4TV7A

Crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
460
structure length
431
Chain Sequence
TITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAALPDDLKEIHIWISFSHMDTDHFPIKSWFRCEQKAASRSYMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEDTRRTEQDILSHAAGLQLEIFGMSRFRPALIIGFARLKEEDIQEGVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Role of the aminotransferase domain in Bacillus subtilis GabR, a pyridoxal 5'-phosphate-dependent transcriptional regulator
pubmed doi rcsb
source organism Bacillus subtilis 168
molecule tags Transcription
total genus 132
structure length 431
sequence length 460
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4tv7A01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4tv7A02
1BQDA 4WXDA 4W91A 4Y15A 2BYJA 4JQFA 2BWOA 1U3EM 1H9TA 4M6YA 3D6KA 1S07A 2D1HA 3JAMZ 3LVKA 3MCZA 3AEOA 3GZDC 3EIAA 4WCGA 4ADEA 3BOQA 1O7LA 2AY7A 5BPDA 3F6VA 4IRIA 3MADA 2F5CA 3LWFA 5CVUA 1TOJA 3EZ1A 1UFMA 3U1DA 3REOA 4EJVA 2RV8A 1FC3A 3OP7A 2W84A 3E2ZA 3TCMA 3COAC 1T6SA 2CJDA 2QENA 2VONA 2DKBA 2RC4A 1BOAA 2GA2A 1GCKA 1IZ1A 1W4MA 1FP1D 2KIUA 1P4AA 2W24A 2P8TA 1MZBA 1R58A 3E2FA 3E6BA 2G7UA 3I64A 3I58A 1I43A 2RKHA 2CGPA 3KGXA 3NU7A 4ZDLA 1AIBA 3CUQC 2WK8A 2RQPA 3ZP5A 3FCRA 3ZRPA 1TOGA 5E1ZB 1TNTA 2MC3A 5HLGA 1N2TA 3WTTC 5HLIA 3F23A 1JHHA 1ZHFA 2Z9UA 3FVUA 1TATA 3JTGA 4LMYA 2O0YA 5FFXA 3GEZA 1W7NA 2K86A 3Q9VA 2P5LC 1ARIA 4P7YA 1AAWA 4A0HA 3ZRQA 1O62A 5EIGA 1F1ZA 1WWXA 1KL2A 1D7UA 2PJPA 4MEYF 4TV7A 4RB3C 3GUDA 4HDUA 1O3QA 2EZ1A 4I02A 1OHWA 1USTA 5C6UA 3I53A 2IA0A 4UHNA 5HS9A 1OHVA 4WYGA 2EV6A 2VBYA 2VT2A 1TW3A 1J75A 2IA1A 4QLCU 3R6SA 3BDDA 4LW2A 4W1VA 2VI9A 5K1YA 4S04A 4CBSA 2CTZA 2JJEA 2MD5A 1LQ1A 3HVYA 4XEWA 2AY2A 4BHCA 4L0OA 2OZUA 3PDXA 3FZVA 3CQ4A 3MC6C 4RJ0A 3DR7A 3GZ5A 3A9YA 5CVJA 3WTUC 2HP2A 3FMSA 2HKXA 3HSEA 2JZYA 4BXUA 3MKJA 3F3XA 2FYFA 1ASFA 4CYDA 4AOAA 4ZLVA 4DBCA 2VIBA 2L3DA 2BI1A 3PQJA 1W5SA 3C1DA 4WK8F 2ORDA 3ZZJA 1W7PA 5M4BA 4JK1X 4M6XA 4KMUX 2EB7A 4FX0A 3Q5FA 1B8GA 1LDKB 1KQ0A 4K2IA 3KZZA 3GFMA 1SFEA 4XSXF 3DFGA 1GVJA 4HV5A 4EJUA 5M46A 4U7DA 2OKKA 4F5FA 1M7YA 1IX8A 1TARA 2W85A 2A5YB 2ZXJA 3W6JB 1TNSA 2CW0F 2PG4A 5EEGA 1GEXA 2FXAA 2KJCA 5LGTA 1AJRA 3FWEA 1O4SA 4R2NA 1YIOA 2DT5A 2O8XA 4TMRA 3MAFA 2A69F 3FM5A 1DUXC 1HW2A 5BJ4A 2FE3A 3E6MA 3O6BB 1AHFA 3BCBA 1I27A 4P55A 1PP8F 3FXUA 4S05A 2J5PA 3V4GA 2CANA 1SMYF 3BWGA 1KU3A 5E8GA 5AONA 1VP4A 2W8VA 2EK5A 1TQMA 1C7OA 4A00A 5D4RA 1Z3ZA 2G9WA 2FM1A 3BB8A 3R61A 4NB5A 3B8XA 3QP5A 3EZSA 3PQKA 1ULYA 1TOEA 4FT8A 1B6AA 2BWNA 4IYOA 1IXRC 5HOOA 4Z2YA 3U9GA 2Z20A 2QBYB 3HRTA 1SZKA 1CL1A 4AO9A 3SFZA 1DDNA 3AENB 2DR1A 2UXNA 1UU0A 1JE8A 4OBVA 3F6OA 3WGBA 1S29A 1P92A 3WKSA 2M1BA 2BIAA 1R1UA 1CQ7A 4AO4A 3M1EA 5DD8A 5K5OA 2PI0A 2PQ8A 2ACJA 2OU2A 1H0CA 2O7CA 3QU3A 3BN1A 3RTRA 4K2MA 4LNMA 1GC0A 8AATA 4U88A 3BCAA 4I0BA 1AHGA 3I54A 3MZYA 5AIPA 4KNYA 2OGAA 1B4XA 1ZG1A 3LVLB 2BI3A 2YKXA 2H94A 3LV2A 2L02A 3HLMA 2QM3A 1X2AA 4F7ZA 2HOZA 2XKOA 1YJYA 3GWPA 2W7GA 3FZ6A 1GHCA 4BQ0A 1U8RA 2CFXA 3BJ6A 1V3FA 4LFUA 3E6CC 3NU8A 1SZSA 1H9GA 3WGGA 2H09A 1YO5C 5EAVA 2PO3A 2CB1A 4KA4A 2FNAA 3QI6A 3E3VA 2CJGA 3EI6A 4UHMA 3HHHA 2OATA 1S8NA 3ZQ7A 4U0WA 4CBRA 2VMNA 5FLXK 5DV5A 4KICA 3HT4A 4EJWA 3JTXA 1YG2A 3FFRA 2RN7A 1DP7P 1VTNC 4UHOA 4OU0A 4ZYGA 3R0AA 5F64A 2EWNA 3E5XA 2GQNA 4XJLA 2VMOA 4GDYA 1OKRA 4ENKA 2DGKA 1M0OA 3DV8A 1GXPA 2F5EA 1E2XA 2AXLA 3HRSA 4Y13A 4A6RA 3F0HA 5LHHA 1CZCA 3J81K 2YPRA 1MJ9A 2Q0OA 4ZYHA 3AEMA 2FBKA 4EGZA 2P4WA 2VOPA 5DYMA 4OIOF 4A6DA 2VBWA 2NNYA 2EJRA 2PLYA 1AJSA 3FZ8A 3W1JA 1OPCA 5J8CA 1ASBA 4JEWA 2WTEA 3JWBA 1L3LA 4IXSA 4BH9A 4XK1A 1FPQA 2A61A 1YFHA 2Z5UA 1CF7A 1YW9A 4PIWA 3T8TA 3O3KA 1Z6TA 4LB6B 3WX9A 2XGXA 3BV0A 5LRSA 3JW9A 3ROUA 2W7JA 5EUEA 2YX7A 2X4HA 4I7HA 1D5VA 3RJPA 5BQTA 2D7ZA 4WXBA 1FG7A 3E97A 1QGNA 1O3TA 3RYPA 1IRFA 4LB5A 3R4KA 1G3WA 5DDGA 3KFWX 5FFZA 1PUEE 4WP0A 1U5TB 2YRIA 4IRHA 1YW7A 1QO0D 1R5GA 1AICA 3I4PA 3EYYA 4Q76A 3FM3A 5DJ1A 2GA1A 4EJOA 2OQGA 3QPHA 3ZMDA 2FNIA 2VGVA 5JFRA 1G3TA 4A2UA 2LDUA 3ATHA 3CO6C 1N31A 1QIRA 2VYCA 3WE2A 1O7FA 1MDMA 3SZTA 3TDZC 5J8FA 2BEOA 2W7FA 3E77A 3NRAA 1WYVB 5ILSA 4OIQF 1XSXA 3IL2A 3I0TA 3LVMA 3GX4X 4FX4A 1ASNA 2R7FA 1BT4A 4Q4ZF 2V1UA 1AHEA 2GSAA 1Z9CA 3T0YA 5HDKA 4HDVA 1AHXA 1L0OC 1SPAA 2Z61A 4HW0A 1AKAA 1HXDA 2EH6A 3CUQB 3HBXA 5FT6A 3I59B 2X3LA 4FFCA 1R22A 4AVPA 5JVTA 5DJ9A 2L01A 2Z3YA 3KP5A 3N0LA 3KKIA 5E4ZA 3WG9A 2GAUA 3L09A 3BJAA 2R2NA 1J32A 3BWOA 3KP6A 2GB3A 2QLZA 2YX4A 1QQIA 5F1RA 5AIQA 3K69A 2CH2A 5FD6A 5ICEA 5DUKA 1GDEA 1EV7A 1GEWA 2C0RA 4OYTA 4NHJA 4WLHA 1UCRA 3FTBA 4I8AA 4ZZDA 5D5VB 4QGRA 3FXRA 3HIFA 3M9AA 2TDXA 5HLHA 2FQ6A 1ASAA 1QPMA 2DLLA 2AY6A 1ARHA 2VMPA 3MQ0A 4AWXB 1P4XA 2PBIA 3DPLC 2YCNA 4ON0A 2QMAA 3WTYC 4XLPF 1SD7A 4KIFA 5D6EA 4CZZA 4DGTA 1D8JA 1EJIA 2FN6A 3LY1A 2V1XA 1FBSA 5HDNA 2A68F 1FX7A 1BM9A 1T38A 3WLXA 3I71A 2VOOA 1AMRA 4F4EA 4WB0B 1YLFA 3DYDA 2VE8A 2WV0A 1MD0A 2VMZA 4E70A 4G6DA 1SFUA 1B9NA 4UV8A 1IAXA 1XDUA 2OD5A 1M4NA 4WXFA 2FQ3A 1U78A 1G4DA 3F8BA 3G8MA 4XJMA 2D45A 5G2PA 5CYVA 3QPTA 2P7VB 1ON1A 1BI0A 1YJZA 4KIBA 3DQVC 2EFOA 2HFHA 2HUFA 4ZM4A 3EDPA 2O1BA 1K79A 1O3RA 1SVVA 1BC8C 2JGTA 4M72A 1I5ZA 1X3UA 2WWYA 5J6XA 1LK9A 1V2FA 2O6GE 1F9NA 1KYZA 4LLGF 1V72A 1KU2A 1IXSB 2DW4A 4RGXA 4IRGA 4N9IA 4LG0A 3LAJA 2HTJA 1LDDA 3WCOA 3SHFA 3PAAA 2CO5A 2BI5A 1J9IA 3FRKA 1YS6A 1BN5A 3MBBA 3USFA 3DXVA 1J7KA 5HS7A 3R60A 1R7JA 3MWMA 4ZWMA 1BJNA 2BI2A 1CS1A 3LFKA 4OOIA 4JEZA 3CO7C 4UVCA 2RFVA 1J0RA 4F5JA 3TO7A 2HGCA 3L44A 1GC2A 3MFKA 3ML6A 4OC9A 2PMHA 1BIBA 1E5EA 5D5WB 2QLRA 3NUIA 4M2KA 1BJOB 1R5HA 2VMQA 2X8UA 1PFFA 2IPQX 3WTZA 3TFTA 2VLHA 5LGUA 5D8LB 3DKWA 2HOXA 4LLNA 4A0XA 1HSJA 2ZNYA 1BC7C 2QBTA 4M9ZA 3P1TA 4PVFA 4B98A 4ZYEA 2XHKA 2RNJA 3H92A 4RKDA 4RIZA 4XAUA 1UHMA 4UOYA 5FT8A 2OKJA 2J5OA 1XMKA 4Q75A 4KYWA 1RV3A 1MJAA 1TBXA 2IP2A 1V2EA 3KZYA 3QU6A 2CYYA 1ECXA 3HTUA 1IN5A 4XLNF 3WCNA 1T98A 2ZMEB 1BBYA 5LHGA 3NNKA 3FMRA 1LS3A 4WYCA 3HRMA 2ESNA 3T1BA 1I6XA 1SD4A 4OCAA 5BOXA 1MDOA 4M2MA 4ENJA 2BBYA 4RITA 4P9FA 2A6HF 3HUGA 4MTDA 2MBFA 3NUBA 2WC2A 1SMTA 5FO5A 5EFSA 2XH1A 3TFUA 3RI6A 3Q9SA 2VI8A 2Z67A 1D7SA 3IRRA 4UNOA 1Y4IA 3IKVA 1OXOA 3F21A 3N75A 4RM1A 1XSDA 5EUDA 3QP6A 2CFBA 4F5LA 3HSRA 3RCHB 3GLXA 2DTRA 1S7OA 2YKVA 1OMIA 3ZMVA 3LQRA 4KN7X 2C44A 4CXRA 3VK2A 1O3SA 4HX8A 1EQBA 2JPCA 2DK8A 3GFLA 4YFNF 2DI3A 4BAYA 3NTJA 5BJ3A 2MLGA 3LA7A 3F8FA 2FF4A 3VOMA 4W5KA 3T32A 4ZDOA 5L3EA 1B5OA 4Q31A 5D8KB 1YOOA 2CY8A 1TOKA 3I5UA 2OA4A 2OAZA 2LKPA 2X5DA 3TGNA 3GSBA 3GO5A 3J7AO 1M0QA 2HQRA 5DCMB 5HXXA 4HF8A 5JHUA 1RIOH 3D5LA 2DGLA 3HMUA 2K7LA 4HOBA 4HAMA 2ZJGA 2R7DA 4NOGA 2OBPA 2QVOA 4UQVA 1BKGA 1LDJA 1QJ3A 1RUOA 1ZODA 1B9HA 5K8BA 2HUUA 4EMSA 1ASDA 1I1GA 3F8CA 4AIKA 3IHUA 2QYOA 5DEQA 2VGSA 3ZRRA 1OYYA 3UAKA 4MGRA 2P5KA 1AHYA 2FMYA 3WGHA 3FD0A 3WTWC 4E3QA 1ONVA 3JWAA 3LAPA 4L9VA 1X0MA 2FMLA 3DP7A 5LH9A 4M71A 1U6GA 4U7BA 3DPTA 4EM1A 4RJYA 3P9KA 1ORDA 2JJGA 5L3GA 3IWFA 4LW4A 3RKXA 4BHDA 2W8JA 3QAHA 4HQMA 4O6ZA 1XB4A 1KL1A 2VGZA 2ZC0A 2W7LA 4Q5SF 1WYUB 3VK4A 1FSHA 3GBXA 2EO5A 3LA2A 2V1PA 1O61A 5IWQA 3ASAA 3MAUA 2K4JA 1M32A 5D5UB 1DJUA 4L9TA 3KP2A 1BJAA 2AY3A 1HKQA 1O69A 2YCTA 4N0BA 4M74A 1WI9A 2Z33A 1BS0A 2G6WA 4DQ6A 5G2QA 2VMTA 1AOYA 3FQ7A 1JG8A 3ECHA 1HKTA 4F5HA 1FBUA 3ASBA 1FC4A 3FFHA 1N8PA 3BPVA 4G7ZF 5F6FA 3WE3A 4BHBA 4MTEA 2K4BA 4P3MA 3F9TA 4GGGA 2DFIA 2NYXA 3V7CA 1KKJA 3AEJA 4W1XA 1IW7F 2VC1A 3F8MA 2V0YA 2W57A 2B0LA 3ELEA 2QBYA 1Z6RA 1GEYA 4LNJA 1PP7U 1S7AA 2VGWA 4ZM3A 4OMZA 3AENA 4A0FA 1AKBA 4WX9A 2GZWA 1IN6A 2IJLA 4MQVA 5K5RA 4HVKA 1ZG3A 2MLKA 3EI7A 3PA9A 2AY5A 2NS0A 1FP2A 2ZP7A 3WGCA 4I0AA 1ZREA 2BI9A 4J8LA 2EA2A 4L18B 3M7GA 2XBNA 3P7NA 1BQAA 2FSWA 1LKCA 1MDZA 3CQ6A 1XGNA 3KE3A 2FOKA 1AMAA 1I41A 3CLOA 2ZO4A 3NDNA 1QISA 2BYLA 1UHWA 3LVJA 2HYFA 3NQOA 4YFKF 3WTXC 4EJTA 3QGUA 3FVXA 1G3YA 2CG4A 4A5MA 3BJOA 1MJBA 1WSUA 2OQRA 4M9SA 4PZJA 1X28A 1WYTB 1QBJA 3UE8A 1P2FA 4KIGA 3T8RA 5A2QK 5E1XA 1B59A 1IXCA 2MH9A 5M49A 2G7HA 1AY8A 2YHKA 3MAJA 1FSEA 2GQQA 1SFXA 3BWNA 5F8VA 4IHSA 3FHZA 4B9BA 1WQ2A 3JW4A 4EM0B 2JPBA 4A0RA 1U2WA 1E17A 1C7GA 4ENMA 1K78B 1YAAA 4MSOA 3BY6A 4I09A 4PDKA 5ED4A 4MEXF 1HQCA 2CINA 7AATA 2ZJ2A 3JZLA 5A2QZ 4EGYA 1BIAA 4G8XA 5FT5A 5CVRA 3KCCA 3TKYA 3K28A 1G4XA 3M5UA 2QQBA 1ELUA 2R5EA 3RPQA 5DD4A 1U08A 4KFCA 2RVCA 1ZN2A 2D7YA 1Z7UA 1R00A 1T3IA 5ILUA 1W7MA 4JEXA 1K6OA 3ZMZA 2EFPA 4IF4A 3FXQA 5FGMA 5FLXZ 4Q6RA 3K0LA 2GXBA 2NAZA 4CHUA 2VE9A 2DOUA 1XGOA 4A6TA 2O03A 4OT8A 3AAFA 4AD9A 3WODF 3PDBB 4Q48A 2GMUA 4W8IA 4BMKA 2NRAC 3P6KA 4BQAA 4PCQA 4BHPA 1UKJA 4O5VA 3WU0A 4RB2C 3K1NA 1G7XA 1FY7A 4XJPA 2KIFA 4MQQA 3AV7A 5D6FA 3J81Z 4BNCA 1OATA 2JJHA 3VP6A 3LQQA 2PMUA 5LBQA 1RV4A 3HOTA 1I48A 1OYWA 1YW8A 2BIGA 4OMYA 5CVIA 5ICCA 2QZ8A 2XAFA 3GFIA 2DGMA 4A0GA 5LHAA 2L54A 5G4IA 3TOAA 4LNLA 1ZRDA 5HS8A 1U5TA 2VBZA 3HYIA 1FYKA 1IX6A 1BJ4A 3LG0A 4AZJA 1SFFA 1HSTA 2D5YA 1UU1A 1ZOBA 1ZLJA 4GYIA 4BYYA 2X0LA 1T0FA 2BYVE 3GZDA 1AKCA 1FBQA 1I1SA 3HSFA 2JTVA 4OIPF 2Q7WA 5LLQA 1YYVA 3VB2A 3ZMTA 2HKOA 4IW7A 2QQ9A 2E1CA 2EZ2A 3EIBA 3NYSA 4LJZF 1WKGA 2QB3A 1WYVA 1KYWA 1IAWA 5D4SA 3B1CA 3Q8NA 2ESHA 4ADDA 2BGCA 2FU4A 3K2ZA 2Q2EA 4A72A 1AMSA 3GZ6A 4JE5D 2LF7A 5E17F 1P4WA 1O57A 1GXQA 2C7TA 3R9AA 4HLXA 5E3KA 1P6RA 2JJFA 5J8QA 1F5TA 3TQNA 2HEOA 2YRRA 3TATA 1B9MA 3CUQA 4RLGA 3I59A 1LW4A 1YIZA 4MQ9F 4GO1A 2XAQA 4WWCA 1DKAA 2HTSA 1WRJA 3R0JA 3BROA 1IF1A 5IT3A 1M0NA 3TO6A 3KGWA 1ARGA 1R23A 3IKTA 2Z9VA 3WKRA 3FDBA 4RKCA 4ATPA 5BMZA 2R5CB 3W1HA 4OBUA 4PGHA 1TPLA 3PPLA 4RAYA 1JGSA 1ASEA 2E7UA 3ZN0A 2LSOA 5BPIA 3FQ8A 1GD9A 3WZFA 2HUIA 4WYAA 3J80K 4ZASA 4PFNA 4FL0A 1H1CA 1G4VA 1CJ0A 2ISYA 2W7MA 1EH7A 4F5MA 3PD6B 3WTSC 4K2BA 5ICGA 2D63A 2D66A 4P96A 1LJ9A 2M30A 3MC6A 4AIHA 4WB0A 1J5YA 2HZTA 3K9TA 1ZGJA 5HDGA 2CH1A 4DQ2A 2L4AA 2NNNA 3J80Z 1IAYA 1S6LA 2VMXA 3L2CA 4IJAA 4KUMA 2K27A 1PDNC 2W7DA 5CVVA 4RAZA 2WK7A 1D2FA 4HQEA 5M4DA 4WLJA 2AY4A 3WTVC 4I2OA 4XBFA 1VJOA 3B1EA 1JXSA 3A2BA 1KA8A 5KVRA 5E8IA 5TRDA 2XIGA 2VMWA 2ELHA 1S06A 1KU9A 4ENNA 3DC1A 3T5XA 4GCVA 3G0TA 1R1VA 2FBHA 3CDHA 1ZC9A 1DTYA 3ABUA 4BA5A 3K40A 3PIUA 1RUNA 4IX8A 1ASGA 3HL2A 2PB2A 2HP1A 4WD2A 4LK1F 1ZLKA 2EV0A 3OV8A 3ELKA 4D0PA 5L3DA 4ITGA 4F5IA 4RGSA 1ARTA 1IN4A 2IW5A 1TASA 3ECDA 4YIFA 4NQWA 1D7VA 2YKYA 4ETSA 1KMKA 3EUHA 3II0A 3OKSA 2Y75A 4W1WA 3VFZA 3ECOA 2HR3A 5FB2A 1S3JA 2HYGD 3H7FA 2VN2A 3ACZA 2E7WA 2EA4A 4Q47A 1C0NA 4ZH4F 3NRVA 1AY5A 2JSCA 1LNWA 4RS8A 1IUGA 4LC3A 1BJOA 3N4MA 3ZPLA 3P9CA 3TOBA 1QGPA 2XAJA 4CVQA 4G7OF 3BS8A 2GXGA 2RDPA 1TQPA 3L8AA 1RVYA 1R1TA 3W1IA 3KEQA 3AEMC 3C18A 4ADBA 1P3WA 2VMVA 1OR7A 1RNLA 2CQKA 5L3BA 1SD5A 1ZG5A 2F5DA 4R8HA 1WSTA 2DAOA 1XGSA 2Z1YA 2ZKZA 1KKPA 1QZYA 1GC4A 1DGEA 3HQTA 1D7RA 3N5MA 4JE5A 6PAXA 3SZPA 2ZMEA 4HBLA 1HBXG 1X29A 4L9NA 1KGSA 3DZZA 2O3FA 3G73A 3FVSA 2FRHA 3GYHX 3TO9A 2ZNZA 3RPUA 2IVMA 1G6NA 2PFBA 5E5IA 2ZFWA 1Z05A 2DU9A 4I98B 3RCHA 2M45A 3QHXA 2MH2A 1IJIA 4ESBA 3BC8A 4LGWA 1DPUA 1W3UA 1KU7A 4YFXF 4UXNA 2Y0MA 4U0VA 4Y0IA 2VMYA 4H51A 4WXGA 1CQ8A 4KT5C 2E7JA 1C0WA 3FF5A 4AIJA 1TTYA 3L00A 3WGIA 2DK5A 3U2RA 3EI9A 5E1WA 2LNBA 3DRDA 4EVIA 3JU7A 3SQNA 3CQ5A 3DR4A 1JHFA 4AH3A 2E1NA 5HDMA 2VGUA 3DEUA 3E6DA 1D3YA 2AATA 3GJUA 3EI8A 4U1TA 4O6JA 5DCMA 3TQXA 3H3UA 4JBAA 4HA8A 5L3CA 2QQAA 2Z1ZA 2ETHA 4HV6A 4EB5A 3E5QA 2D1VA 5K5QA 2L4MA 1DGDA 2STWA 4RB0A 4K2EA 4Y0DA 2XROA 3E2ZB 1EH8A 2FA5A 2CWEA 3ELPA 3E5UA 3FSLA 2VBXA 2E7XA 3SXYA 1TW2A 2KJBA 5LEJA 1BI3A 2Z99A 2UXXA 3KEOA 4XSZF 3AATA 2A07F 4IXAA 5LEKA 1D8KA 3N97A 4WBTA 2YSRA 4WF2A 2ZSMA 5LGNA 1JS6A 2EFQA 4J5UA 1MAQA 3VK3A 2KKOA 2AY8A 4A5NA 2TPLA 4A6UA 3PFIA 4HX7A 4UVBA 4GEBA 5TJJA 1KQ9A 5H20A 1TLHB 3KLOA 1ASLA 1FLIA 4E1OA 1W23A 1M0PA 1YJSA 1WYUA 5EIGB 3RUYA 2VGTA 5G09A 1SF2A 1B1BA 2JRTA 3COGA 3GZCA 1JS3A 4EQQA 4MKJA 4EFFA 2P5VA 4HZFA 3IF2A 1SD6A 2YKUA 3LA3A 3UWCA 3OOPA 3B1DA 4GRXA 1REPC 1TQIA 5DX5A 3KP4A 2V6CA 1J2XA 4N0WA 2F5FA 4ZWVA 4CXQA 4XQ2A 3ISPA 1MLZA 3G7QA 2D61A 4H0EA 2GMSA 3BPXA 4IPAA 5KK1A 3DF8A 3DXJF 5ERIA 1ZGAA 3O2PE 3D0SA 3S2WA 4O3MA 2M5WA 2DQLA 3CJNA 4M2JA 1YIYA 1FNNA 2EFNA 1XDSA 4CO8A 2X5FA 4LD5A 2EFWA 5TF5A 1ZRCA 3AOWA 3QM2A 1G3SA 2HS5A 4MNUA 2F8JA 5HHYA 1MGVA 4EMYA 1FT9A 1ELQA 4FHTA 1YS7A 3NEUA 2QWWA 2M87A 2YR2A 5D5XB 3AOVA 1XSVA 1DJ9A 1W7PB 2COMA 2VXZA 2CSOA 3RQ1A 2BIEA 2W7HA 2ZSLA 4MHGA 1ARSA 5ILVA 4R1HA 5LRRA 2W7IA 3W6KB 4A0ZA 4MQPA 2D65A 3GFJA 4RGUA 1AY4A 1C4KA 3L9FA 5ICFA 1IUYA 3JSOA 1WYTA 2DKJA 3I5TA 2DQRA 3MZHA 4G6QA 2Y48A 3G3ZA 1ON2A 1UB9A 1MKMA 3QOPA 3MAFB 1H0MA 4P9UA 2DPDA 1I29A 3V7SA 5BS6A 3TDUC 4JF0A 2VIAA 5JI6A 1WKHA 5DUIA 3P9IA 2VMRA 1XCBA 2STTA 3M8FA 3V8LA 2Z9XA 4IXZA 4HYEA 2ZBKA 2W8TA 1K78A 2AEVA 2HORA 1ZRFA 1FOKA 3EI5A 1IVRA 3VODA 1TOIA 2O0RA 3ABTA 4ADCA 3FZ7A 4BA4A 3IWZA 2XUBA 4IYOB 2Q8KA 3RBLA 1Z1DA 1XI9A 5DCFA 4AZKA 5CJ9A 5DB5A 5CLSA 4HLYA 2FEZA 3NYTA 1XN7A 4EM2A 5LHIA 3F22A 2KIMA 2IA2A 1OHYA 2W7KA 3RKWA 4GE4A 3AEPA 2QUFA 1LB2A 2GIVA 3RDIA 4PFFA 3IC7A 1T39A 1IBJA 2XASA 5JAYA 1FYLA 3ZMSA 1DPRA 3IHJA 3F72A 2OZ6A 2RGVA 3B02A 4WYFA 1V4RA 2PN6A 3RKYA 1EH6A 3PDBA 2VC0A 1J04A 3QPGA 2YOBA 4M73A 2P7CB 1J59A 3FX3A 2FBIA 1XMAA 1RZ4A 2VT3A 1BJWA 4GE7A 4OMAA 2W8WA 4YG2F 4ZSYA 2HDCA 2E7IA 3ISLA 3K7YA 2KRFA 1AAMA 1AX4A 4XJOA 1LC5A 3CTAA 1DJEA 4ZDPA 2ADUA 4B09A 1XD7A 3HOSA 2OQXA 9AATA 2P6TA 1FG3A 1EG5A 2DBBA 4MY5A 2OGEA 4OTLA 3IRQA 4Y0HA 1MAPA 3WY7A 3GETA 4L0ZB 4CICA 3F6TA 4HF2A 3LWSA 2C6YA 4UUVA 3EETA 1IN7A 4U0YA 2A6EF 4GXOA 3GVAA 5E18F 1ZH5A 5H6QA 2W7EA 1IN8A 1USSA 4WXCA 3PJ0A 2R3SA 1CQ6A 3VOEA 1JF9A 3I16A 1ODDA 2HOYA 3BCXA 1SAXA 2ZUKA 1QITA 1SZUA 5JR3A 3GR9A 3M8EA 2HZPA 3GF2A 2H27A 3FMQA 4WYDA 2H6BA 2PEXA 2CSTA 3E2YA 3VEPA 1AMQA 3AELA 1AJSB 2YCPA 2V79A 2ZYJA 2DPUA 3E9KA 4JF1A 1STZA 4KXKA 2FNPA 2DO7A 1BI2A 3NX3A 3L7WA 2HOEA 2YU3A 4ASNA 1YNUA 1CF7B 1G7WA 4KAMA 4MKKA 3HDOA 1B4AA 2BWPA 1OXPA 4KDPA 2IRFG 3LSTA 2QA3A 4IXOA 1ASMA 3VAXA 4ZSWA 3B46A 4QWQA 1LEBA 1ZAOA 3V7RA 3QRFF 5HVQC 2R5CA 5AX8A 4HF0A 3CBFA 3KP7A 3WU1B 1YQAA 2M8EA 3KE2A 2BV6A 3DU4A 3V8JA 2EGYA 1BW0A 2JISA 1ASCA 2ISZA 2D64A 1R36A 2XAGA 1HKSA 1KMJA 4GE9A 4R5FA 4XRFA 1IX7A 4L0YB 1A04A 4R5ZA 4ZAHA 1E5FA 1PG8A 1HW5A 1Z91A 1T2KA 2GWRA 3PD6A 2V9VA 2R0TA 4ZZLA 3A9ZA 4YIIA 1PMMA 2BE5F 2WK9A 5EEHA 3JSPA 2W8UA 3AEJC 4E77A 2UZKA 1FYMA 1NHAA 1UU2A 4DNCA 1F4KA 3HRUA 1M6SA 1MDMB 4UVAA 1PMOA 5D5SA 3ZN1A 3A8UX 1ZARA 1Y0UA 5IT9K 2E54A 1C9CA 4HX4A 1Q1HA 3C7JA 4CXFA 3E6GA 4GYGA 5EAAA 2P6SA 4L9JA 1ZYRF 2VODA 3KETA 5E20A 4LK0F 4OINF 1XEYA 3HHGA 4EV0A 2VLFA 2MA3A 4CGZA 2H6CA 5F9SA 2BKWA 2XV4S 3C3WA 4OIRF 3RBFA 1AIAA 4A6EA 5L3FA 2Z9OA 1S08A 3FKDA 3ZZKA 5G4JA 5IT9Z 1QNTA 1OYIA 3ULQB 4G94A 1CZEA 3A9XA 2QB2A 4E3RA 2XRNA 1FWZA 4LLLA 5FD5A 1RI7A 3DODA 3F8NA 4UHTA 1KQ8A 2K02A 1XCVA 3QBOA 4CDGA 3EUCA 3GW2A 4ESFA 2XVCA 3K1PA 4KMFA 4GSAA 3K1MA 4G7HF 2VMSA 3BWNC 4IHTA 2AY9A 2C81A 1DFOA 3GXOA 3QN6A 4JEYA 1C7NA 2BHXA 3I4JA 2JT1A 1MLYA 1WKMA 4RGRA 3V8KA 4TN4A 4ITXA 4ZYDA 2XKPA 3BP8A 3BZ6A 3MEXA 1VEFA 3RYRA 1MGTA 4F5KA 5FT4A 1GBNA 2O61A 4G9YA 4KN4X 3RIRA 1V2DA 1W5TA 4N9HA 3KLNA 5G0AA 3FQAA 1AWCA 1RVUA 4RAEA 2HWVA 4WXHA 1LC8A 1B5PA 4U2HA 3NYUA 1QJ5A 4EU1A 2F2EA 4UV9A 3CUOA 3MEBA 4B8XA 4IVNA 2PB0A 4EB7A 2CJHA 1BI1A 3CAIA 4A0YA 2WKAA 4R79A 3GWZA 1W7LA 2AS5F 2VMUA 3HTSB 2Z9WA 3PGYA 4L5IA 5EUNA 1CL2A 3RI4A 2UWMA 2LF8A 4A12A 4I01A 1K7AA 3ERED 4MQRA 2FNUA 3H3ZA 1W7PD 2AY1A 2V1DA 2JG2A 2XAHA 4M9XA 4IY7A 1S09A 5H6RA 4Y17A 1GC3A 1B9IA 4F5GA 4L5JA 1QZ9A 4R8DA 4LG0B 1FZPB 1QZZA 3JTHA 3ZMUA 2D2WA 4P5OA 1CGPA 5D95A 2AEUA 1YTYA 3H14A 4JEVA 2NMPA 1MDXA 2EV5A 3JAMK 4ATQA 4HF1A 1LEAA 4PGGA 4KYOA 3R4TA 4RB1A 2HQNA 1LC7A 3KP3A 1LVAA 3B73A 1S0AA 4WYEA 4ESJA 5EQCA 2ZCWA 3EYIA 2IT0A 1HW1A 2A3SA 1LW5A 1IRGA 5I92A 1U5TC 4ISYA 3DXWA 1XGMA 1Z7DA 2EPJA 3EQLF 2W25A
chains in the Genus database with same CATH superfamily
2O7OA 1BQDA 4WXDA 1QZEA 4Y15A 4W91A 2BYJA 1N75A 2W1OA 4JQFA 2BWOA 3WG7H 3H0DA 1U3EM 1H9TA 4M6YA 3D6KA 1S07A 2D1HA 2L7ZA 3JAMZ 2OC6A 1T0FC 2CUZA 3SFIA 3FKJA 3MCZA 5J1YA 3LVKA 3AEOA 3GZDC 3EIAA 4WCGA 4ADEA 3BOQA 1O7LA 2AY7A 5BPDA 1K61A 2V6EA 2R7UA 3F6VA 3BR5A 4IRIA 2QSHX 3MADA 2F5CA 3LWFA 5CVUA 5F0HA 5M5XJ 1KONA 1TOJA 1UFMA 3EZ1A 3U1DA 3REOA 4EJVA 2RV8A 1FC3A 3OP7A 2W84A 2R7VA 3BR3A 3E2ZA 3TCMA 3COAC 1T6SA 2CJDA 2OJED 2QENA 2VONA 2DKBA 2RC4A 1BOAA 2GA2A 2VJ4A 5GADJ 1GCKA 1IZ1A 1W4MA 1FP1D 2KIUA 1P4AA 2W24A 4BEHA 2P8TA 1MZBA 1R58A 1FJLA 3NARA 3E2FA 4XRSA 3SEQA 4CCJA 3E6BA 1RR7A 2G7UA 3I58A 3I64A 2H1KA 2RKHA 1BJZA 2CGPA 4XLAA 5LFAA 3JRIA 4ZDLA 1I43A 3KGXA 1AIBA 3CUQC 3HUGB 2WK8A 3BQZA 2RQPA 3ZP5A 3PSIA 3FCRA 4A3DJ 1TOGA 5E1ZB 1TNTA 3ZRPA 2MC3A 3BR1A 5HLGA 3OYNA 1N2TA 1D0YA 5B5EC 2EBIA 2X48A 4Y7NJ 3LSHA 3OL3A 3WTTC 3AG4H 1X58A 5HLIA 3F23A 1JHHA 4I76A 1ZHFA 5EGOA 2Z9UA 3FVUA 1TATA 3JTGA 3ASOH 3RZOJ 3ZQQA 4LMYA 2O0YA 5FFXA 3GEZA 5J47A 2M9HA 2B63J 1W7NA 2PJRA 2K86A 3Q9VA 1IDYA 4FE4A 2P5LC 3HM5A 1AAWA 1ARIA 4P7YA 3ZRQA 4A0HA 1O62A 5EIGA 3FIWA 1YIJI 1F1ZA 2Z16A 1WWXA 1KL2A 1D7UA 4C2UA 2PJPA 4MEYF 4TV7A 2KRCA 4RB3C 3TEDA 3GUDA 4HDUA 1O3QA 2EZ1A 4I02A 1OHWA 1USTA 5C6UA 3I53A 2IA0A 2JUGA 3HGGA 4UHNA 3LL7A 5EF6A 1XX5A 5HS9A 4XIDA 5EGOB 1OHVA 2E60A 4WYGA 2EV6A 2VBYA 3BT9A 1IG7A 1LKXA 2ELKA 2VT2A 1TW3A 1J75A 2IA1A 3FK7A 4DYCA 4QLCU 4FE7A 3R6SA 4BUPA 3HKZA 3BDDA 4LW2A 4W1VA 3ABKH 2VI9A 5K1YA 4S04A 2GXAA 4CBSA 2CTZA 3L1PA 2JJEA 2MD5A 1LQ1A 3CCJI 3HVYA 2CJJA 2E35A 2AY2A 4XEWA 4BHCA 4L0OA 2OZUA 2JA5J 4RAGA 3PDXA 2E5NA 1W0UA 3FZVA 1ENHA 3CQ4A 1I39A 3MC6C 3ABLH 3A1YA 4RJ0A 3DR7A 3GZ5A 2R5ZA 3A9YA 5CVJA 3WTUC 1Y39A 2HP2A 1Y56A 3FMSA 2HKXA 3HSEA 2JZYA 4BXUA 3JRAA 3MKJA 2JA2A 3F3XA 2ZXHA 2FYFA 1ASFA 4CYDA 4AOAA 1X1PA 1MMDA 1OCOH 1MSEC 2X6WA 3JRHA 1ZKGA 4DZPA 1RPWA 4ZLVA 4DBCA 5B1AH 2VIBA 2L3DA 2BI1A 2FOWA 3PQJA 1W5SA 3C1DA 4WK8F 2ORDA 3ZZJA 1W7PA 5M4BA 3JRGA 2EZKA 1IO2A 1DGRM 4JK1X 3D5RC 4M6XA 3C2GA 4KMUX 3CP2A 2EB7A 4FX0A 5FJ8J 3I4NJ 3J7YJ 3Q5FA 1B8GA 2K9MA 1LDKB 1KQ0A 5EJCA 4K2IA 3KZZA 3GFMA 1D1AA 1SFEA 2ZSIB 4XSXF 5CQGA 3DFGA 1GVJA 4HV5A 4EJUA 4AYBA 4U7DA 5M46A 2OKKA 4F5FA 1M7YA 1XS9A 3QQAA 1IX8A 1TARA 2W85A 2A5YB 2E1OA 3OYLA 3M3YJ 2ZXJA 2M3AA 1TNSA 3W6JB 2CW0F 3BG6A 2DA5A 1VQ9I 2PG4A 5EEGA 1GEXA 5TISC 4E7ZA 2FXAA 1GV5A 1RESA 2KJCA 5LGTA 1AJRA 3FWEA 1O4SA 3ZR8X 1TZLA 3H9GA 4BDYA 2HOTA 3HB9A 4R2NA 1YIOA 2DT5A 3FXJA 3LSKA 2DOEA 2O8XA 4TMRA 2GBYA 2W4SA 3MAFA 2DJNA 2A69F 3EUHC 3FM5A 1DUXC 1HW2A 5BJ4A 2FE3A 3SYTA 2LY1A 3E6MA 3O6BB 3BCBA 1AHFA 1I27A 4P55A 1PP8F 3FXUA 4S05A 2J5PA 3V4GA 2CANA 1KZHA 4DYQA 1SMYF 3BWGA 1KU3A 5E8GA 5AONA 2R93J 1VP4A 2EK5A 1TQMA 3EPZA 1C7OA 2W8VA 4A00A 2VJIA 2CUEA 5D4RA 2CV2A 2X1DA 2G9WA 1NK3P 2K9NA 4HG2A 1Z3ZA 2FM1A 1X1BA 2L7KA 3BB8A 2E19A 3PUBA 3E7LA 3R61A 4BS9A 4NB5A 3B8XA 2EINH 3QP5A 3EZSA 1ZK8A 2VXDA 4A3KJ 3PQKA 4E7SA 1ULYA 4IHYA 1TOEA 4FT8A 1B6AA 1BR4A 3PJRA 2BWNA 4IYOA 1P7IA 2BHYA 1IXRC 5HOOA 4Z2YA 3U9GA 4C3IJ 2QBYB 2Z20A 3HRTA 2R4GA 1SZKA 3TP0A 1CL1A 4AO9A 1FIAA 1APLC 3OSGA 2ID6A 1OR7C 3SFZA 1DDNA 3AENB 4M6VA 1TWHJ 2DR1A 2UXNA 5M3MJ 1UU0A 1JE8A 4OBVA 3F6OA 3HPHA 1FMWA 1P92A 1S29A 3JCUC 4PUSA 3WGBA 3S1QJ 2IBDA 2M1BA 2BIAA 3WKSA 1R1UA 1CQ7A 4AO4A 3M1EA 5DD8A 5K5OA 2QEXI 2PQ8A 2L2OA 2ZMEC 2OU2A 2XPUA 5E3LA 1VQPI 5GAEJ 2ACJA 3QU3A 1H0CA 1ZQ3P 2O7CA 3BN1A 3RTRA 2HXOA 4K2MA 4LNMA 1GC0A 3DTIA 8AATA 1RKTA 2BHZA 4U88A 3BCAA 4XKVA 2JRMA 4I0BA 1AHGA 3I54A 3MZYA 5AIPA 4KNYA 2OGAA 1B4XA 1ZG1A 3LVLB 1W36C 2BI3A 2YKXA 4PK4A 2VASA 4UUTA 2H94A 2HZDA 3LV2A 2XF5A 2L02A 2HI3A 3HLMA 4N4NB 2XGCA 3ZQHA 1JTYA 2QM3A 1X2AA 4F7ZA 2HOZA 3HXLA 2XKOA 4F3QA 3JRCA 4QSHA 3S17J 1YJYA 2W7GA 3FZ6A 1GHCA 3GWPA 4BQ0A 3HG9A 3FXKA 1U8RA 2CFXA 3BJ6A 3QYBA 1V3FA 4LFUA 4HNVA 1WVRA 3E6CC 1H9GA 2LRDA 2H09A 3WGGA 1YO5C 1BA5A 1SZSA 2CB1A 2DA7A 2PO3A 3HZJA 4KA4A 5EAVA 2FNAA 3QI6A 2CQQA 3E3VA 2CJGA 3EI6A 4F91B 3HC7A 3HHHA 2OATA 1S8NA 4UHMA 3ZQ7A 2AHQA 4U0WA 3C2HA 2VMNA 4CBRA 2LG4A 4V19K 4YIRX 5FLXK 2XB5A 3CJQB 4G12A 4KICA 5DV5A 4ANJA 4EJWA 3OS2A 3HT4A 3JTXA 1YG2A 2ZXIA 2RN7A 3FFRA 1DP7P 1VTNC 5KHDA 4UHOA 1OISA 4OU0A 5EEAA 4ZYGA 3MKLA 3S2DJ 3R0AA 5F64A 5C4XJ 2EWNA 3E5XA 2GQNA 4XJLA 2VMOA 1X2NA 4GDYA 1OKRA 4ENKA 4XLCA 2DGKA 1IV8A 2BZTA 1M0OA 2AQEA 2XSDC 4A3BJ 3OYIA 3DV8A 4GRIA 1GXPA 2QCOA 4A69C 2F5EA 4CCNA 1E2XA 2AXLA 3GCMA 3HRSA 5EDNA 4HRIA 3TBIA 4Y13A 2LREA 2R7XA 3F0HA 5LHHA 4A6RA 1CZCA 4CA0A 1X1AA 2QQ8A 3J81K 1MNMC 1FOXA 4BBSJ 4EATA 2YPRA 1MJ9A 2Q0OA 4ZYHA 3AEMA 4M3GA 2FBKA 2V9KA 3LMMA 3Q0WA 5M5YJ 1PUFB 4XICA 3CJTB 1VQ4I 4EGZA 2P4WA 2CRGA 2VOPA 5DYMA 4OIOF 4AVZA 4A6DA 4BXFA 2JK3A 2VBWA 3OIQA 3IAS2 2NNYA 2EJRA 2PLYA 4PFPA 1AJSA 2VIXA 2WADA 3FZ8A 3W1JA 1OPCA 1MBJA 4AM3A 3A4CA 4MLOA 2WV1A 5J8CA 3E1SA 1ASBA 2R7SA 4JEWA 2WTEA 3JWBA 1L3LA 1VF9A 1IUFA 4BH9A 4IXSA 4XK1A 1FPQA 2A61A 1YFHA 2Z5UA 1CF7A 1YW9A 4PIWA 1K6YA 3T8TA 1J09A 2X1EA 3O3KA 1Z6TA 1W0TA 1RC9A 4LB6B 3WX9A 3K70D 2XGXA 3BV0A 5LRSA 2M34A 3JW9A 3ROUA 1V54H 2W7JA 5EUEA 2YX7A 2X9DA 2X4HA 4IHVA 4I7HA 3G1LA 5KAIC 2IS2A 1D5VA 3RJPA 5BQTA 2D7ZA 4WXBA 2ZSHB 2JVGA 3HDDA 1D1CA 1FG7A 3E97A 4FQGA 3GBGA 1QGNA 1O3TA 1UHSA 3ERMA 3RYPA 3BG7A 1IRFA 4LB5A 2XGDA 2O5RA 1G3WA 3R4KA 5DDGA 2XAUA 3KFWX 3KYLA 4W97A 1JGGA 2VQHA 1Y8QB 5FFZA 4Y52J 1U9NA 2Y2ZA 3A02A 2CW7A 2FX0A 1PUEE 4WP0A 4E4HA 1U5TB 2E34A 2YRIA 4IRHA 1YW7A 1QO0D 1R5GA 1AICA 3I4PA 3EYYA 1MW7A 1MNEA 4JX6A 4Q76A 3FM3A 5DJ1A 2GA1A 4EJOA 2OQGA 1TWFJ 4PJNA 2WAFA 3QPHA 3ZMDA 2FNIA 2VGVA 5JFRA 1G3TA 3L2RA 4A2UA 5E3NA 2IS6A 4DYRA 2R7ZJ 2LDUA 4BXXJ 3ATHA 3CO6C 4QIWN 2EIMH 1N31A 1QIRA 4PFOA 1JKQC 2VYCA 3WE2A 2KISA 4QPQA 3HGYA 1O7FA 1MDMA 1JJ6C 3SZTA 3TDZC 5J8FA 2BEOA 2IS4A 2W7FA 3E77A 3DKYA 5ILSA 3M4OJ 1WYVB 3NRAA 4BJ5C 4X6AJ 2KZGA 4OIQF 3NU8A 2HDWA 1XSXA 3FK6A 3IL2A 3I0TA 3LVMA 3PIPF 3GX4X 4FX4A 2MD0A 2Q2EB 1ASNA 1JUMA 2R7FA 1BT4A 4Q4ZF 5K7FA 2V1UA 4IHXA 4C2TA 1AHEA 4RLQA 1MMSA 2DJIA 3L2WA 2Y9ZA 1GDTA 2GSAA 1Z9CA 3T0YA 5HDKA 4HDVA 1AHXA 1L0OC 4LIVA 1SPAA 2OF7A 4HW0A 1AKAA 1HXDA 2EH6A 2R7OA 3CUQB 2VLHA 2Z61A 4ZTJA 3HBXA 5FT6A 5F08A 2HVQA 3I59B 3QYFA 2X3LA 4FFCA 2BY3A 5EG0A 1R22A 2R0QC 5DTDA 1WSTA 4AVPA 5JVTA 5DJ9A 2L01A 2Z3YA 3KP5A 4E7KA 3N0LA 3KKIA 3FXLA 3BR0A 5E4ZA 3WG9A 2GAUA 3L09A 3BJAA 2R2NA 2MABA 2ZB9A 1J32A 3BWOA 3KP6A 3U1KA 2GB3A 2QLZA 5B1BH 2YX4A 1QQIA 5F1JA 5F1RA 2DA6A 1YOVB 5AIQA 2XSJC 3K69A 3MN2A 2CH2A 5FD6A 5ICEA 1EF4A 5DUKA 2H8WA 1AHDP 1GDEA 1ERDA 1EV7A 1GEWA 2C0RA 4OYTA 4NHJA 4WLHA 1UCRA 4GDFA 3FTBA 4I8AA 2K9SA 3CQZJ 5KCMA 4ZZDA 5D5VB 4QGRA 3FXRA 3HIFA 3M9AA 2TDXA 5HLHA 2FQ6A 1ASAA 2EIJH 4RM2A 1QPMA 2DLLA 2AY6A 4BGDA 1ARHA 2VMPA 2JSPA 2I10A 3MQ0A 4AWXB 1P4XA 2PBIA 3DPLC 2YCNA 4ON0A 1S5LC 2ECCA 1EKEA 2QMAA 3WTYC 2L9NA 4XLPF 1SD7A 4KIFA 1XG1A 5D6EA 1YRNA 4CZZA 4DGTA 1D8JA 2KLOA 1BW6A 1EJIA 2FN6A 3LY1A 4BKXA 1E3OC 2ZJQF 2V1XA 1FBSA 1B8IB 3VYUB 5HDNA 2A68F 1FX7A 2F48A 1BM9A 1T38A 3WLXA 3H3VK 3I71A 4XKWA 2Z1DA 2VOOA 1AMRA 4F4EA 4WB0B 3K6GA 1YLFA 3DYDA 2VE8A 3JREA 2WV0A 1MD0A 2VMZA 4B44A 4B1RA 4E70A 4G6DA 1SFUA 4XLFA 1B9NA 4UV8A 2F4MB 1XDUA 2QSGX 2OD5A 1IAXA 1M4NA 2X6YA 1JKPC 2FQ3A 4WXFA 1U78A 3OS1A 1G4DA 3F8BA 3G8MA 2IAIA 4XJMA 1H88C 2K3FA 2D45A 4A3IJ 5G2PA 2DN0A 2DCEA 1UAAA 3EUAA 4Y4RA 2WAQA 4U87A 3QPTA 5CYVA 2P7VB 3HKZN 2V4JC 5DS9A 2EZLA 5FKOA 2FJ1A 1ON1A 1BI0A 3OWTA 5M5WJ 1YJZA 4KIBA 3HOXJ 3DQVC 2EFOA 2HFHA 2HUFA 4II2A 4ZM4A 3EDPA 2O1BA 2LC2A 1K79A 3BR2A 1O3RA 3CF2A 1SVVA 1BC8C 2LY9A 2JGTA 4M72A 1I5ZA 4OAZA 3H1CA 1X3UA 2WWYA 5J6XA 1LK9A 1V2FA 1QU3A 2O6GE 2ZJRF 1F9NA 1KYZA 4LLGF 1V72A 4AUXA 1KU2A 1IXSB 2DW4A 1MBKA 4IRGA 4RGXA 3OIPA 4N9IA 3TW7A 1A31A 1LE8A 4LG0A 2ZC2A 1E0EA 3LAJA 2HTJA 1DQUA 1LDDA 3WCOA 3SHFA 1T56A 2DT6A 3J7ZI 2CO5A 2BI5A 1J9IA 2DFHA 1YS6A 3FRKA 3PAAA 1BN5A 3MBBA 3USFA 3DXVA 1J7KA 3D5SC 3R60A 5HS7A 1R7JA 5JLXA 3IP4B 4ZYAA 3MWMA 4ZWMA 1BJNA 1TWAJ 2KFDA 2BI2A 1CS1A 3PO2J 3LFKA 4OOIA 2KDZA 4JEZA 4AIDA 3CO7C 4UVCA 2RFVA 1T95A 1J0RA 4F5JA 3TO7A 2HGCA 3L44A 2VPRA 1GC2A 3MFKA 3ML6A 4CYCA 1O4XA 3CCRI 3S3OA 4OC9A 2KQRA 3V42A 2GM4A 2PMHA 3S3NA 4KITB 1BIBA 4A3LJ 1E5EA 4L5EA 3QPSA 5D5WB 2QLRA 3NUIA 4M2KA 1TL8A 4ZC3A 1BJOB 1R5HA 5FRMA 2VMQA 2DMQA 5FKMA 3ZQFA 1U8BA 2X8UA 1PFFA 2IPQX 3WTZA 2E5ZA 3TFTA 3VSKA 2JQ7A 2LFBA 5LGUA 4QTRA 5D8LB 3DKWA 2DDBA 2HOXA 4LLNA 4A0XA 1HSJA 2ZNYA 1BC7C 2QBTA 4F92B 4M3EA 3ZQLA 4M9ZA 3P1TA 4PVFA 4B98A 4ZYEA 4CYCB 2XHKA 2RNJA 3H92A 4IQJA 4RIZA 4RKDA 4XAUA 3SZGA 1UHMA 4UOYA 5FT8A 2OKJA 2J5OA 1XMKA 4Q75A 4KYWA 1RV3A 1Z3XA 2X6XA 2GIZA 1TBXA 1MJAA 2IP2A 2M2EA 1V2EA 3BTJA 3KZYA 3QU6A 2CYYA 4X0GA 1IRZA 1ECXA 3DBLB 3HTUA 1IN5A 4XLNF 3ZQGA 3WCNA 1T98A 2ZMEB 1BBYA 5LHGA 3NNKA 1MSFC 1T33A 3VWBA 3FMRA 2LR8A 2DT7B 1LS3A 4WYCA 2PI0A 2KT0A 3HRMA 2ESNA 3T1BA 1I6XA 1SD4A 4OCAA 2OUMA 1AKHB 2KIQA 1U0JA 5BOXA 1MDOA 3S16J 4M2MA 2BW3A 4ENJA 1Z7LA 2EIKH 2BBYA 4RITA 4P9FA 2A6HF 3HUGA 2MBFA 2B7EA 4XOTA 4MTDA 3NUBA 2WC2A 1SMTA 1Z3YA 4NBQA 5FO5A 3G4SI 2KL4A 3U21A 5EFSA 5JLWA 2XH1A 3TFUA 3RI6A 2XPVA 3Q9SA 2VI8A 1MBEA 2E1MC 2Z67A 1D7SA 3IRRA 4UNOA 1Y4IA 2DTZA 3IKVA 3DWLE 3HOVJ 4XNFA 1OXOA 3F21A 3S1RJ 3N75A 4RM1A 3TMOA 4JX5A 1XSDA 3JR9A 1IDZA 3QP6A 3PO3J 5EUDA 2CFBA 2BW3B 4F5LA 3HSRA 3IH2A 2DMNA 3GLXA 3RCHB 3CMAI 1TWCJ 2DTRA 2X51A 1S7OA 3B6CA 1OMIA 3ZMVA 2YKVA 3LQRA 4KN7X 2C44A 3S15J 4CXRA 3JRFA 3VK2A 3KPHA 1O3SA 4HX8A 1EQBA 2JPCA 5CKTA 1QVUA 5GTIC 2DK8A 3GFLA 4YFNF 2DI3A 4BAYA 3NTJA 5BJ3A 2MLGA 3LA7A 5HNFA 3F8FA 2FF4A 3VOMA 4W5KA 2EILH 4D9JA 1TP4A 3JRDA 4ZDOA 3CC7I 5L3EA 3T32A 1B5OA 4Q31A 4XM3A 3OYDA 1LFUP 1OCTC 2L9VA 5D8KB 1YOOA 2TRTA 2CY8A 1TOKA 3I5UA 2OA4A 2OAZA 4GFBA 2V7FA 2I5UA 2LKPA 4NNJA 4XKCA 4NUBA 2X5DA 3TGNA 3GSBA 3GO5A 3OMYA 1R4MB 3J7AO 1M0QA 2HQRA 5DCMB 5HXXA 1YE9A 4HF8A 2K9QA 1MH3A 5JHUA 1D0ZA 1RIOH 3D5LA 2DGLA 3OYHA 3HMUA 2K7LA 4HOBA 4HAMA 2ZJGA 2ZFUA 2CH0A 2R7DA 2LKSA 2XDVA 5HLTA 5E3OA 1Y0NA 4NOGA 3WHBA 2OBPA 2QVOA 4D7MA 4UQVA 1BKGA 1LDJA 1Z21A 2HQ5A 2VL8A 1QJ3A 4RLFA 3PFYA 3Q0VA 1RUOA 1ZODA 1B9HA 5K8BA 3UKGA 2HUUA 4EMSA 1ASDA 3BR6A 1I1GA 3F8CA 3WHCA 3IHUA 5DEQA 2QYOA 5FROA 4AIKA 3L2QA 2VGSA 3ZRRA 1OYYA 5GAHJ 3UAKA 4MGRA 2FD5A 2P5KA 3MD2A 1AHYA 2IGKA 2FMYA 3WGHA 1LPQA 3WTWC 1VQKI 4B43A 1ONVA 3FD0A 4E3QA 3JWAA 3LSIA 4ABZA 3LAPA 2QGUA 4L9VA 3ZQIA 1X0MA 2FMLA 5J3LA 3DP7A 5LH9A 4M71A 1U6GA 4U7BA 3DPTA 4EM1A 4RJYA 2HQAA 3P9KA 1OLTA 3K4KA 1ORDA 2JJGA 5L3GA 3IWFA 4LW4A 3RKXA 4BHDA 2W8JA 3QAHA 4HQMA 4O6ZA 3KEYA 4FETA 1XB4A 2R7RA 1KL1A 2VGZA 1XC5A 2NVYJ 2ZC0A 2W7LA 2LD5A 4Q5SF 2RQQA 4ITVA 1ZR2A 1I50J 1WYUB 3K2AA 3DU5A 3VK4A 1FSHA 3GBXA 2EO5A 3LA2A 2V1PA 1LFBA 2LKXA 1O61A 5IWQA 3ASAA 3MAUA 2K4JA 1DP3A 1M32A 5D5UB 1DJUA 4L9TA 4C30A 3KP2A 1BJAA 2AY3A 1HKQA 1O69A 2K85A 4D1QA 3F9KA 2YCTA 4N0BA 4XONA 1GV2A 3LSRA 4M74A 1WI9A 2Z33A 1BS0A 2G6WA 2R7QA 4DQ6A 5G2QA 2I8DA 2KMUA 4FASD 2VMTA 4BY1J 1AOYA 3GTGJ 4IQ4A 3FQ7A 1JG8A 3ECHA 4BBRJ 4II3A 1POGA 1HKTA 1YJWI 5EZHA 4F5HA 1MMGA 1FBUA 3ASBA 4DW6A 1ETWA 2MG4A 1FC4A 3FFHA 1V5GA 1N8PA 3BPVA 4G7ZF 5F6FA 3WE3A 4BHBA 4RBOA 4MTEA 2K4BA 4P3MA 3F9TA 4GGGA 2DFIA 2M7BA 2NYXA 2HOAA 3A03A 3TP3A 3V7CA 1KKJA 3AEJA 4W1XA 1IW7F 2VC1A 3C2BA 3F8MA 4BACA 2V0YA 2W57A 3I3LA 2B0LA 1YX3A 1PVEA 4IX7A 2NVQJ 3ELEA 1XPXA 1FEXA 2QBYA 3S32A 1Z6RA 3GTQJ 1GEYA 4CH7A 4LNJA 1PP7U 1S7AA 2VGWA 4ZM3A 4OMZA 3AENA 4A0FA 3CCEI 1AKBA 4WX9A 2GZWA 1IN6A 2IJLA 4MQVA 5K5RA 4HVKA 2EQRA 3UNGC 1ZG3A 2MLKA 4D5CA 3QYEA 3EI7A 3PA9A 3OYCA 2CS3A 1LFPA 2DMTA 2AY5A 2NS0A 1FP2A 2ZP7A 3WGCA 2BY0A 2DYRH 3MMYB 4I0AA 4QPOA 1ZREA 2M4KA 3BG5A 3OYAA 2BI9A 4J8LA 2EA2A 3CMMA 4L18B 3M7GA 2E2JJ 3CCSI 2XBNA 1WCMJ 3QWLA 2VQCA 3P7NA 1EJ9A 1BQAA 5IYDJ 2XGEA 3PSFA 4XORA 2FSWA 1P7JA 1LKCA 5IP7J 1MDZA 1XGNA 3CQ6A 1X19A 2KPMA 3KE3A 2FOKA 1Y8RB 1AMAA 1I41A 3CLOA 1HF0A 2ZO4A 3NDNA 1JKRC 3FBIB 1QISA 2BYLA 1UHWA 3LVJA 2HYFA 1UZCA 3NQOA 4RAFA 2NS8A 2ID3A 1QRYA 4YFKF 3WTXC 4EJTA 3FVXA 2MC4A 3QGUA 1W1WE 1G3YA 3CJRB 1W5CC 2CG4A 2PMZN 2Y0SA 3BJOA 3HPGA 1MJBA 4PJJA 4A5MA 1WSUA 2OQRA 4BY7J 4M9SA 4PZJA 1X28A 2YUSA 2FUG2 1WYTB 2GLOA 1K4TA 1QBJA 5LD2C 3UE8A 1P2FA 4KIGA 3T8RA 1X4PA 3S93A 5A2QK 5E1XA 1B59A 1IXCA 2MH9A 3HJEA 2G7HA 3J7AY 5M49A 3KZIC 1AY8A 2YHKA 3DEEA 3FXOA 2FQ4A 1FSEA 3MAJA 2GQQA 2XB0X 4CCOA 1SFXA 3BWNA 3CCUI 5F8VA 4B47A 2IGNA 4IHSA 3FHZA 4B9BA 1A6IA 1WQ2A 3JW4A 4EM0B 2JPBA 4A0RA 1U2WA 5H2FC 1MBFA 5IYCJ 1E17A 1C7GA 4F55A 1DU6A 3TL4X 4ENMA 1S9HA 1K78B 1YAAA 4MSOA 3BY6A 4I09A 4PDKA 5ED4A 4MEXF 3K10A 1HQCA 2CINA 7AATA 3H5NA 2CV1A 2ZJ2A 3JZLA 2IGOA 1FMVA 2LBFB 5A2QZ 4EGYA 4XLHA 1BIAA 1DU0A 3FDYA 4G8XA 5FT5A 5CVRA 3KCCA 3TKYA 3K28A 1G4XA 3M5UA 2QQBA 1ELUA 1PUFA 2R5EA 2W48A 3RPQA 5DD4A 1U08A 4KFCA 2RVCA 2F5VA 1ZN2A 2D7YA 1Z7UA 5J1RA 1WJEA 1R00A 2NXNB 1T3IA 2ME0A 1YITI 5M3FJ 2DFEA 2R92J 5ILUA 1W7MA 4JEXA 1K6OA 2DA4A 3PNYA 3ZMZA 2EFPA 4IF4A 3FXQA 5FGMA 5FLXZ 4Q6RA 3K0LA 2GXBA 2NAZA 4CHUA 2HVSA 2VE9A 1N77A 5F04A 2DOUA 1VI0A 1TC3C 3FXMA 2CQ7A 5GPAA 1XGOA 1Y1WJ 4A6TA 2NVUB 4CUGA 2O03A 1MH4A 2NVTJ 4OT8A 3AAFA 3WODF 4AD9A 4Z6YA 1B72B 3PDBB 4Q48A 2GMUA 4W8IA 2KZVA 4BMKA 2NRAC 3P6KA 3DTKA 2EZHA 4NC7A 4BQAA 4PCQA 4BHPA 5C4JJ 2V9PA 1UKJA 4O5VA 2ICWG 3WU0A 1IV6A 4RB2C 1OCRH 3K1NA 1G7XA 2DA2A 3VPRA 1FY7A 2JMWA 4XJPA 2KIFA 4MQQA 3AV7A 5D6FA 5FKKA 2WAQN 2Y69H 3J81Z 4BNCA 1OATA 2JJHA 3VP6A 3SDBA 3LQQA 2PMUA 1SVLA 1WGXA 4OWRB 4DGWB 5LBQA 5IYBJ 1RV4A 3HOTA 2R7TA 1I48A 1OYWA 1YW8A 2BIGA 4OMYA 5CVIA 2BY1A 2QZ8A 2XAFA 5ICCA 3GFIA 2DGMA 4A0GA 5LHAA 2LTPA 3FBNB 3D1NI 1WZ2A 2L54A 1H89C 4CCLA 5G4IA 3TOAA 4PSWA 4LNLA 1ZRDA 5HS8A 3OYEA 1U5TA 2DMUA 2VBZA 3HYIA 2WB1N 3I55I 1FYKA 1IX6A 1BJ4A 3A01B 3LG0A 4AZJA 1SFFA 1HSTA 3CD6I 2D5YA 3OR2C 4BDZA 1ZGWA 1UU1A 1ZOBA 5J40A 2A05A 4MO7A 1ZLJA 4GYIA 4P1WA 4BYYA 2X0LA 3G2BA 1T0FA 2BYVE 3GZDA 1AKCA 1FBQA 1I1SA 1K83J 2NVXJ 1Z0XA 3HSFA 2JTVA 4OIPF 2Q7WA 5LLQA 1YYVA 2HDDA 3VB2A 3ZMTA 2M0MA 2HKOA 4IW7A 2QQ9A 2E1CA 2EZ2A 3EIBA 2NS7A 3OL4A 1ETVA 4LJZF 1QA6A 1WKGA 2QB3A 3NYSA 3HOYJ 1WYVA 1KYWA 2L7FP 1IAWA 5D4SA 4JOMA 3B1CA 3Q8NA 2ESHA 2QKLB 4ADDA 2BGCA 2FU4A 3K2ZA 4KJZA 4AU7A 1SVOA 2Q2EA 2WY8Q 3NWTA 1JJ8C 4A72A 2NOGA 1AMSA 3ZCOA 4V2FA 3GZ6A 4JE5D 4DOZA 2LF7A 5E17F 1P4WA 4J19A 1JI8A 1O57A 1GXQA 2C7TA 3R9AA 4HLXA 5E3KA 1P6RA 4A3MJ 2JJFA 2UV1A 1F5TA 3TQNA 2HEOA 2YRRA 5J8QA 3TATA 1B9MA 4BJTA 3I56I 1R49A 3CUQA 5F0CA 4RLGA 1W36D 3I59A 1HDPA 2PMZA 4NDLA 2VKVA 4IO9F 4A3JJ 1LW4A 1YIZA 4B4CA 2YU9J 4MQ9F 4PSXA 4GO1A 2XAQA 2E1MB 4WWCA 3NU7A 1DKAA 2HTSA 3IAM2 3RPUD 2EZIA 3HOWJ 2XF6A 2IGMA 1MIJA 1WRJA 2W00A 3EQLF 2HVRA 3R0JA 1Y6IA 3BROA 5IP9J 3LNQA 5IT3A 1IF1A 1A5JA 1M0NA 3TO6A 3KGWA 1ETOA 1ARGA 1R23A 3IKTA 4RDUA 4UB8C 2Z9VA 3FDBA 3WKRA 4RKCA 3L2UA 4ATPA 5BMZA 3JRBA 2R5CB 3OYMA 3W1HA 4OBUA 3OOUA 4PGHA 2KHMA 1TPLA 3PPLA 4RAYA 2DODA 4CSWA 1JGSA 4DZJA 1ASEA 2E7UA 3ZXSA 1A35A 3ZN0A 2LSOA 1D1BA 1D5YA 5BPIA 3FQ8A 5FKLA 1GD9A 3WZFA 2HUIA 4WYAA 3J80K 4BU2A 4ZASA 4PFNA 4FL0A 1H1CA 1G4VA 1CJ0A 3BQYA 2ISYA 2W7MA 1VQ7I 1EH7A 3ASNH 4F5MA 3PD6B 3WTSC 2JVHA 4K2BA 3KIOA 5ICGA 2VB6A 1V55H 2D63A 1B8IA 3H5AA 2D66A 2F6CA 4P96A 1PYVA 1LJ9A 2M30A 4UUSB 3GTMJ 3MC6A 4AIHA 2Y30A 1ETYA 1YJNI 4WB0A 2BXZA 1J5YA 4W1UA 2HZTA 2A6TA 3K9TA 1V5EA 1ZGJA 2E71A 4XL9A 5HDGA 4D7NA 4DQ2A 2CH1A 2L4AA 2NNNA 3J80Z 1NH3A 1D0XA 1IAYA 1RETA 1S6LA 2VMXA 4KUMA 4IJAA 3MKYB 3L2CA 2WA0A 3LFUA 2K27A 1RR8C 1OQYA 1PDNC 1VQ8I 5CVVA 2W7DA 4RAZA 2WK7A 1D2FA 4HQEA 1X3WB 5M4DA 4WLJA 2HOSA 2AY4A 3WTVC 4AC0A 2VLAA 1R9TJ 4I2OA 2OCCH 2LOOA 4XBFA 1VJOA 3B1EA 1JXSA 3CCYA 3A2BA 2VQLA 3CCVI 1KA8A 5KVRA 5E8IA 5TRDA 2XIGA 2VJJA 2VMWA 1JUPA 2ELHA 4CCMA 3H0GJ 1KU9A 4ENNA 1YI2I 1S06A 3DC1A 3T5XA 3G1MA 4GCVA 3QODA 2X1CA 3G0TA 1R1VA 2FBHA 4HPQA 3CDHA 1ZC9A 4M3FA 1DTYA 4DIQA 3ABUA 3X2QH 4BA5A 3K40A 4XQFA 1RUNA 3PIUA 3HL2A 1ASGA 1MMAA 4IX8A 2PB2A 2HP1A 4WD2A 4LK1F 1ZLKA 3OYGA 2EV0A 3A0HC 1WHUA 3ELKA 3OV8A 1WH5A 5L3DA 4D0PA 4M3BA 3W6VA 4ITGA 4F5IA 1OFCX 2VKDA 4RGSA 1ARTA 2DMPA 1U9OA 1IN4A 2IW5A 3DPUA 1TASA 3ECDA 4YIFA 4NQWA 2V1NA 3AG3H 3HEFA 1D7VA 2YKYA 4ETSA 1KMKA 3EUHA 3II0A 3OKSA 3M07A 2Y75A 3K4MA 2GOMA 2WB1A 3H5RA 3WU2C 4BQOA 3VFZA 3CC2I 2PX9A 4W1WA 3ECOA 4LIUA 4D5FA 1NTCA 2HR3A 5FB2A 1S3JA 3Q3SA 2HYGD 3H7FA 2VN2A 3KYCB 3ACZA 1Q1VA 2E7WA 4PJMA 2EA4A 4Q47A 1C0NA 4ZH4F 3UR3C 3NRVA 1AY5A 3VYRB 3K4BA 2JSCA 2NOJB 1LNWA 4RS8A 1IUGA 4LC3A 1BJOA 4NQWB 3N4MA 2MYSA 3ZPLA 2LP0A 2VJ5A 3P9CA 3CDIA 3TOBA 3DEWA 1S72I 1F36A 1QGPA 1R5ID 5IOYA 1N25A 2XAJA 4CVQA 4G7OF 3BS8A 3GTKJ 1HA8A 2GXGA 2RDPA 1TQPA 3L8AA 1RVYA 2TCTA 1R1TA 3W1IA 3KEQA 3AEMC 2WBMA 3C18A 4ADBA 1P3WA 1ITYA 1OR7A 1RNLA 2CQKA 2BXYA 2VMVA 4CZCA 5L3BA 1SD5A 3W2VA 1ZG5A 2F5DA 1RKWA 4R8HA 2DAOA 1XGSA 5GTHC 2ZKZA 4X1EA 3N05A 1FTTA 1KKPA 2Z1YA 1QZYA 1GC4A 1DGEA 3HQTA 2K3PA 4B3XA 1D7RA 3F0CA 3PNVA 3ZQCA 3N5MA 1YHQI 2E36A 4JE5A 6PAXA 3SZPA 2ZMEA 4HBLA 3ZOBA 1HBXG 4L9NA 1X29A 1KGSA 3DZZA 2O3FA 3NAUA 1V5FA 1TT0A 3G73A 3FVSA 3S8PA 1ORKA 1JUSA 2V26A 5K7HA 2FRHA 1AKHA 1WJAA 3GYHX 3TO9A 3HOUJ 4RM3A 3I4MJ 1SFKA 2ZNZA 3RPUA 2IVMA 2CQXA 4HEA2 3QOEA 4N4OB 2R5YB 1G6NA 4BL0B 1HCRA 2PFBA 1TT5B 3CP8A 3P5JA 1E3HA 5E5IA 2ZFWA 2KDOA 1Z05A 2DU9A 4I98B 1I3AA 3RCHA 2M45A 3S2HJ 3QHXA 2MH2A 3RKQA 4ESBA 3BC8A 1IJIA 3DTEA 2VPLA 4LGWA 2AXTC 4MFDA 1DPUA 2Y9YA 1W3UA 1KU7A 4YFXF 4UXNA 2Y0MA 1HC8A 3AG1H 2MSYA 2M8GX 4U0VA 4F52A 4ZTFA 4J00A 4Y0IA 2VMYA 4H51A 4WXGA 1CQ8A 4H4KC 4KT5C 2E7JA 1C0WA 3FF5A 4AIJA 1TTYA 5FLVA 1BR2A 3L00A 3WGIA 2DK5A 3U2RA 3HOZJ 2M7AA 3EI9A 5E1WA 2Y0SN 1LUJB 2LNBA 3DRDA 4EVIA 2EH3A 2A5WA 3JU7A 3ESWB 3SQNA 3CQ5A 3DR4A 4KISA 1JHFA 4AH3A 2E1NA 1MNDA 2VGUA 5HDMA 4BQQA 3DEUA 5GAGJ 2DFFA 3E6DA 1D3YA 2AATA 2M0CA 3GJUA 4A3CJ 5KNLA 3EI8A 4U1TA 4O6JA 5DCMA 3TQXA 4FTHA 3H3UA 4JBAA 1WJ5A 4HA8A 5L3CA 3K4NA 2QQAA 2Z1ZA 2ETHA 2YS9A 4HV6A 4EB5A 3E5QA 2D1VA 5K5QA 1FIPA 2L4MA 1BR1A 1DGDA 2CMPA 3AG2H 9ANTA 2STWA 4RB0A 2F4OB 4K2EA 4Y0DA 1FTZA 3G71I 2XROA 3FKIJ 1EH8A 3LSGA 1VFCA 2LK2A 3E2ZB 2MFZA 2FA5A 2CWEA 3ELPA 3E5UA 3FSLA 2VBXA 5C44J 2E7XA 3SXYA 1TW2A 2KJBA 2QA4I 5LEJA 4BEHB 5IPAA 1BI3A 2Z99A 2UXXA 3KEOA 4XSZF 3AATA 2GOXB 2A07F 4IXAA 5LEKA 1HDDC 1D8KA 3O8HA 3N97A 4WBTA 2YSRA 4WF2A 2ZSMA 2DDAA 2RAEA 1QHGA 5LGNA 3LSPA 3FHNA 1SC7A 1IC8A 1JS6A 2EFQA 4J5UA 1MAQA 2P81A 2KKOA 3VK3A 2AY8A 1G59A 1WJCA 4A5NA 2CFOA 2LMDA 2TPLA 2QSFX 4IOAF 3DLLF 4A6UA 3PFIA 4HX7A 4UVBA 4GEBA 3MKWB 4HSTA 5TJJA 1KQ9A 4F93B 5H20A 4XRSG 1TLHB 3KLOA 1ASLA 1FLIA 4E1OA 1MBGA 4XN0A 3CMEI 1W23A 1M0PA 2PJRB 2RREA 1YJSA 4Y33A 3DBRB 3PNTA 2L9RA 1WYUA 1XTAA 4LITA 3I9V2 3DLAA 1IJWC 2VGTA 5EIGB 3RUYA 2W7NA 5G09A 1SF2A 1B1BA 4IOCF 2JRTA 1EA3A 3COGA 3GZCA 1JS3A 1JT6A 4EQQA 4MKJA 4EFFA 2P5VA 4HZFA 1G8XA 3IF2A 1SD6A 2YKUA 2E2IJ 3LA3A 3UWCA 3OOPA 3B1DA 4GRXA 1REPC 2JN6A 3S14J 5BNGA 1TQIA 5DX5A 3KP4A 4MIMA 2V6CA 1J2XA 4N0WA 2F5FA 4ZWVA 4CXQA 4XQ2A 3ISPA 1S7EA 1MLZA 4E6KG 3G7QA 2D61A 4H0EA 2DOFA 1FOWA 2GMSA 3BPXA 1ZR4A 4IPAA 5KK1A 3DF8A 3DXJF 4V2GA 5ERIA 2CW8A 2VQGA 1ZGAA 3O2PE 1K4SA 3D0SA 3S2WA 4O3MA 2M5WA 4IHWA 2DQLA 3CJNA 4M2JA 2EPFA 1ACIA 1YIYA 3M1CA 1FNNA 2EFNA 3IV5A 5GPCA 1XDSA 4CO8A 2X5FA 3HBLA 4LD5A 2EFWA 5TF5A 2R5ZB 1IGNA 1ZRCA 3AOWA 3QM2A 1G3SA 2HS5A 3W3CA 4MNUA 2MW8A 4BE1A 1MGVA 2M4GA 2F8JA 5HHYA 3BZCA 1DGWY 4EMYA 1FT9A 2IS1A 1ELQA 2B9SA 2OPTA 4FHTA 1F43A 1YS7A 2DYSH 3NEUA 2QWWA 5CQEA 3H36A 2JUCA 2M87A 2R7WA 2IEKA 2YR2A 5D5XB 3AOVA 1XSVA 1DJ9A 4E7JA 1W7PB 2COMA 2VXZA 1ZELA 3IH3A 2CSOA 3RQ1A 1XMXA 4OAYA 2BOLA 3G1OA 2BIEA 2W7HA 2ZSLA 1P9QC 4MHGA 1ARSA 1I3QJ 2DOAA 5ILVA 2DXIA 4R1HA 3K70C 2P0WA 5LRRA 1ETXA 2W7IA 3W6KB 4A0ZA 4MQPA 2D65A 3GFJA 4RGUA 3MKZA 1RRJA 3SJMA 1VQLI 1AY4A 1C4KA 4JYKA 1Z77A 2BVLA 4EEFG 3L9FA 5ICFA 1IUYA 3BZKA 1NG7A 3JSOA 2JA8J 1WYTA 2DKJA 3I5TA 3AL0C 3H9JA 3Q0UA 1N78A 2DQRA 1BW5A 3MVPA 5B3SH 3MZHA 4G6QA 3AFHA 2Y48A 3G3ZA 1ON2A 1UB9A 1MKMA 3QOPA 3MAFB 1H0MA 4P9UA 1HLVA 2DPDA 1I29A 3V7SA 5BS6A 2LLKA 3TDUC 4JF0A 2VIAA 5JI6A 3BG9A 1YJ9I 1WKHA 5DUIA 3P9IA 2VMRA 1WJBA 1XCBA 2STTA 3M8FA 3V8LA 4I99C 3S1MJ 4A3GJ 4HYEA 2Z9XA 4IXZA 1ZTRA 2ZBKA 4XOPA 1M1EB 2W8TA 2JJ7A 1K78A 4BE0A 2AEVA 2HORA 2CUJA 1ZRFA 3O8GA 1FOKA 3EI5A 3BTCA 1IVRA 3VODA 1TOIA 2LVSA 5DM6F 5FLMJ 4BQNA 2O0RA 1VNDA 2F4IA 3ABTA 4ADCA 3FZ7A 4BA4A 2DA1A 2LBFA 4BE2A 1VQ5I 2D5VA 2W82A 3IWZA 2XUBA 4IEJA 4IYOB 2Q8KA 2WY7Q 3RBLA 1Z1DA 1A36A 3GTLJ 1XI9A 1R6RA 5DCFA 3IUOA 4AZKA 5CJ9A 5F0FA 3CMYA 3PM1A 5CPRB 5DB5A 3CC4I 2HNHA 5CLSA 3PUFA 4HLYA 2FEZA 4E7LA 3NYTA 1XN7A 4EM2A 5LHIA 3W2AA 3F22A 2KIMA 2IA2A 4XRMA 2HPIA 1OHYA 2W7KA 4LOCA 3RKWA 4GE4A 3AEPA 2XPWA 2O9LA 2QUFA 3W2WA 1LB2A 1GLNA 2GIVA 3RDIA 2X6OA 5FRNA 2HPMA 4PFFA 3IC7A 1T39A 1IBJA 2XASA 1AU7A 5JAYA 4XR6A 3GTJJ 2BY2A 1FYLA 1QVTA 2HU9A 1DPRA 3ZGKA 3ZMSA 3IHJA 3F72A 2OZ6A 3LSJA 2OCEA 2RGVA 3BTLA 3B02A 4WYFA 1V4RA 2PN6A 3RKYA 1EH6A 1B72A 3PDBA 1IRXA 3OS0A 3RZDJ 2ME6A 3AKZA 2VC0A 3OY9A 5HODA 1J04A 1BOBA 3QPGA 4E7IA 2YOBA 4M73A 2P7CB 2IXSA 1J59A 3DBHB 3FX3A 2FBIA 1XMAA 1RZ4A 4A93J 2VT3A 1BJWA 5J4VA 1JKOC 2CU7A 4GE7A 4OMAA 3SEZA 3K4LA 4YG2F 4RMNA 2W8WA 4ZSYA 4UY8I 2HDCA 2LYCA 2E7IA 3ISLA 3BLYA 3DCFA 3K7YA 1QPIA 3VYTB 4C2MJ 1T8IA 4DJAA 2KRFA 1AAMA 1AX4A 3OIOA 4XJOA 1LC5A 1VQNI 3CTAA 1DJEA 1VZ0A 1SAUA 4ZDPA 3CLQA 1A6QA 3GTPJ 2ADUA 4B09A 2ELJA 2ZJPF 1XD7A 3QPLA 3HOSA 2OQXA 9AATA 2P6TA 3K4CA 1FG3A 2OTJI 1EG5A 2DBBA 4MY5A 2OGEA 4OTLA 3IRQA 4Y0HA 5EYRA 3RCOA 1MAPA 3A01A 3GETA 3WY7A 4L0ZB 4CICA 3F6TA 3E0JB 4HF2A 1Y1VJ 2C6YA 4UUVA 3EETA 1IN7A 3LWSA 4U0YA 2A6EF 4GXOA 3RQ4A 1WJDA 3GVAA 1WPKA 4UB6C 5E18F 5H6QA 1ZH5A 2JA7J 2W7EA 4HNTA 1IN8A 1USSA 4WXCA 3PJ0A 2R3SA 1CQ6A 4S0HB 3VOEA 1JF9A 1LVKA 2H1LA 3I16A 1OCCH 1ODDA 2HOYA 1PJRA 3BCXA 3NWSA 4C3HJ 1SAXA 2QKMB 1T08B 2ZUKA 1QITA 1MMNA 2H8RA 1SZUA 3K4JA 5JR3A 2CQNA 3GR9A 3GLLA 3M8EA 2VKHA 2HZPA 3GF2A 2H27A 3FMQA 4WYDA 2H6BA 2PEXA 5FKNA 4FCYA 2CSTA 1NK2P 3E2YA 3VEPA 1AMQA 1I6HJ 1SANA 2XF7A 1SFOJ 3AELA 2XC7A 1AJSB 5EZGA 1X4OA 5E3MA 2YCPA 2V79A 2ZYJA 2DPUA 1R71A 4ZJZA 3E9KA 4JF1A 1STZA 5K7ZA 4KXKA 3CDLA 2FNPA 1E3PA 2DO7A 1BI2A 3NX3A 3L7WA 4G6TB 2HOEA 2AQFA 3RSNA 2YU3A 2ZXWH 4ASNA 1YNUA 1CF7B 1G7WA 4KAMA 4MKKA 1R4NB 3HDOA 1B4AA 4RA2A 1SEUA 1OCPA 3H35A 2BWPA 2QF7A 1NG6A 2VI6A 3VSLA 1OXPA 3KYDB 5GP9A 4KDPA 2IRFG 3LSTA 4A3FJ 2QA3A 4IXOA 3ABMH 4DBQA 1ASMA 2VKEA 4M3DA 3VAXA 1WJFA 4LG3A 4ZSWA 3B46A 4QWQA 4XN3A 1LEBA 1ZAOA 3V7RA 2KP6A 3BG3A 3QRFF 5HVQC 2R5CA 4XK4A 5AX8A 4HF0A 4Y3OA 3CBFA 3KP7A 2Q1ZB 3IH4A 3WU1B 1YQAA 2M8EA 3KE2A 2BV6A 3DU4A 1GVDA 3V8JA 3S1NJ 2EGYA 1BW0A 2JISA 1VQOI 1ASCA 3CESA 2Y31A 2CV0A 2ISZA 2D64A 1UG0A 1R36A 2XAGA 1HKSA 4BJ6C 1KMJA 4GE9A 4R5FA 4XRFA 3CCLI 1IX7A 4L0YB 4IZZA 1A04A 4R5ZA 4XKBA 4ZAHA 1JTXA 1E5FA 1PG8A 2HXIA 1HW5A 1Z91A 1T2KA 1CQTA 2GWRA 3PD6A 2V9VA 4JP0A 2R0TA 4ZZLA 3A9ZA 5B66C 4YIIA 1PMMA 3A2KA 2BE5F 3PL8A 2WK9A 4UUSA 1GUUA 1MBHA 3DKXA 5EEHA 3JSPA 2W8UA 2MGQA 3AEJC 4E77A 2UZKA 1FYMA 1NHAA 1UU2A 4DNCA 1F4KA 5J1UA 3HRUA 2E2HJ 1M6SA 2COBA 1MDMB 2WAEA 4UVAA 2AO9A 3CF5F 2OV7A 1UELB 1PMOA 5D5SA 3ZN1A 5DM7F 3A8UX 3OYKA 5IY5H 1ZARA 1Y0UA 5IT9K 2E54A 1C9CA 4HX4A 2L9SA 1Q1HA 3C7JA 3DU6A 4CXFA 5JVGF 3E6GA 3SDGA 4GYGA 5EAAA 1UG2A 1ETQA 4YELA 1SVMA 3L2VA 2P6SA 4L9JA 1ZYRF 4IL6C 2ECBA 2XRLA 2KRHA 2VODA 4YEJA 3KETA 5E20A 3VDXA 4LK0F 4OINF 1XEYA 3HHGA 4EV0A 2VLFA 2MA3A 3GMEA 4CGZA 5C3EJ 4IKFA 2H6CA 5EG0B 5TGTA 5E79C 4KT6A 5F9SA 2BKWA 2K40A 2XV4S 3C3WA 4OIRF 3RBFA 1AIAA 3LSMA 4A6EA 5L3FA 2Z9OA 1S08A 3FKDA 3ZZKA 3CCMI 4C3JJ 4HNUA 5G4JA 5IT9Z 1QNTA 3K7AJ 1OYIA 3ULQB 4G94A 3CCQI 3EUKL 1X1DA 1OJLA 1WI3A 1CZEA 1Z67A 4PJ0C 2L0KA 3S3MA 3A9XA 3CZ6A 2QB2A 3ZRGA 2XRNA 1FWZA 5HNHA 4LLLA 4E3RA 4A3EJ 2Z2SB 5FD5A 1RI7A 4C9YA 3DODA 3F8NA 4UHTA 4CCKA 1KQ8A 1UMQA 1XCVA 2K02A 3QBOA 4CDGA 3EUCA 3GW2A 4ESFA 2XVCA 2JWTA 3K1PA 4KMFA 4GSAA 3K1MA 4G7HF 2VMSA 3BWNC 4IHTA 2AY9A 2C81A 2G0EA 3OSFA 4PJLA 3GXOA 5IP6A 1DFOA 3QN6A 4JEYA 1C7NA 2BHXA 3I4JA 1AA7A 2JT1A 1MLYA 1VQMI 1WKMA 4RGRA 3V8KA 4TN4A 4ITXA 4DBRA 4ZYDA 1YRNB 2BVMA 3OYJA 2O8KA 2XKPA 3BP8A 3BZ6A 3MEXA 1VEFA 3RYRA 1MGTA 5F27A 3MZ8A 4F5KA 3PIOF 4NC8A 2L5QA 2X85A 3ONQA 4YRVA 5FT4A 1QHHD 1GBNA 1WH7A 2O61A 3GZNB 2OTLI 4J01A 4G9YA 4KN4X 3RIRA 1V2DA 1W5TA 1WFXA 4N9HA 3KLNA 5G0AA 3FQAA 1AWCA 1RVUA 4RAEA 2VUMJ 2HWVA 4JX4A 4WXHA 1LC8A 1B5PA 3B6AA 3OYFA 4U2HA 3NYUA 2N8GA 1QJ5A 1UJ8A 4EU1A 2F2EA 4UV9A 3CUOA 2HYJA 4B8XA 4IVNA 3RQIA 2PB0A 2CJHA 1BI1A 3CAIA 3MEBA 4EB7A 4A0YA 2WKAA 4R79A 3GWZA 1W7LA 2AS5F 2VMUA 3HTSB 2Z9WA 3PGYA 4L5IA 5EUNA 1CL2A 3RI4A 2UUZA 2UWMA 2DA3A 4B48A 2LF8A 4A12A 2LY2A 1VQ6I 3H9QA 4I01A 1K7AA 5KAFC 3ERED 3GTOJ 4MQRA 1X3ZB 5JHFA 2FNUA 3H3ZA 1W7PD 2AY1A 1H8AC 2V1DA 2JG2A 2XAHA 4M9XA 4XLEA 2CUFA 2JA6J 3G6EI 4IY7A 3BTIA 1S09A 1YX5A 3VYSB 5H6RA 4Y17A 1GC3A 1X2MA 1OCZH 1B9IA 1HOMA 4F5GA 1GT0C 1ETKA 4L5JA 1QZ9A 1LE8B 4LG0B 4R8DA 1FZPB 2R5YA 1QZZA 4MFEA 3JTHA 2K9LA 3LOCA 3ZMUA 4E7HA 1JT0A 2D2WA 4P5OA 4AYBN 1CGPA 3M8JA 5D95A 2AEUA 1TWGJ 1YTYA 3H14A 4JEVA 1X1CA 3AL0B 1MDXA 2NMPA 2EV5A 3OYBA 3JAMK 4FISA 4I6ZA 4ATQA 4HF1A 4NC6A 1LEAA 2RNGA 4PGGA 4KYOA 3KX2A 3R4TA 3FISA 2HQNA 4RB1A 1LC7A 3A0BC 5IOZA 1FOYA 3KP3A 1LVAA 3OR1C 3B73A 1S0AA 2LH9A 4XMYA 4WYEA 4ESJA 5EQCA 2ZCWA 4HSRA 3EYIA 2IT0A 1HW1A 2A3SA 1LW5A 1IRGA 5I92A 1U5TC 1G2HA 5J4YA 2K5CA 3DXWA 4ISYA 1XGMA 3TW6A 1Z7DA 1BL0A 2EPJA 4B3AA 2L7MP 2W25A
chains in the Genus database with same CATH top