 5BJ3A 1ZYRF 4ESJA 3VOEA 3F22A 2LYCA 3NDNA 1N77A 3MEXA 1SAUA 4CA0A 3GZ5A 1D1BA 3EETA 3QQAA 4NB5A 1LEAA 2V26A 2K9LA 1IZ1A 1XMAA 3M8EA 2EFNA 4CCLA 3FXOA 2ZJGA 1QBJA 5J4VA 2CGPA 3NU7A 1WYVB 2YSRA 2CH0A 2NXNB 3NRVA 4F5KA 3T8TA 1GEXA 1SMTA 1SD4A 3CCMI 5D5WB 5B3SH 5GTIC 2VKHA 3IWZA 2JUGA 1AJSB 3LMMA 4ATQA 3K0LA 1P7JA 4A5NA 5TJJA 1GC3A 5E1ZB 3PJ0A 2M0MA 2PG4A 3ERMA 1WJCA 3CP2A 3EDPA 2NS7A 3DEUA 4I0AA 2LD5A 4PZJA 4XN0A 4PK4A 4JF1A 2HTJA 4QPQA 4A0FA 1EH6A 3HTSB 2XF7A 1Y6IA 1OCZH 1HBXG 1J7KA 1EJIA 1SZSA 3VK2A 3EPZA 1KONA 2VMSA 2DPUA 1FBSA 2H8WA 3II0A 3AEPA 3GLLA 4G8XA 4CO8A 1PVEA 1IGNA 1UHSA 4A6UA 1MSEC 2IAIA 1ODDA 2HKXA 3JREA 3L2RA 2TRTA 1DGWY 3MKYB 2VQCA 4Q75A 3W2AA 1I6XA 3EIBA 3ZRRA 3CCVI 2EZ1A 5LRSA 2GMSA 4IQ4A 2CUEA 5E3OA 1JUPA 4XRSA 3I4PA 1YHQI 2DKJA 4H4KC 3WLXA 1PG8A 4EJUA 2M7AA 1U9OA 5JHUA 4IRHA 1MLYA 2W00A 4L9VA 4M3DA 1HQCA 2Z1YA 1D8KA 4ATPA 3RZDJ 1XMKA 3CJQB 4XJPA 1GD9A 3LA2A 1ZODA 4EB7A 3PA9A 1TOIA 1W0UA 3BWNA 4N4NB 4AYBA 2XBNA 1ON1A 1BOBA 1RKWA 1HW1A 3ZCOA 2CFXA 2L9NA 1F36A 1SFXA 3J81K 3AEMA 4EQQA 3F0HA 3TFUA 4EJVA 4H51A 3UAKA 1X19A 3W1IA 1IXSB 1R4NB 1BIBA 4AC0A 1B9IA 3DP7A 4XOPA 2DTZA 1XB4A 2CQNA 4HSTA 3E3VA 3GZNB 3LQRA 5LFAA 4UB6C 4BQNA 2IVMA 4HDVA 2NVQJ 2DMTA 2QLRA 1EH8A 2KIMA 2ZFUA 1IBJA 4R79A 4ZWVA 3ZQGA 3R0AA 1ARTA 5IY5H 2L54A 4M9SA 3RTRA 3MZ8A 1S3JA 1LJ9A 3K10A 4XMYA 4IKFA 4BGDA 2KDOA 3F0CA 2K02A 4FQGA 5DYMA 4BS9A 4A3GJ 2MBFA 4AWXB 2K4BA 4GE4A 3GTKJ 5J6XA 4E3RA 3FM5A 5C44J 4AOAA 3O3KA 2CWEA 1RVUA 2JJHA 2MC3A 1LUJB 3E2FA 1QZ9A 2EZ2A 2JTVA 3MC6A 4HBLA 3BR0A 2VGTA 1S6LA 3ONQA 3Q3SA 2FE3A 1HXDA 3H92A 1AAMA 1UZCA 1X0MA 3JWAA 4FX4A 2W1OA 3GFJA 1YJWI 3LVMA 3WG9A 2BI2A 2PB2A 2WK7A 3HEFA 1BJWA 3NEUA 4PGGA 2VB6A 2K5CA 3GX4X 4A0GA 4EMYA 1USSA 3I54A 3ASNH 1UKJA 3WGBA 1F43A 3U2RA 2VMVA 1V4RA 1IRGA 4DOZA 5IYDJ 1RUNA 1W4MA 3W2WA 3F6OA 3H5AA 2BY0A 1ETYA 1I29A 2WKAA 2E60A 2MLKA 4XJMA 1ONVA 3G4SI 4ENJA 1R6RA 1Y4IA 3JZLA 4F5GA 1JXSA 3QPSA 1ASCA 2OZUA 1W5CC 5E1XA 4BJ5C 4XONA 2L9RA 5HLIA 4D5FA 1FWZA 3D0SA 1UHWA 2Y30A 1EJ9A 1IUGA 2QLZA 2KISA 1ETVA 4AIHA 3J81Z 1YW8A 5EIGA 1NG6A 3FBIB 4CCNA 1ELQA 1SD6A 4RB0A 4RGRA 4RB2C 3V8JA 3CMEI 2HDCA 3TOAA 3E6GA 3MCZA 1I50J 4XKVA 2FNAA 2IGNA 1PJRA 3O8GA 1VQ9I 3B1CA 5BS6A 5DX5A 4UY8I 3LV2A 3JSPA 1HKSA 4M74A 3TW7A 2GOXB 4BEHB 1X1DA 5DUKA 4IHWA 2VBXA 2PBIA 1KYWA 2BIGA 3DU4A 2R5ZB 3JRAA 3HGYA 3DZZA 2JZYA 2JG2A 1K6YA 2EV5A 2AY4A 3OYGA 2CO5A 2F4MB 1AHXA 2DT7B 5J1YA 4RGXA 1ETQA 2VMNA 3FMSA 4BQOA 3OYMA 1JGGA 2IA0A 3QAHA 3Q0WA 4BHBA 2NAZA 1EA3A 2H09A 2XV4S 1G3TA 4WWCA 2RAEA 2Z67A 4NBQA 1VQ7I 2QQAA 4P55A 4N0BA 2VN2A 3LVLB 1AY8A 3OYKA 4Q76A 3BG7A 2JRTA 5E8GA 2G9WA 3AG1H 3KP6A 2HUIA 3IHJA 4XRFA 1AMSA 3CESA 2DGLA 1MGTA 1MDMB 4A3IJ 3QPGA 3I55I 1BR2A 7AATA 4RBOA 4RIZA 2R7RA 3FKDA 4HQMA 3L00A 4OMZA 1LDJA 1Z7UA 4HNVA 2HPMA 1QJ3A 2BKWA 3PL8A 5D5XB 4LOCA 3SJMA 3KZIC 2X5DA 1MMSA 2FOWA 3D5SC 2BY1A 4L9JA 1WI9A 2LMDA 3ABLH 3GBGA 1VQ5I 4DJAA 3MADA 4WXCA 2M2EA 3KIOA 3ZMZA 1VZ0A 1GHCA 2O6GE 1ASLA 4D9JA 1QVUA 3HRUA 3LSMA 2BI3A 3TKYA 3F9KA 3KP7A 1JT0A 4F5IA 2FNIA 4HVKA 1JE8A 1S8NA 4W91A 2XKPA 1VJOA 3N4MA 2ZXWH 1FBQA 2CV0A 3GTLJ 3DXVA 1G3YA 1VFCA 3RI6A 2KJBA 1QU3A 2ELHA 1PUFB 2IP2A 4YFKF 1AKBA 1PUFA 3M5UA 3K28A 3I0TA 1NHAA 1ULYA 3PIOF 2E5ZA 4Y33A 1HLVA 4CHUA 2CINA 2HORA 2EB7A 3TCMA 3I58A 5HS8A 1I43A 1OR7A 2QGUA 1OFCX 3LSGA 3S1QJ 1ZOBA 4W8IA 2VKVA 2LREA 5LLQA 2AY3A 2CUZA 1OLTA 2QYOA 2VJ4A 2FQ4A 4DYCA 2QQ8A 1YAAA 1QGNA 4I09A 4C3IJ 2E36A 3TP3A 2AY6A 3ECOA 2LKPA 3TO6A 1RZ4A 2IEKA 4BQ0A 3P7NA 1E2XA 2O03A 1LKCA 2X0LA 4LFUA 1B72B 1Z7DA 2R4GA 2L3DA 3FXQA 2XIGA 3LSIA 4OIQF 2W7EA 3BN1A 2ZXIA 1O61A 4ZM4A 4LK1F 4RAFA 3K2AA 1NG7A 1O4XA 5JLWA 2VMOA 3FWEA 2CW8A 3M8FA 4AD9A 3F21A 1YJNI 5G2QA 2D61A 2GIZA 4ZYGA 1MAQA 4GXOA 1XCVA 1B59A 2K9QA 4RKCA 1I5ZA 3RSNA 1BJZA 3HDDA 2A6TA 4QGRA 2BE5F 4WD2A 5CVIA 1SFOJ 3MBBA 2IS1A 2FQ3A 3K7YA 1RETA 4LLNA 4N4OB 1BI0A 2DT6A 4BJ6C 3ROUA 5GAHJ 1FG3A 1SF2A 2Z61A 2FNPA 1LB2A 1FZPB 5IT9K 2E1NA 4G94A 2LNBA 4I76A 2LBFB 2HZDA 2Q0OA 2W4SA 3E5QA 3WE3A 4BE1A 1YO5C 1C0NA 1O62A 4XAUA 1AMAA 5K5RA 1GCKA 3C3WA 2Z9WA 3FXMA 2MLGA 4P96A 2W7DA 4WP0A 3K1PA 1ERDA 2M34A 1G8XA 4CXFA 3O8HA 1PP8F 1JS6A 5HLHA 2ZCWA 4L0ZB 5E1WA 3ZN1A 3DXWA 2DDAA 3MZYA 1A31A 1LVKA 1ZHFA 3PNVA 3GEZA 3MMYB 3GETA 1QPMA 2CV2A 2DPDA 1PP7U 1FIAA 2BXZA 2XAUA 5F8VA 3H9GA 1CL1A 1H1CA 2VMPA 2IGOA 2F5FA 2PEXA 1UAAA 2YHKA 5G4JA 1Z6TA 2DFHA 3IH2A 5DM6F 4E7LA 2ETHA 2NVYJ 3W6VA 2AY5A 2YOBA 2G7HA 2PMHA 1IF1A 4W1WA 2ADUA 2VPRA 4XSXF 5DDGA 4CDGA 3BS8A 1BR4A 4C2TA 4HAMA 5KAIC 1TATA 4EU1A 4B44A 5TGTA 3HSFA 2KKOA 1W5SA 2EGYA 1YOOA 2LOOA 5DV5A 1AJRA 2A3SA 2XAJA 1SPAA 3UKGA 3IRQA 5LD2C 2M8GX 5IP7J 1RRJA 2UUZA 3H5RA 5FROA 4F52A 1H0CA 1QVTA 2V7FA 4A2UA 3FBNB 3OYDA 2DGMA 1YW9A 5L3EA 4W5KA 2JVHA 5FLMJ 2GAUA 2CJDA 3X2QH 5F6FA 3TGNA 5IOYA 2VGWA 2KL4A 4CGZA 4ESBA 2ME6A 3S8PA 1J9IA 2O0YA 2EPJA 3BWNC 4M71A 2FBKA 4IO9F 1VI0A 1BQDA 4C30A 3DTKA 5GAGJ 2Z3YA 1S9HA 5CQGA 4BBRJ 3NQOA 3P5JA 2IGKA 3FMRA 3MKWB 2M1BA 1FT9A 1VEFA 3PO2J 2V1UA 3K4BA 3B1EA 3MAUA 2HS5A 3HRMA 2RDPA 3IP4B 1AOYA 3R6SA 5HDNA 2W7MA 3G73A 2VBWA 1TW3A 5EG0B 5LGTA 1TWHJ 4CCOA 3S17J 2AEUA 4HA8A 2I8DA 3NWSA 2QKLB 4L9NA 1I48A 2W8UA 2DA1A 4NQWA 3A9YA 4Q5SF 3RBLA 2L5QA 4LJZF 1R1TA 4EEFG 1X1PA 3LSPA 2A68F 2OZ6A 3BWOA 1FPQA 3M07A 4WXDA 3I56I 2CQKA 1R5ID 2BY2A 3HOWJ 1I3AA 5K7FA 3PPLA 1S7EA 2H6CA 4A3DJ 2OTLI 2M4GA 4XOTA 2BIEA 3DEWA 4WYGA 2VI9A 1GUUA 1ZQ3P 1IN4A 1LVAA 1LC5A 2V79A 2XDVA 5D8KB 3IKTA 1Z6RA 1UELB 4MFEA 3JRHA 5DTDA 1XDSA 4X1EA 3ZMTA 4OTLA 3KE2A 4ZDLA 4M3BA 2G6WA 1ZG3A 2FBHA 4A69C 1O7FA 1XCBA 1Z77A 4ITXA 5EZGA 4JEWA 5G2PA 3G6EI 3SFIA 1WKMA 4PFOA 1UCRA 1TLHB 4AUXA 4HF1A 1MD0A 1O4SA 4WYAA 1MMNA 2L7ZA 2V9PA 5FD5A 4AVPA 3G71I 3ELKA 2VIXA 3BT9A 1XGSA 4YIIA 4CXRA 3FHZA 1J32A 1SFFA 5D5SA 4BE2A 1AICA 2VPLA 2FEZA 2UXXA 1X28A 3A0BC 3SEZA 3KGWA 3QU3A 3WTTC 1QNTA 1WJFA 2EILH 4B8XA 3GZDA 3I16A 2JN6A 1P3WA 2R7QA 3CC7I 1VQLI 4IQJA 3GTOJ 2X6XA 2M9HA 4PSWA 4A0XA 1X3ZB 1C0WA 3VK4A 3AEOA 1X1BA 3L2QA 1QISA 3WTSC 4HOBA 2HFHA 3KZYA 3KEYA 5ILUA 5HOOA 3SYTA 5EIGB 2O9LA 1WZ2A 2MSYA 4HQEA 1W5TA 4N0WA 1ARGA 3VAXA 4DYRA 2EIJH 5GAEJ 2B63J 1PFFA 1BI1A 3H0GJ 4QWQA 2NNYA 2HUFA 3LQQA 1K6OA 3E2ZB 3K4CA 2VIBA 4J5UA 1WFXA 2OD5A 6PAXA 4PSXA 2MG4A 1K83J 4F92B 5M5XJ 3S2HJ 2JJGA 3I59B 1WH5A 1AY4A 5HXXA 5DB5A 4ISYA 4UHOA 2BVMA 3LSJA 2YU3A 2JPCA 3AELA 2ZC2A 1ZLJA 3OYBA 3LA7A 2DK8A 3CO7C 2EZIA 1DPRA 3QOEA 1PMMA 1ZREA 3BLYA 4IOCF 3BTCA 5LBQA 2Q7WA 3BR5A 4UVBA 5IP9J 1KKJA 1X58A 1T98A 5GPAA 3H36A 4WCGA 1GV2A 5D4RA 3FRKA 2Y9ZA 3FKIJ 4X6AJ 4B1RA 4JE5A 3PQKA 1P6RA 5J1RA 2W25A 3UWCA 3TEDA 4B09A 2XSJC 1LFPA 2NVTJ 3NRAA 5A2QZ 1YE9A 2DODA 2DYRH 2M30A 1TWCJ 2DO7A 2MW8A 1ZRFA 1DFOA 1G4VA 4XQFA 2KRHA 3VSLA 4FX0A 1BM9A 4RAZA 2ZBKA 4IRGA 1YYVA 3H14A 3CDIA 9AATA 4P9FA 1UHMA 3U21A 1JHFA 1U6GA 4KIFA 5EF6A 1QGPA 3FZ7A 3CF5F 3A2KA 2PJRB 1RNLA 3NU8A 1LC8A 2EJRA 1ZGJA 4FE4A 4HLXA 2P5KA 4HRIA 3F8BA 4LW4A 3C7JA 2ISYA 2PO3A 4PFFA 1C7NA 1UG0A 5E20A 2ZSHB 4UVAA 5FD6A 2CS3A 2JT1A 5M3MJ 2Z9UA 3ZGKA 3FCRA 1TQMA 2STTA 4Z2YA 3FIWA 1FX7A 4OBUA 5FT8A 1LE8B 4NOGA 4BMKA 2A05A 4HX8A 4ZZLA 3HUGA 3AEJA 1YJYA 3DPTA 2MYSA 3KP3A 2DBBA 1ZC9A 3COAC 1OHWA 4Y17A 1V2DA 2AQEA 2HOEA 4I98B 5F1RA 3FVXA 2Y9YA 4MSOA 2HP2A 4C3JJ 1ASEA 3ZPLA 2W8JA 2X6YA 4OMAA 4ENMA 2V1NA 3Q9VA 4DBCA 4KISA 3LVKA 2DMUA 2W8TA 3CCRI 2VOOA 3SFZA 4I0BA 1BBYA 3CP8A 1WJAA 4L5JA 3NWTA 5DS9A 3CMYA 1ARHA 1OCTC 3FSLA 2PLYA 4UV9A 1MJAA 1QHHD 3I4NJ 3CCJI 2ZMEC 4Z6YA 2QA4I 1TARA 3QPHA 1ORDA 1MMAA 5HNHA 4L18B 2Z20A 4XK4A 2VT3A 4ZTFA 1GVJA 2AEVA 3H3UA 4AIKA 3GR9A 1KQ8A 4JEXA 5FT6A 1SFKA 1B5OA 3MN2A 1BI3A 3W3CA 3VSKA 4GO1A 1T0FC 3VYRB 4NQWB 1WVRA 2ZNZA 4ZM3A 1G4DA 3AEMC 1MMGA 1E0EA 4BKXA 2QSHX 4XLEA 5HDKA 1GV5A 3J7YJ 1KMKA 4ADDA 5EG0A 3OIPA 4L9TA 3GFLA 3D6KA 1DTYA 4UHTA 4WYCA 3FXJA 1JT6A 3J7ZI 2EZLA 4Y52J 3JTXA 2STWA 2XAGA 2RNGA 3OYAA 3HT4A 2LF7A 2XB5A 3OYLA 4C2MJ 3OYNA 2F6CA 4WF2A 1MBFA 2H1LA 4GEBA 1FC3A 4A6EA 1FG7A 3RKWA 5K5QA 2EH3A 3DKYA 1E5FA 1MJ9A 1YIJI 1FC4A 4D7NA 4GE9A 3R60A 2XPVA 1Y1WJ 2YRRA 3HSEA 1IJWC 3PNTA 4MKKA 2A61A 4L5EA 4F55A 2CJGA 3AV7A 2R5YB 2R5CA 1TOJA 3DODA 1YG2A 3LNQA 1T2KA 4JE5D 1TW2A 1JTXA 4BL0B 2R2NA 3DR4A 1K78B 3EUCA 1W23A 2VODA 4OIOF 3BY6A 1SZUA 2Z33A 1VP4A 3GFIA 1IAWA 2VI8A 4MTEA 1YLFA 2HYGD 2JA5J 2LY9A 4U88A 2DA5A 5CVVA 5ERIA 1QQIA 1GXPA 3LFUA 3QWLA 1D7SA 2DA7A 2BHXA 2XGCA 4AIDA 4XJLA 3S32A 3RUYA 3NYSA 4A12A 2Y0MA 2QSFX 5BNGA 3V4GA 3JAMZ 2HEOA 3DRDA 1E3HA 1A35A 3K2ZA 2W85A 3FQ8A 3L1PA 1YJZA 4RJYA 3AOVA 2YX7A 3B02A 3B1DA 1G7XA 5D5VB 4BY7J 3L8AA 4U7BA 3WTVC 2N8GA 3KLNA 3OR1C 2GBYA 3K4NA 4G6TB 4M9XA 3PD6B 1GLNA 4RM3A 4UOYA 2XGXA 3AAFA 3HZJA 4EB5A 1F4KA 1B9NA 2E34A 2GZWA 1Q1HA 4XKCA 4V2FA 1K4TA 2LBFA 3BJAA 4PFNA 4ZSYA 3H35A 2R93J 4ZYAA 1TOKA 2ZC0A 5J8QA 4KYWA 3F8MA 2WA0A 3NYTA 3LOCA 1MH3A 3F6VA 3OWTA 3U1KA 2JUCA 3RKYA 1HOMA 1Y1VJ 3ULQB 5M3FJ 3S3OA 2JISA 2Y69H 3DEEA 3DBHB 3LWFA 4RAYA 1OYIA 3K4JA 2GB3A 2R7FA 4F5LA 3BJ6A 4M6VA 2R7ZJ 1U5TA 4ABZA 2Z1DA 1MJBA 1KZHA 2R7WA 4ON0A 4I2OA 2H27A 2O61A 3TMOA 1J04A 2BWOA 2V9VA 2CJHA 2BXYA 2LSOA 5FRNA 3NNKA 3M9AA 5EQCA 1BJAA 5TRDA 1N31A 3G0TA 4KIGA 3WU0A 1AHDP 3DF8A 2DI3A 2D2WA 3JAMK 4AO4A 1X3UA 1TC3C 5E3NA 4KYOA 4M3FA 2QEXI 1VQ6I 4HSRA 1WSTA 2OKKA 1EQBA 2BWNA 5L3CA 3TBIA 4MKJA 4HX4A 4R1HA 4O5VA 3DC1A 2ID6A 4A3LJ 1ASFA 1MDOA 2M0CA 2DAOA 2V1DA 3IAM2 5CYVA 3FZ8A 2CUJA 4I8AA 1DJUA 3H7FA 4BXFA 4OINF 4L0YB 2CW7A 1I1SA 1J0RA 2YCTA 3R4KA 3RKXA 3MKLA 9ANTA 2ZKZA 5E8IA 3P6KA 2DGKA 3AENA 2VBYA 2E1OA 5L3GA 1HF0A 2QF7A 3DWLE 3KETA 2H8RA 2AY2A 1CQ8A 1MSFC 2ID3A 3CD6I 4KAMA 1ZARA 2EIKH 4E3QA 4PJ0C 1UFMA 5FGMA 1R1UA 2EV0A 3FMQA 1V3FA 3TDZC 1ZLKA 4A72A 2LLKA 2ZB9A 3I64A 4RB3C 1ITYA 1WKGA 3VOMA 4XBFA 3V8KA 3W2VA 3BG6A 4CZCA 2FNUA 2ZJQF 3HMUA 4G6QA 3DR7A 2IGMA 3MAFB 3HOYJ 2Z2SB 2E19A 3SHFA 1MNDA 1B8GA 3V42A 1QA6A 1SD7A 5CPRB 1LEBA 5FKNA 2OAZA 2M87A 5E3LA 4OAZA 1P4XA 3B73A 4ZTJA 1XSDA 2IT0A 2QVOA 1QIRA 4HF0A 4RB1A 2K9NA 4MFDA 4Y7NJ 3IH4A 1X4PA 2NVUB 1NH3A 3BR2A 2LY1A 3RPQA 3AL0C 1IAXA 4IX7A 3S16J 2O3FA 2O0RA 3T5XA 1AHEA 4EFFA 1WYUA 1HA8A 5AX8A 3KCCA 4ITGA 4NC7A 4O6ZA 5LRRA 4Y3OA 4LMYA 1R23A 4ANJA 1GDTA 4XIDA 1B8IB 1HC8A 2YKVA 1IJIA 3WKRA 5M5WJ 5F9SA 4GYIA 4U87A 1CGPA 5LEJA 1AY5A 3HBLA 1MDZA 3WODF 4FASD 2KMUA 2HTSA 4HDUA 2MA3A 1T3IA 2PN6A 1M1EB 1CZEA 1OHYA 3IWFA 3PJRA 4E7IA 3JWBA 4LC3A 2KRCA 4MGRA 2R0TA 1IN7A 2E2IJ 3GWPA 2VMYA 2GQNA 5TF5A 2VMUA 3WE2A 4HG2A 3ZRGA 3GFMA 1TT5B 1JKRC 1ASDA 3QHXA 5HNFA 3AOWA 3UE8A 1T56A 1BC7C 2W84A 1RUOA 2L4AA 4M73A 4XRSG 5HLGA 1J09A 3JRFA 3BB8A 4G12A 1BOAA 2E7IA 3HKZN 3ELEA 3E0JB 1SAXA 2ZO4A 2D5YA 4K2IA 4ADEA 2HOAA 5FRMA 2PQ8A 2XRNA 3FD0A 2LKSA 2LVSA 3FK6A 4DGWB 1PUEE 3CQ4A 1IXRC 1FSEA 2GXGA 2DOUA 2M3AA 1V2EA 4EJWA 3AATA 1YIYA 2EFOA 2VMXA 3GZDC 3W6KB 4OYTA 4W1XA 4B3XA 4GDFA 3OY9A 1I39A 4RLQA 1DPUA 1S0AA 4A3CJ 2YKXA 1MKMA 3KLOA 4OC9A 4ENNA 3EI5A 4KN7X 5DCMA 2L9SA 2P4WA 4M72A 1R4MB 1EF4A 2KZVA 5B1BH 3PDXA 1FNNA 3FXKA 2PFBA 2XPWA 2Z99A 3TP0A 1G3SA 2BYVE 2L7FP 3ABUA 1R22A 2L0KA 4BU2A 4BACA 1ZG1A 3QOPA 2I5UA 2FOKA 4DW6A 2ZNYA 1QHGA 4L5IA 1AMRA 1CQ6A 1S07A 1U5TB 2AXLA
chains in the Genus database with same CATH topology