4TV7A

Crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
460
structure length
431
Chain Sequence
TITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAALPDDLKEIHIWISFSHMDTDHFPIKSWFRCEQKAASRSYMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEDTRRTEQDILSHAAGLQLEIFGMSRFRPALIIGFARLKEEDIQEGVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Role of the aminotransferase domain in Bacillus subtilis GabR, a pyridoxal 5'-phosphate-dependent transcriptional regulator
pubmed doi rcsb
source organism Bacillus subtilis 168
total genus 132
structure length 431
sequence length 460
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4tv7A01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4tv7A02
4WF2A 3WCNA 3J81Z 3ACZA 3TQXA 3K28A 3K1NA 4AO4A 3ELPA 2O7CA 1JHHA 4AVPA 3D5LA 3U2RA 1S08A 3LVJA 2R2NA 2P4WA 5FT4A 1I5ZA 4EJWA 1QISA 5AX8A 2EFPA 5HLIA 2HUUA 4L5IA 1DP7P 3FF5A 3RDIA 3REOA 4XRFA 2STTA 2JPBA 4Q31A 2UZKA 3PJ0A 2R7DA 1G3TA 1FBSA 1SVVA 3VOMA 5L3DA 2QMAA 1U5TC 1AJRA 3ABUA 2D66A 5C6UA 2ZUKA 2W7MA 3IF2A 4HX4A 1ASEA 1T39A 1YLFA 3AEPA 1LC5A 3VFZA 2QLZA 4OC9A 1U78A 2D7ZA 3ATHA 1FSEA 1ARIA 5G2PA 2R3SA 1LDJA 3LA2A 3MEXA 1X2AA 3HRUA 1U8RA 2V9VA 3RIRA 1PMMA 5TF5A 2UXNA 1CL2A 2TDXA 1XCBA 4RS8A 3E5QA 1E5EA 1Z05A 2CO5A 5KK1A 2FN6A 4PDKA 4J5UA 1KYWA 4IYOA 2XASA 4A0FA 4GO1A 2W7KA 4MKKA 3NTJA 3CQ4A 2WV0A 4R2NA 3NYUA 1ZARA 1UB9A 4LLGF 4BH9A 4QGRA 4WXFA 1I48A 1LW5A 2QVOA 2P6TA 3EI9A 3FD0A 5FT8A 5M49A 1LB2A 1O61A 2Q0OA 3MADA 4OCAA 2W25A 4CXQA 2BI3A 1OYWA 1FYMA 1AAWA 1WWXA 1C0WA 1QGPA 2DGKA 4PVFA 2WK8A 4I8AA 4JE5A 1DGEA 5FD5A 1KU9A 3RYPA 4A0HA 4WWCA 2JJGA 3CLOA 2JJFA 2CYYA 1TOIA 1ODDA 2FBKA 4EM0B 2HP1A 1S29A 4G6DA 3FZ6A 3K9TA 1ZGAA 3MZHA 2G9WA 2YU3A 2VONA 3NRAA 1KYZA 5IT9Z 3EI7A 4WYGA 4BXUA 5E17F 2AY4A 4WD2A 2R5CB 1UFMA 5CLSA 1IXRC 1ZRDA 4HOBA 1DJEA 3I5TA 5DDGA 4OYTA 1BBYA 2QZ8A 4GYGA 1W7LA 2WK9A 3DQVC 3F8FA 1ASMA 3ECHA 2YCNA 2QA3A 5FGMA 4Q47A 4W1VA 3FDBA 1ZHFA 2EV0A 2LSOA 1F4KA 2YPRA 2C7TA 4Y15A 1AX4A 2BBYA 2HUIA 1X3UA 4M9XA 1TARA 2AY9A 2EV5A 4XSXF 2XH1A 3EDPA 3WKSA 2DK8A 3MC6C 4K2IA 5J8QA 1YS7A 2D7YA 2Z9WA 1TBXA 5E1ZB 3GFLA 2GSAA 5TRDA 4KYOA 3ELEA 5L3GA 1G3YA 1U3EM 1S6LA 2OZUA 4TN4A 4ZDOA 3ZN0A 2L3DA 2ZNYA 1FNNA 2M45A 4ATPA 1IF1A 4UOYA 2K7LA 1PDNC 5J8FA 3VODA 1LQ1A 2OKKA 1HBXG 3ZMSA 3KGWA 2W8VA 4MHGA 2J5OA 3ML6A 1OXPA 2HOEA 1HKQA 3E2YA 3BJAA 2VGTA 2MH2A 3E6DA 3FMQA 2O0YA 4U0WA 4B9BA 1Z6TA 3II0A 1XGNA 2VXZA 2XAHA 4A2UA 1AHYA 3KFWX 1KU2A 5BS6A 3ZMUA 2GIVA 3LFKA 2VMVA 3LA7A 4O6JA 4A6UA 1OHVA 4NB5A 2V1XA 4YG2F 1ASFA 1H9TA 4F5JA 1XGMA 3PQJA 1QPMA 1LEAA 3QU3A 2XKPA 5LHGA 2VMUA 2WK7A 1DGDA 2MLKA 1M32A 2HEOA 1M6SA 1O4SA 2E1CA 1DPRA 3RKWA 2ACJA 2G7UA 3K40A 5HS9A 4UVBA 2R5CA 2VGZA 1QNTA 5D5XB 4HDVA 3V4GA 2VOOA 3FFHA 1UKJA 4O6ZA 1ZRFA 1FG3A 2FNAA 3TATA 3E97A 3A2BA 2H94A 1QITA 1J59A 4HQMA 4ZDLA 1MJBA 2YCTA 2MBFA 1R22A 2FQ3A 4ADCA 4HQEA 5E3KA 3TOAA 1E2XA 2M1BA 3PIUA 1TQIA 4CXRA 2WTEA 2QWWA 3FMRA 1OR7A 2BI1A 1AHFA 1OXOA 3KCCA 4N0BA 4ISYA 2AEUA 1CS1A 2DGLA 4XQ2A 3B1DA 5CJ9A 1H0MA 4EM1A 4LNJA 5E1XA 5JAYA 2BYVE 2Z9VA 5HDKA 3PGYA 2V1PA 2YRIA 3NUBA 4P3MA 1C7GA 2A68F 1Z3ZA 2W7HA 3V7SA 5CVJA 1IVRA 2DPDA 1UHMA 4U0YA 4LC3A 2BKWA 3BZ6A 1MGTA 4ADBA 4XAUA 1IAYA 2M5WA 4I0BA 1MDZA 1UU2A 2DR1A 5HVQC 2VLHA 4A72A 4L9TA 3HRTA 2FNPA 4I98B 4KN7X 3QBOA 3QP5A 3HBXA 2FQ6A 3MQ0A 5DCFA 3BOQA 2Z9XA 3I71A 4R8HA 1BJ4A 4XEWA 3MKJA 4F5MA 4M9SA 1OHWA 5DYMA 1QJ3A 2D61A 3DXVA 4AIKA 4JEYA 2KRFA 2W7GA 2MA3A 1ZLJA 2AS5F 3MAJA 2ZKZA 4S05A 4M2MA 1WRJA 4IRIA 2IPQX 3WCOA 3P6KA 3GYHX 5FT5A 4RGXA 3DXJF 4ZASA 2ZMEA 1CQ7A 4GRXA 3EZ1A 3K1PA 3GSBA 1PFFA 3VK2A 2A6EF 3ZRRA 2ESNA 3H3ZA 3T8TA 3PPLA 3CBFA 4RB3C 2LF7A 1BIBA 3V8LA 3HLMA 2FXAA 3DKWA 1ON2A 3GFJA 3RPUA 1FYLA 3WTTC 4FT8A 3F23A 1GEWA 2LKPA 4A6DA 3PDBA 1SFFA 3ZMZA 4LW2A 1SD7A 2OKJA 4DQ6A 3HL2A 2ZSLA 1H1CA 4JQFA 4EMSA 3I4PA 4ZSYA 3AV7A 3FSLA 3FVUA 3M7GA 2O61A 2ZP7A 3GJUA 3H3UA 1UHWA 4KNYA 3WODF 3V7RA 2KJCA 1ZC9A 2HOYA 5JI6A 2PFBA 5LHAA 2EZ2A 1N31A 3ZMDA 2EFQA 1O3QA 4WBTA 4JEZA 3L2CA 4IW7A 1U5TB 1IN5A 3FRKA 1QIRA 1B8GA 2Y75A 4IPAA 2C0RA 1I1SA 3RJPA 2R7FA 1XSDA 4HA8A 3RPQA 2Z9UA 2XBNA 4R8DA 4JF0A 3JTGA 4NHJA 1FC3A 3TFUA 2D64A 1EJIA 2DQLA 3E5XA 5TJJA 3I58A 3ZQ7A 2L54A 4HV6A 4E3QA 4IXOA 4EFFA 3QAHA 2GA1A 1XDUA 2DGMA 2V0YA 1DJ9A 4GE7A 1EG5A 4MTEA 2XROA 2Z33A 1KKJA 1BJOB 4LNMA 1RZ4A 1ASNA 2HFHA 4ADEA 5D5UB 3DP7A 3DPTA 3PDXA 4UVAA 1ELUA 4DNCA 1P6RA 2A6HF 3LG0A 3NNKA 4NOGA 5M4BA 3GBXA 1ZREA 1M4NA 2A3SA 1BIAA 1T0FA 2JT1A 4BHDA 1IZ1A 4WYDA 4PGHA 4ZWVA 2P5LC 3ZMTA 3P9CA 4MQRA 1IXSB 2K4JA 4WX9A 2DBBA 5D6EA 4XJPA 1Z7DA 4TMRA 4WXCA 3ERED 3KLNA 1GHCA 4M2JA 3H7FA 1IRGA 4ENMA 5H6QA 2DO7A 4LLLA 2JJHA 1JE8A 1EV7A 4Q5SF 1SD6A 1IBJA 1V2DA 4HV5A 2ZCWA 4ENJA 4RGRA 3F8BA 3FQ8A 1B9MA 2W24A 4MQQA 3DYDA 1HSJA 3E77A 5A2QZ 4ENKA 2YOBA 1WSUA 2YX7A 4K2BA 1FPQA 1GXPA 5D5VB 3ISLA 3TOBA 4U2HA 2CANA 4WYAA 2QBTA 4EGYA 5DUIA 2QYOA 4BA5A 2DI3A 1P4XA 2PEXA 2P6SA 3M8FA 5D4RA 3WTSC 1YJSA 1M0NA 3R0JA 5JR3A 1IN6A 4ESJA 3WU1B 4UUVA 2K27A 3NQOA 1OKRA 2DFIA 5BMZA 4QWQA 4P9FA 3SHFA 3N97A 3GFIA 2E7UA 4RLGA 2VE8A 2ZBKA 4ENNA 2KJBA 3WKRA 3LVMA 2EWNA 5CYVA 2AY3A 2X3LA 3G3ZA 4ZZDA 2E7JA 3HDOA 1S7OA 2BI5A 1XGOA 1E5FA 4M73A 3GXOA 1U5TA 1MD0A 1HXDA 2JTVA 5E20A 3EI5A 4BMKA 5EAAA 4OOIA 3IHJA 3K2ZA 3DF8A 4Y17A 3IWFA 2F5EA 1KQ8A 3MBBA 1O57A 4A0XA 4P9UA 3J81K 4N9IA 4AZKA 4HF8A 1BKGA 1BI2A 4IYOB 1ZG5A 4PFNA 3KP2A 3KP5A 1DUXC 2VMPA 2NMPA 2F5FA 2OD5A 1KMKA 3M5UA 1AOYA 4KA4A 1Q1HA 3GFMA 3HRMA 4CBSA 4A0GA 1V3FA 3QP6A 2E1NA 1SD5A 2VI8A 3K0LA 3IKTA 2EB7A 5L3BA 1XDSA 5F1RA 1O3TA 4LW4A 1H0CA 1BQAA 4AIHA 3FXRA 1I6XA 3B02A 1KU3A 3SQNA 2Z99A 4I2OA 2VGVA 3DU4A 4LNLA 3B1EA 3LA3A 4CVQA 1OPCA 4G7HF 2CJDA 4OBVA 5E5IA 2QQAA 3KP4A 2O1BA 1M7YA 1LDKB 4ZYEA 4RKDA 2X8UA 2EO5A 1MAPA 3FKDA 4LK0F 1BQDA 2QBYB 1R5HA 2M87A 4E1OA 2AXLA 4RIZA 4KDPA 5CVUA 4WCGA 2JG2A 1FP2A 2A69F 4ZYGA 3F9TA 2VLFA 1W5SA 5IWQA 4MTDA 2XAJA 3E2ZB 1MLZA 1G3WA 4GSAA 1G7WA 1VEFA 2VMNA 4PIWA 2ZXJA 2EFNA 3T5XA 3NUIA 4M74A 3E6BA 3I59B 3NRVA 4RB0A 4UXNA 1ULYA 2STWA 1DDNA 4L18B 4F4EA 3AOWA 5EAVA 3IRRA 3GF2A 2CB1A 4MY5A 1FX7A 3B46A 3DR7A 1KL1A 4I0AA 4Q4ZF 2RGVA 1R1UA 3G0TA 4OBUA 1S7AA 1H9GA 3ECOA 4XK1A 5M4DA 2VMXA 4RGUA 3L00A 1DKAA 2CH1A 2VBYA 4AO9A 4EJOA 5LEJA 3UE8A 2NRAC 2ESHA 1STZA 3DV8A 4PZJA 2FBIA 1VP4A 2D5YA 2VT2A 3MC6A 3GVAA 3EI6A 2W7LA 2R0TA 5IT9K 3AOVA 2JJEA 4OIQF 3AEJC 4UNOA 4A6EA 1LVAA 8AATA 5EUNA 4KIGA 3E6CC 1AHGA 5F64A 2ZYJA 4BYYA 5AIQA 4K2MA 1QJ5A 2ZJGA 3MAFA 2W8JA 1ZGJA 1HW1A 4OT8A 4TV7A 2X5FA 2RNJA 5K8BA 4ZDPA 3KE2A 3S2WA 4W91A 1FLIA 1F1ZA 5K5OA 2HQRA 3R61A 4BA4A 2PLYA 2VC1A 1MZBA 4L9JA 3ZRPA 4R1HA 3RTRA 1R23A 4OMYA 1X0MA 4FHTA 1TASA 3AELA 1SZKA 1ZN2A 1P2FA 4ASNA 1QZYA 1AIAA 5ICGA 2IA1A 1X28A 1G4XA 3FM3A 2V1DA 2YKVA 1G4VA 3QM2A 3AAFA 2CGPA 5AONA 5J8CA 2QBYA 1F9NA 2XHKA 2BWNA 3QRFF 4GCVA 1YOOA 1TTYA 2YSRA 1Z1DA 3HHHA 2J5PA 1R00A 3BPVA 4KN4X 5L3EA 3GETA 2BYJA 2NS0A 5D5WB 1AJSA 3SXYA 2WWYA 4UHNA 1GD9A 3WTWC 3BWNC 3HIFA 3KEQA 4ZYHA 3E2ZA 1XSVA 3P7NA 1V2FA 2JISA 2P7CB 3WTVC 1FOKA 3O2PE 3I0TA 3I59A 3USFA 4EV0A 1W7MA 1DFOA 5ILVA 1TQMA 2CH2A 2RC4A 4YIFA 2PJPA 1AKAA 1HW2A 3RKXA 2NNYA 3TKYA 3GZCA 5E4ZA 3F72A 3ECDA 5BJ3A 2VBXA 2EFOA 4YFKF 2EA2A 2W7FA 1D8JA 1XN7A 4A00A 4ESFA 1TLHB 1SFEA 1FC4A 3LVLB 1BC8C 3A9YA 3R4KA 2FBHA 3ROUA 5JHUA 4IXSA 4G7OF 1O7LA 4KMFA 5FT6A 3QPTA 5DEQA 5CVRA 1EQBA 1ORDA 1SMTA 1MLYA 1YIYA 4Y0IA 2XAQA 5EUDA 1W5TA 3WLXA 4M2KA 4IRGA 5AIPA 4LB5A 1L3LA 1AMRA 2GXBA 3ISPA 5H20A 4UHTA 1ARGA 2LNBA 1TNTA 1FSHA 3L7WA 2YCPA 3TO7A 2VN2A 3H14A 2WC2A 5DCMA 1XD7A 2ELHA 4BHBA 1B59A 5LLQA 2BWOA 2BIAA 3DODA 4A0YA 4EU1A 3R60A 3F0HA 3GZDC 3EETA 2XGXA 1ASDA 5DUKA 5IT3A 1DJUA 1EH8A 4ZM4A 3DFGA 1BI3A 3GZ6A 1R7JA 2D63A 3NYSA 3TCMA 2ZMEB 4WYFA 2C44A 4I02A 1JXSA 2PBIA 2R5EA 4LG0B 1FY7A 1T6SA 2CINA 1MDMB 3VAXA 1GC2A 3C7JA 3BCAA 4BHCA 2EK5A 4WLJA 2K86A 3EQLF 1ZH5A 3E6MA 1N8PA 4BQ0A 3G73A 3BC8A 2A61A 2ZFWA 4YFNF 1ARSA 2RN7A 2ORDA 2GMUA 1S3JA 4M6XA 2QLRA 2Z5UA 4A6RA 4HZFA 3PDBB 1AHXA 4P55A 1S07A 4WB0B 3L8AA 1IN8A 4ZAHA 3W6KB 4EVIA 4ATQA 4GDYA 4Q6RA 1J0RA 4DQ2A 3N4MA 2BEOA 2C6YA 2FE3A 3C1DA 1IRFA 1RNLA 5HS8A 1PP8F 4A5MA 4P96A 5K5RA 2Z1YA 4OMAA 4WYEA 4Y0DA 3FQAA 4IXZA 3EUHA 3LVKA 3HYIA 5DD8A 2VBZA 4LD5A 2O0RA 3RBLA 2D2WA 1BI1A 5F9SA 2Z9OA 3LWFA 1AMQA 3GLXA 3SZTA 1PUEE 3L44A 2YX4A 3TGNA 3I54A 3EUCA 1LKCA 2Y0MA 1S06A 4K2EA 5DV5A 2P5KA 4WXHA 1G3SA 1B5OA 1BJWA 4YFXF 4UV8A 1WKHA 1LK9A 1T98A 5F6FA 1O7FA 5HDMA 1FG7A 1B9IA 1JG8A 4I01A 3HRSA 5L3CA 1WYVB 1ZG3A 2D1HA 3CJNA 4HF2A 4QLCU 3OKSA 1GDEA 3E9KA 4XSZF 2P5VA 4RITA 1WYTB 4UV9A 1U08A 2CJGA 5EIGB 2X5DA 3ELKA 4RJYA 3MAUA 3CUQC 4MQ9F 4RAEA 3GWPA 1ZODA 4UVCA 1GC0A 2HUFA 3MWMA 1WSTA 3JU7A 3KP6A 3FXUA 5E8IA 1RUOA 2CW0F 4EJUA 1AMSA 2CFBA 4L9NA 3VEPA 1KMJA 5G2QA 2FF4A 3J7AO 2CQKA 3M8EA 2PQ8A 4LG0A 1K7AA 1REPC 1BOAA 3CTAA 1MDMA 2XUBA 3KP3A 1LJ9A 4E3RA 4HBLA 1BC7C 2FEZA 4ADDA 3TDUC 3N5MA 3WX9A 2E54A 4CYDA 1ASGA 4BQAA 1D7SA 4HW0A 1ASCA 2P8TA 3VK3A 2RFVA 5E1WA 5HS7A 4RGSA 1KA8A 1B9HA 2HKOA 3I16A 1SAXA 4WB0A 5BPIA 3R4TA 2GZWA 3B73A 4GYIA 1LS3A 3U1DA 1ARHA 3FVXA 2CG4A 2RVCA 3FZ7A 1ZRCA 5EUEA 3BJ6A 2O6GE 2CTZA 2PMHA 4KIBA 2BI2A 2HOZA 2O3FA 3EYIA 5H6RA 4U1TA 4M6YA 3P9KA 3KE3A 4MNUA 3MEBA 5EEHA 1I27A 3QU6A 2IA0A 2WKAA 3EIAA 3E3VA 2GA2A 4DBCA 3UAKA 5CVVA 2QB3A 4CGZA 2VMQA 5FB2A 1J04A 1R5GA 3HHGA 2HWVA 1BS0A 1RV3A 1PMOA 3VB2A 1B5PA 4KT5C 4OINF 3FXQA 1Z9CA 2VMYA 3C18A 3A9ZA 2PO3A 1UCRA 1WYVA 4J8LA 3RKYA 1IAWA 4L5JA 2CFXA 4Q75A 6PAXA 1YAAA 2Q7WA 1KGSA 2BHXA 4IY7A 2LDUA 2VIAA 2VIBA 1V2EA 1WYTA 4ZM3A 2BI9A 4FX4A 1J5YA 1VTNC 5EIGA 4HDUA 3TO9A 2HTJA 3OOPA 4L9VA 1MKMA 2DOUA 3OP7A 5G4JA 3I4JA 3G7QA 2EGYA 1BW0A 4A0ZA 2L02A 4NQWA 3KKIA 4B98A 4A12A 1D8KA 1IUYA 3JAMK 1RV4A 1SPAA 2FNUA 1P92A 1MAQA 5ICFA 1TOKA 3J80Z 3ASAA 1XB4A 4EB7A 5FLXZ 1I41A 3BJOA 1I1GA 5K1YA 1TW2A 1ARTA 1V72A 5DX5A 1TW3A 1IW7F 3P1TA 3QPHA 1YTYA 4EJVA 4B8XA 4FL0A 4RM1A 2W7EA 1AKBA 3FQ7A 3FTBA 5DJ1A 5G09A 3EI8A 2DTRA 4A5NA 1M0OA 3CDHA 3IKVA 2FU4A 2XIGA 2QQBA 3BP8A 4XJLA 2HDCA 4OTLA 4EQQA 1LEBA 2HTSA 1TQPA 2L4MA 1AIBA 2CSOA 4BAYA 1YIZA 3NDNA 1B4AA 2HKXA 3M1EA 1IJIA 4KIFA 5HLGA 4GEBA 2L01A 1CQ8A 1ZLKA 1XEYA 4WXBA 4HAMA 3BDDA 3I53A 4PCQA 2GXGA 2YKUA 2VMRA 3IWZA 4XJOA 2EFWA 3PAAA 4XLNF 2EZ1A 4ZH4F 2VOPA 3GWZA 3Q9VA 4G94A 3WE2A 3JZLA 3MAFB 3E6GA 3AEJA 5FD6A 2DQRA 4G8XA 3ZZJA 3BV0A 3JW9A 3D0SA 1HSTA 1KKPA 4L0ZB 3ZN1A 2GQQA 2O03A 2K4BA 4M71A 1AY5A 4GE9A 3ZRQA 1LC7A 1G7XA 3PQKA 4G9YA 4OIOF 3W1HA 1QZ9A 5LEKA 3COGA 3TFTA 1YQAA 1IX8A 1FYKA 4A6TA 2V6CA 2UWMA 1HW5A 2L4AA 1ON1A 3I64A 1C7OA 1IXCA 5LRRA 1D2FA 1IN4A 3GZ5A 2BYLA 3HOSA 2ZC0A 4N9HA 2VGSA 1JHFA 3G8MA 4UHMA 2PB2A 1AJSB 4WXDA 2V79A 1XMAA 2VMWA 2RDPA 3H92A 2QQ9A 1E17A 2V1UA 1P3WA 1F5TA 2Z20A 3WGGA 2IW5A 3Q8NA 1TATA 3SFZA 3ZPLA 5G4IA 1XMKA 2ZO4A 2OBPA 2PG4A 4HX8A 4YIIA 3RYRA 3BWNA 1UU1A 3WG9A 3EZSA 2VMTA 2VMSA 4HF0A 3PFIA 1AY4A 5BOXA 2X4HA 4U0VA 4H51A 1W7PD 2EPJA 2W7JA 1AAMA 4ZLVA 5FFZA 3AATA 3BB8A 1LNWA 1TOGA 2W7IA 4UQVA 3PD6B 1C0NA 2EH6A 3VOEA 3F8MA 2CSTA 4EMYA 2QENA 1K6OA 2OZ6A 2W8UA 2QB2A 1JF9A 2D1VA 1BN5A 1CZCA 2X0LA 2FMYA 1R58A 3NYTA 3IL2A 4AIJA 1ASBA 2PB0A 4PFFA 4ZSWA 9AATA 2YKYA 2OGAA 2FMLA 2BWPA 4Q76A 2NAZA 4WK8F 2W84A 2H27A 3BWOA 1J2XA 1D3YA 1YJZA 2DT5A 5EFSA 4IVNA 3W6JB 4ESBA 1G4DA 4CICA 1YJYA 1GBNA 1VJOA 4KXKA 1I29A 3U9GA 4RB1A 1LC8A 4ITGA 1J75A 5FO5A 2B0LA 2W8TA 4OU0A 1AY8A 2VC0A 1QO0D 3LQQA 5DJ9A 4MSOA 5G0AA 2Q2EA 4GGGA 5DCMB 4GE4A 3CO7C 4F5FA 4O5VA 3F6VA 1CGPA 2XRNA 5KVRA 1KL2A 4HVKA 4JF1A 3BS8A 1QQIA 3BPXA 5HLHA 1AMAA 2MD5A 1WYUB 1YW7A 1FBUA 2AEVA 4B09A 2HQNA 3V8KA 1J9IA 5DD4A 2ZSMA 1YNUA 3CUOA 3CUQB 3GZDA 2MH9A 4AD9A 3UWCA 5F8VA 1X29A 2ISZA 3FMSA 5LGTA 1CQ6A 4AWXB 3KEOA 3HMUA 5ICCA 2DKJA 1MGVA 1W7NA 2GAUA 2XAGA 3P9IA 4F5KA 1UU0A 3AEMA 1MDOA 7AATA 4ITXA 4ZZLA 3LSTA 1Z91A 3L09A 1NHAA 2XAFA 3E5UA 4CBRA 3R0AA 3BCBA 1SMYF 1M0QA 3F6OA 4AZJA 3KETA 2PMUA 1JS3A 3A9XA 2G7HA 3CO6C 1GC3A 1G6NA 2AY8A 2KKOA 3JSPA 2F5CA 2CJHA 4M72A 1O3RA 3BWGA 1ZOBA 3PA9A 3RUYA 2Q8KA 2M30A 3V8JA 1FT9A 3TQNA 5BJ4A 5E18F 3CQ6A 3PD6A 3M9AA 1C7NA 3NEUA 3HOTA 4E70A 4D0PA 4G6QA 3BROA 2E7XA 1SFUA 1U2WA 3HTUA 4N0WA 1USTA 4F5HA 4JK1X 3HVYA 1D5VA 1ZAOA 2HZTA 3GX4X 4P7YA 1D7VA 4RKCA 4IJAA 1HKTA 3FCRA 3ABTA 1JS6A 3A8UX 4HX7A 3GR9A 3DEUA 5LGUA 3RQ1A 3GO5A 2FYFA 1AICA 3WZFA 3NU7A 4MQVA 5D6FA 2F8JA 4LLNA 1BJAA 2VODA 3WU0A 5HDGA 4JEVA 2HR3A 3WGIA 1AHEA 4E77A 1YS6A 2AATA 5HOOA 3KP7A 2IVMA 1SZUA 1WYUA 2VBWA 2CWEA 4O3MA 4FFCA 2F5DA 3T8RA 4CDGA 4HF1A 4RAZA 1P4AA 3FVSA 1LW4A 2DK5A 2EA4A 3ZZKA 2RKHA 1P4WA 1W7PB 3CUQA 3DPLC 4LGWA 2DU9A 2OQXA 5D5SA 4XBFA 3AEMC 3ASBA 3ULQB 1YW8A 4AH3A 2Z67A 3GEZA 2M8EA 5LRSA 2COMA 2JRTA 1KQ0A 5JFRA 3SZPA 1CL1A 3QPGA 1T2KA 4W1XA 1GC4A 1HQCA 1GEXA 5LGNA 3WE3A 1D7RA 3LAPA 2HP2A 2Z1ZA 3QI6A 2HOXA 3QOPA 1ZG1A 4KFCA 2KIMA 2JZYA 1BI0A 5BPDA 2ISYA 1OHYA 2JPCA 2DW4A 4R5FA 3AEOA 2IT0A 4FX0A 5EQCA 3K1MA 3Q9SA 4CZZA 3FZ8A 1IN7A 3FWEA 4IHTA 2MC3A 1RUNA 3DZZA 1SF2A 1XGSA 1C4KA 1AKCA 3K7YA 4BNCA 3KZZA 3F8CA 4CHUA 2IA2A 1XI9A 3KGXA 3DXWA 3NU8A 2DAOA 1IX6A 3FX3A 1JGSA 3DR4A 3WGHA 4ZWMA 4KICA 4JBAA 2PN6A 1SFXA 1BT4A 4EJTA 3Q5FA 2KIUA 3IRQA 3HT4A 3FZVA 2A07F 1KQ9A 2IRFG 4Y13A 2IP2A 2VYCA 4OMZA 3MCZA 1ZYRF 1J7KA 4F5GA 2HZPA 4ON0A 3JW4A 5HHYA 1WQ2A 3C3WA 4F5LA 3ZMVA 5HXXA 5ILUA 3R9AA 3LV2A 1QBJA 1QZZA 3VK4A 3LAJA 4Z2YA 4KUMA 2FSWA 3HSFA 3KLOA 4OIPF 1AWCA 4LMYA 4MKJA 3JWAA 3AENB 4G7ZF 2EV6A 3RCHB 3O6BB 4RJ0A 4OIRF 1C9CA 3DC1A 3WGCA 1K78B 2AY6A 4R5ZA 3LWSA 3VP6A 4KMUX 5D4SA 1S8NA 2YKXA 3F22A 2E7IA 1T3IA 1Y4IA 5CVIA 2D45A 3FFRA 1GVJA 1K79A 1W7PA 5K5QA 3IHUA 1CJ0A 2JGTA 5M46A 2IJLA 1BM9A 2VI9A 3W1JA 2NYXA 1IUGA 2E7WA 2QUFA 4F7ZA 1GCKA 3MFKA 3EYYA 2GQNA 1TNSA 4U88A 2XKOA 2DKBA 1FZPB 3K69A 2FA5A 1EH7A 3B1CA 2OA4A 1IAXA 1B4XA 2GWRA 1FBQA 1QGNA 1R1VA 3RI6A 2GB3A 1S0AA 3QN6A 1T38A 4W5KA 1L0OC 4Q48A 4L0OA 1B9NA 3QGUA 2BV6A 4JE5D 2VGUA 3WTXC 4H0EA 2AY2A 1WKMA 2JSCA 4IRHA 4CO8A 2W8WA 3N0LA 2K02A 4U7BA 1RI7A 1S09A 2AY5A 3QHXA 2DLLA 2HYFA 3F21A 1YW9A 1ELQA 1M0PA 2OQRA 5ICEA 1ASLA 1GEYA 1RVUA 3I5UA 5ERIA 2PI0A 3W1IA 2AY1A 3O3KA 1ASAA 1YFHA 1DTYA 4A0RA 3EIBA 4LK1F 5I92A 1GXQA 5A2QK 3J80K 3L9FA 1OATA 4S04A 5FLXK 2OAZA 3HUGA 5E8GA 2TPLA 5D8LB 3COAC 2O8XA 2ADUA 4WP0A 2KIFA 2MLGA 4JEWA 3WTZA 1KU7A 2QM3A 2FRHA 5LHIA 1ONVA 1WKGA 5ED4A 3CQ5A 2ZNZA 4IX8A 2ZJ2A 3LY1A 4I7HA 3MZYA 1PG8A 3KZYA 1PP7U 2OGEA 4WXGA 4WYCA 4HYEA 2ETHA 3WGBA 2BGCA 1YG2A 2D65A 1O69A 3BY6A 3AENA 3JTHA 2HYGD 4M9ZA 3CAIA 3RCHA 2NNNA 3F8NA 1Z6RA 2FOKA 1B1BA 5D95A 4F5IA 4LB6B 1K78A 3B8XA 2VMOA 4U7DA 4AOAA 5LBQA 4WLHA 1CF7B 3LQRA 3FHZA 2RQPA 2W85A 2H6BA 1IX7A 2DPUA 1TPLA 2H09A 1I43A 5ILSA 2Z3YA 3JTXA 3JWBA 3HTSB 2XVCA 3T1BA 2AY7A 4RB2C 1W4MA 3DRDA 1BJNA 3HQTA 4LJZF 2FNIA 1D7UA 2VGWA 1Y0UA 1J32A 3BN1A 2XV4S 1O62A 1FWZA 3GW2A 3TO6A 1O3SA 3R6SA 4W8IA 5EEGA 1DPUA 2VE9A 4MEXF 1RIOH 4HLYA 5LH9A 4GXOA 3T0YA 1FP1D 2OQGA 2VT3A 1WI9A 4ZYDA 1EH6A 1Z7UA 3WTYC 4IF4A 3HSRA 1MJAA 3T32A 2BIGA 1N2TA 1HKSA 3OV8A 1A04A 2RV8A 4I09A 4BHPA 1MDXA 5LHHA 4EGZA 1SD4A 2FM1A 4JEXA 3HSEA 2YR2A 4LFUA 2BE5F 2Y48A 4PGGA 5DB5A 4CXFA 4ETSA 1W23A 5L3FA 1TOEA 1YO5C 1R1TA 5FFXA 4P5OA 3TDZC 1OYIA 4MGRA 1OYYA 2F2EA 3NX3A 3V7CA 4EB5A 2G6WA 2OU2A 2UXXA 4IHSA 2LF8A 1U6GA 5JVTA 3ZP5A 2EJRA 3GUDA 1V4RA 1W3UA 4XJMA 4MQPA 4DGTA 3JAMZ 2VMZA 2Z61A 2A5YB 1CZEA 2HS5A 2YRRA 4RAYA 2C81A 5HDNA 4KYWA 4EM2A 2CY8A 1RVYA 1USSA 4R79A 1YYVA 3N75A 2OATA 2W57A 1R36A 3JSOA 1BJOA 1YIOA 4KAMA 3WY7A 1XSXA 1TOJA 2YHKA 4W1WA 4UHOA 3RI4A 1ECXA 3FM5A 2P7VB 3IC7A 1OMIA 3WTUC 1CF7A 3F6TA 4IXAA 3E2FA 3RBFA 2HGCA 2HORA 4Y0HA 2GMSA 3BCXA 5BQTA 4XLPF 1SZSA 2H6CA 1XCVA 3F3XA 1LDDA 2BIEA 5J6XA 2W7DA 1MJ9A 4HLXA 4MEYF 3D6KA 1B6AA 5D8KB 4L0YB
chains in the Genus database with same CATH superfamily
1OJLA 4WF2A 1PUFB 4J01A 3KIOA 1QHGA 3J81Z 1RR7A 3WCNA 3ACZA 3TQXA 2H8RA 3K28A 3K1NA 4IOAF 3ELPA 4AO4A 3K2AA 4AIDA 3PNVA 1Y8QB 2O7CA 1JHHA 3HKZN 4AVPA 5IYDJ 1EA3A 2EIKH 3D5LA 3U2RA 1S08A 3LVJA 2R2NA 2P4WA 2RAEA 5FT4A 4MO7A 1I5ZA 2XSJC 4EJWA 1QISA 5AX8A 1BOBA 2EFPA 2MW8A 5HLIA 2HUUA 4L5IA 1DP7P 2V9PA 3FF5A 2JA2A 2IGNA 3RDIA 3REOA 4XRFA 2KL4A 2STTA 2A5WA 3HPGA 5C4XJ 4E6KG 5IOYA 2JPBA 2WADA 4Q31A 5B1AH 2UZKA 3PJ0A 2R7DA 3OYDA 4XRSG 2CV2A 1G3TA 1FBSA 1SVVA 2DODA 3VOMA 1UJ8A 5L3DA 2LD5A 1JT6A 2QMAA 3TW6A 1U5TC 1X4OA 1AJRA 3ABUA 2D66A 5C6UA 1WJAA 2ZUKA 3G1MA 2W7MA 3IF2A 4HX4A 2CQQA 5J3LA 1T39A 1YLFA 1ZQ3P 1ASEA 2FD5A 1RUOA 3AEPA 2E5NA 3SDBA 2R4GA 2QLZA 3VFZA 5EJCA 1LC5A 1U78A 4OC9A 2D7ZA 3ATHA 1FSEA 1ARIA 5G2PA 2R3SA 2X51A 2R7UA 5GTIC 1LDJA 3LA2A 2CUZA 3MEXA 1YRNB 1X2AA 3HRUA 1U8RA 1PYVA 2V9VA 2VJ5A 3RIRA 1PMMA 4BXFA 5TF5A 1ETOA 2UXNA 2YUSA 2Y0SN 3TBIA 3HOZJ 2TDXA 1XCBA 4RS8A 3E5QA 1CL2A 1E5EA 1BW6A 1Z05A 2CO5A 5KK1A 3OIPA 2FN6A 3AG4H 4PDKA 1W36C 4J5UA 1KYWA 4IYOA 2XASA 4A0FA 4GO1A 1T08B 2W7KA 4MKKA 3CMYA 3NTJA 1T56A 3CQ4A 2WV0A 4R2NA 2AQFA 2EIMH 3NYUA 1ZARA 1UB9A 4LLGF 4BH9A 1MBGA 4RBOA 4QGRA 4WXFA 5FLMJ 1I48A 1LW5A 2QVOA 1MW7A 4NUBA 2P0WA 2P6TA 3EI9A 3FD0A 5FT8A 5M49A 1LB2A 1O61A 2Q0OA 1TWHJ 4XLEA 3MADA 4OCAA 4AU7A 2W25A 4CXQA 2BI3A 5F04A 1OYWA 1FYMA 4CCMA 2R92J 4M6VA 1WWXA 1C0WA 1QGPA 3DTKA 3MD2A 1AAWA 2DGKA 4PVFA 2WB1A 2WK8A 4I8AA 4JE5A 1DGEA 3FXLA 4DJAA 5FD5A 1KU9A 4F92B 3RYPA 3FBNB 3CMEI 4A0HA 4WWCA 3CCSI 2JJGA 3CLOA 3LSHA 3CCUI 2BW3A 4IHXA 4XOTA 2JJFA 2CYYA 1TOIA 3BG6A 1AKHB 2Z1DA 1ODDA 2FBKA 4EM0B 1GUUA 1S29A 4G6DA 3HC7A 3QPLA 3K9TA 3OYHA 3PL8A 1ZGAA 2OF7A 3PM1A 2G9WA 3MZHA 2YU3A 3OYAA 2VONA 1KYZA 3NRAA 5IT9Z 2YS9A 3EI7A 4WYGA 4BXUA 2MG4A 1N25A 1GLNA 5E17F 2AY4A 2X6XA 4WD2A 1Z3YA 2R5CB 2P81A 1UFMA 5CLSA 1DU0A 1IXRC 2JVGA 1ZRDA 4HOBA 1MSFC 1DJEA 3I5TA 5DDGA 2NVYJ 2HI3A 4OYTA 1BBYA 2QZ8A 4GYGA 1W7LA 3FKJA 2WK9A 3DQVC 3F8FA 1ASMA 3ECHA 2RREA 4A3KJ 3AFHA 2QA3A 2YCNA 1Y0NA 2G0EA 5FGMA 4Q47A 4W1VA 3FDBA 1ZHFA 2EV0A 2LSOA 2XF7A 5M5WJ 3OS0A 1F4KA 4LITA 2YPRA 2C7TA 2PX9A 4Y15A 1AX4A 2BBYA 2HUIA 3DEWA 3ZQGA 1XPXA 1X3UA 4M9XA 1UG0A 1HOMA 1TARA 4HG2A 2K9QA 2AY9A 2EV5A 4XSXF 1A35A 4IHYA 1UELB 5JVGF 2VL8A 2XH1A 3EDPA 4Q75A 3PJRA 3M3YJ 1ZK8A 4HEA2 3WKSA 1FTTA 2DK8A 3MC6C 2K9NA 4DYCA 4K2IA 2L9RA 5J8QA 1YS7A 2D7YA 2Z9WA 3WHCA 3CJQB 1MH4A 1G8XA 1TBXA 5E1ZB 3I4NJ 3GFLA 2LBFB 1W1WE 4HPQA 2GSAA 5TRDA 4KYOA 3ELEA 5L3GA 1G3YA 1U3EM 1YRNA 1S6LA 2OZUA 4TN4A 2O7OA 4ZDOA 3ZN0A 2L3DA 2ZNYA 1FNNA 2CV0A 2DMNA 2M45A 4ATPA 4PJLA 1IF1A 4UOYA 2K7LA 1PDNC 5J8FA 1XG1A 2DYRH 3VODA 1LQ1A 2OKKA 2KPMA 1HBXG 1LFUP 3ZMSA 3KGWA 1J09A 3LSPA 2W8VA 4MHGA 4D7MA 2J5OA 2EZIA 2NXNB 3ML6A 3GTQJ 3BR6A 2F48A 5K7HA 1OXPA 2HOEA 1HKQA 3E2YA 2HOAA 3BJAA 2CRGA 2V4JC 3GTPJ 2VGTA 1IV8A 2MH2A 3E6DA 4RMNA 3FMQA 2O0YA 3LSKA 2VXDA 4U0WA 4B9BA 1Z6TA 3II0A 1XGNA 3FHNA 2VXZA 2XAHA 4A2UA 1AHYA 1MNDA 3KFWX 1KU2A 2VLAA 4DYQA 2HXOA 3BG9A 5BNGA 3ZMUA 5BS6A 3S3NA 2GIVA 3LFKA 2VMVA 3LA7A 4O6JA 4A6UA 1OHVA 4NB5A 2V1XA 4YG2F 1ASFA 1H9TA 4F5JA 1W36D 3BR0A 2R5ZB 1XGMA 2DCEA 1Z3XA 1MBJA 1QPMA 1XTAA 3PQJA 3J7AY 1LEAA 3QU3A 2XKPA 5LHGA 1VQ8I 2VMUA 2WK7A 1AKHA 4F52A 1DGDA 3ESWB 2MLKA 3DBRB 1KONA 3CCJI 1M32A 1YOVB 4D5FA 2HEOA 1M6SA 3VWBA 1O4SA 3ZCOA 2E1CA 1DPRA 2WY7Q 3I3LA 3RKWA 4DZPA 2ACJA 1OCTC 2G7UA 2WB1N 3K40A 2E1MB 2R0QC 5HS9A 4UVBA 5J40A 2R5CA 2VGZA 1QNTA 3PSFA 3LFUA 5D5XB 4HDVA 3V4GA 2VOOA 3FFHA 1UKJA 4O6ZA 3OWTA 2MYSA 2F4OB 1ZRFA 1FG3A 2FNAA 3TATA 3E97A 3A2BA 1D1BA 2LREA 2H94A 1QITA 1J59A 4BXXJ 1G59A 4HQMA 4ZDLA 1MJBA 2F4IA 1HLVA 2MBFA 2YCTA 1R22A 2FQ3A 4ADCA 1WH7A 3N05A 2M1BA 1E2XA 3TOAA 3H9QA 4HQEA 3PIUA 5E3KA 1TQIA 4CXRA 3HOUJ 2WTEA 2VI6A 2QSFX 2QWWA 3FMRA 1OR7A 3PIPF 4HSTA 1JT0A 2BI1A 1AHFA 4XICA 3L2QA 1OXOA 4UY8I 3KCCA 4N0BA 3FBIB 3NARA 4IX7A 2AEUA 4ISYA 4AM3A 1CS1A 2DGLA 3HM5A 5DM7F 2BY1A 4XQ2A 3B1DA 3OIOA 5CJ9A 1H0MA 2BY0A 4EM1A 4LNJA 5E1XA 5JAYA 2BYVE 4FE4A 2BHYA 3MKLA 2HVRA 2Z9VA 5HDKA 3PGYA 2V1PA 2YRIA 3NUBA 4P3MA 3OOUA 1GV5A 1C7GA 2A68F 2DT6A 4N4OB 1Z3ZA 2W7HA 3V7SA 4XN3A 3TEDA 5CVJA 4PFPA 1IVRA 2DPDA 5C44J 1UHMA 5B3SH 3HEFA 4X1EA 4U0YA 3CMAI 4LC3A 2BKWA 3BZ6A 1MGTA 3OYCA 4ADBA 4XAUA 4Y4RA 2LVSA 3SYTA 5M3MJ 1IAYA 2M5WA 4I0BA 1MDZA 1UU2A 2LY9A 3G1OA 4EEFG 3S93A 3ZQHA 5HVQC 2DR1A 4L9TA 3HRTA 2FNPA 2DA4A 4I98B 4KN7X 3QBOA 3QP5A 3HBXA 2NS8A 2FQ6A 3MQ0A 5DCFA 3BOQA 2Z9XA 3I71A 1DU6A 5E3LA 4F93B 5HNHA 3CP2A 4R8HA 1BJ4A 2WAEA 3MKJA 4XEWA 4F5MA 3OR1C 4M9SA 3JRIA 1OHWA 5DYMA 1QJ3A 1VQNI 2D61A 4AIKA 3DXVA 4JEYA 2KRFA 2W7GA 2MA3A 1ZLJA 3H0DA 1I50J 2DTZA 3K10A 2JA7J 2VQHA 4OAYA 2AS5F 3MAJA 3VYUB 2ZKZA 2VIXA 4FISA 3GMEA 2EH3A 4D7NA 4S05A 4M2MA 3O8GA 1WRJA 4IRIA 2IPQX 2X6WA 2R7RA 3P6KA 3WCOA 3GYHX 5FT5A 2DA6A 4MFEA 4RGXA 3LMMA 2DDAA 2JSPA 3DXJF 3W2AA 4ZASA 2ZMEA 1XMXA 1CQ7A 4GRXA 2R5ZA 4NC7A 3IAM2 3K1PA 1PFFA 3EZ1A 3GSBA 3O8HA 2R7SA 3VK2A 5EF6A 2A6EF 3ZQFA 3HOYJ 3ZRRA 4LIVA 4J00A 1ORKA 2ESNA 3H3ZA 1JKQC 3T8TA 4BE1A 3PPLA 3CBFA 4RB3C 2LF7A 1BIBA 3V8LA 1POGA 2H8WA 3HLMA 3UR3C 2FXAA 1WJBA 3DKWA 4XRSA 3Q0VA 1ON2A 1JKPC 4YELA 1R6RA 3GFJA 3RPUA 3WTTC 1FYLA 4FT8A 3F23A 1GEWA 2LKPA 4A6DA 4XONA 1SFFA 3PDBA 3ZMZA 4LW2A 1SD7A 2OKJA 2KZGA 2W4SA 5H2FC 3HL2A 4DQ6A 2ZSLA 1H1CA 4JQFA 4EMSA 4BS9A 3I4PA 4ZSYA 3AV7A 1HA8A 3FSLA 3K4BA 3FVUA 3M7GA 2O61A 2ZP7A 3EUHC 3GJUA 2CQXA 2DN0A 4NC8A 3H3UA 1OR7C 1UHWA 5F27A 4KNYA 3WODF 3V7RA 2KJCA 2ZB9A 3L2RA 1ZC9A 2HOYA 3ZXSA 2XGCA 5JI6A 3CJTB 1W5CC 1K6YA 2HXIA 2PFBA 5LHAA 2EZ2A 1N31A 3ZMDA 1X3WB 2EFQA 1O3QA 4HSRA 4WBTA 4JEZA 3L2CA 3JRBA 4CCOA 1U5TB 3ZQCA 1K61A 4IW7A 1IN5A 3FRKA 3BZCA 1QIRA 3CZ6A 4PSXA 2Y75A 4II2A 4IPAA 1B8GA 2AQEA 2C0RA 4BEHB 1I1SA 3RJPA 2R7FA 1XSDA 2L9NA 4XK4A 4HA8A 4GRIA 1SVOA 3RPQA 2NVUB 2Z9UA 2XBNA 4R8DA 4JF0A 3JTGA 4NHJA 5FKNA 1FC3A 4XLHA 3TFUA 3CF5F 2D64A 1EJIA 2DQLA 3E5XA 5TJJA 3I58A 3ZQ7A 2L54A 1WPKA 1A36A 4HV6A 4E3QA 3BQZA 4IXOA 4EFFA 3HGYA 3QAHA 2GA1A 1XDUA 2DGMA 2V0YA 1JTYA 1DJ9A 1T33A 1ZR4A 1EG5A 3PFYA 4GE7A 4MTEA 1X4PA 2XROA 2Z33A 2NS7A 1KKJA 1BJOB 3A1YA 4LNMA 1RZ4A 3DKYA 1VF9A 2HFHA 2CUEA 4BDYA 1ASNA 5D5UB 4ADEA 3TP3A 3DP7A 3DPTA 3PDXA 4UVAA 1ELUA 4DNCA 1P6RA 2A6HF 3LG0A 3NNKA 4NOGA 5M4BA 3ZGKA 2L5QA 3GBXA 1ZREA 5K7FA 1M4NA 2A3SA 1BIAA 1T0FA 2MABA 2MD0A 4A3DJ 2JT1A 4CZCA 4BHDA 1IZ1A 1MBFA 4WYDA 2LLKA 4PGHA 4ZWVA 3ZMTA 3P9CA 2P5LC 4MQRA 3IH2A 1IXSB 2K4JA 4WX9A 2DBBA 3OMYA 5D6EA 4XJPA 3HKZA 1Z7DA 4FCYA 5DTDA 4TMRA 2X85A 4WXCA 1MMAA 3ERED 3KLNA 1GHCA 1H88C 4M2JA 3H7FA 1IRGA 4ENMA 5H6QA 2DO7A 2ZMEC 4LLLA 3OY9A 1O4XA 4EATA 2JJHA 1JE8A 1EV7A 4Q5SF 1SD6A 4V19K 1IBJA 1V2DA 4HV5A 4XLAA 1RRJA 2ZCWA 4ENJA 4BJ5C 4RGRA 3F8BA 1VNDA 3FQ8A 4BQOA 1B9MA 3MKYB 3AKZA 2W24A 4MQQA 3DYDA 1HSJA 3E77A 5A2QZ 1XS9A 3JRFA 1P9QC 4ENKA 2YOBA 1WSUA 2YX7A 4E7KA 1FPQA 1GXPA 5D5VB 3ISLA 4K2BA 1R9TJ 4XN0A 3TOBA 3FDYA 2CANA 4U2HA 4WYAA 2QBTA 4CCLA 1VQ9I 2ELJA 4EGYA 4E7SA 3BTIA 2IBDA 2IAIA 5DUIA 2QYOA 2NVXJ 2DMQA 4BA5A 2DI3A 1P4XA 2JN6A 2P6SA 2PEXA 5CQEA 3M8FA 5D4RA 3L2VA 3WTSC 2HQAA 2XDVA 1YJSA 1M0NA 3R0JA 5JR3A 1IN6A 2EPFA 3JREA 4ESJA 3WU1B 4UUVA 3PNTA 4IQJA 2K27A 4J19A 3NQOA 1OKRA 4HRIA 2DFIA 5BMZA 3K70D 4QWQA 4P9FA 3SHFA 3N97A 3GFIA 2E7UA 4RLGA 2VE8A 4ZTJA 3UNGC 1R4NB 2K5CA 2ZBKA 4ENNA 2KJBA 3WKRA 2MFZA 3LVMA 2EWNA 5CYVA 2AY3A 2X3LA 5IYCJ 3K4KA 2LP0A 3G3ZA 4ZZDA 3M8JA 2E7JA 4G6TB 3HDOA 1S7OA 2BI5A 1XGOA 1E5FA 4M73A 3GXOA 2YU9J 4BJ6C 5E3NA 1U5TA 1MD0A 1HXDA 2JTVA 5E20A 4Y52J 3EI5A 5EAAA 4BMKA 4OOIA 3IHJA 1QZEA 3K2ZA 3DF8A 4Y17A 3CC4I 2DMPA 3D5SC 3IWFA 1V5GA 2W1OA 2F5EA 4XRMA 3CCRI 1KQ8A 3MBBA 1O57A 4A0XA 4BEHA 4P9UA 3JRHA 3B6CA 5B66C 4N9IA 3J81K 3ONQA 4N4NB 4HF8A 4AZKA 1BKGA 5E3MA 3ZR8X 4S0HB 1MMSA 1BI2A 2K85A 4IYOB 1E0EA 1ZG5A 3DCFA 4XNFA 4PFNA 2KZVA 3KP2A 3KP5A 2M7AA 5IP7J 1DUXC 2JK3A 3C2HA 1I3QJ 2VMPA 2NMPA 2F5FA 2OD5A 1RC9A 1KMKA 3M5UA 1T0FC 1X1DA 1AOYA 4KA4A 4L0OA 1Q1HA 3GFMA 3HRMA 4CBSA 4A0GA 1V3FA 3QP6A 2E1NA 1SD5A 2VI8A 3K0LA 3IKTA 1GVDA 2EB7A 5L3BA 1IC8A 1XDSA 4C30A 5F1RA 1O3TA 4LW4A 2JVHA 1IRXA 1H0CA 2DJIA 4AIHA 1BQAA 3FXRA 2LTPA 1JKRC 3WHBA 1I6XA 3B02A 1KU3A 3SQNA 2Z99A 4I2OA 2VGVA 3DU4A 2VPLA 3B1EA 3LA3A 4LNLA 4CVQA 2OJED 1OPCA 4G7HF 2CJDA 2WAFA 4OBVA 5E5IA 3CC7I 2QQAA 3KP4A 2O1BA 1M7YA 1LDKB 3H9JA 4ZYEA 4RKDA 5EYRA 3CCVI 2EO5A 1MAPA 2X8UA 3FKDA 4JYKA 4LK0F 1BQDA 2QBYB 4ZJZA 4E7JA 1R5HA 1X1BA 2M87A 4E1OA 2AXLA 2M0CA 4KDPA 4RIZA 4UB8C 5CVUA 4WCGA 2PJRB 2JG2A 5KAFC 1FP2A 3H5AA 2A69F 4ZYGA 2B9SA 3F9TA 3MKWB 2VLFA 1W5SA 2VJ4A 2IGMA 5IWQA 4MTDA 4QSHA 3S17J 5HNFA 2XAJA 1YJWI 2VKEA 3E2ZB 1MLZA 1G3WA 4GSAA 2W7NA 1G7WA 1VEFA 2VMNA 4PIWA 2ZXJA 4QTRA 2EFNA 3T5XA 3NUIA 4M74A 3E6BA 3I59B 3NRVA 4RB0A 4UXNA 4F55A 1ULYA 2STWA 4M3GA 3V42A 1DDNA 4L18B 4PFOA 2Y31A 3CC2I 3AOWA 4F4EA 1IRZA 5EAVA 1I6HJ 1ITYA 3IRRA 2QQ8A 3MVPA 3GF2A 2Y9YA 2CB1A 4MY5A 1FX7A 3B46A 3DR7A 1KL1A 4KISA 4I0AA 4Q4ZF 2RGVA 4C2TA 2CFBA 1R1UA 3G0TA 4BY1J 2HQ5A 2L7FP 1S7AA 4OBUA 1H9GA 5EZHA 2LY2A 3ECOA 1QPIA 4XK1A 5M4DA 2VMXA 1ETKA 4RGUA 4UB6C 2DJNA 3L00A 1DKAA 4YEJA 2CH1A 2VBYA 4AO9A 4EJOA 5LEJA 4B3XA 4RDUA 3SJMA 3UE8A 3RPUD 3RQ4A 4IO9F 2NRAC 2CUJA 3X2QH 3PO2J 2ESHA 1STZA 3DV8A 4PZJA 2FBIA 1VP4A 2D5YA 4BBSJ 2VT2A 3MC6A 4C2UA 3GVAA 2F6CA 3MN2A 5GAGJ 3EI6A 2W7LA 2M3AA 3ASOH 2R0TA 5IT9K 3AOVA 1WJ5A 2JJEA 2R7XA 4OIQF 3AEJC 4UNOA 4A6EA 1LVAA 8AATA 5EUNA 4KIGA 3E6CC 1AHGA 2ECBA 5F64A 1TP4A 2ZYJA 4BYYA 5AIQA 4K2MA 1QJ5A 2ZJGA 3MAFA 2W8JA 1ZGJA 4JX6A 5LFAA 1HW1A 4HNVA 4OT8A 4TV7A 2X5FA 1WJEA 2RNJA 2EILH 1OISA 5K8BA 2E35A 2LH9A 4JX4A 4ZDPA 3KE2A 3S2WA 4JP0A 1QU3A 1F1ZA 1FLIA 3Q0UA 5KAIC 5K5OA 3JR9A 2HQRA 1OQYA 2VPRA 3R61A 1A5JA 2PLYA 3ABMH 4BA4A 2VC1A 2KRHA 1MZBA 4L9JA 4Y7NJ 1X1CA 3ZRPA 4R1HA 2NVTJ 3RTRA 2HVQA 1R23A 4IZZA 4OMYA 1X0MA 4FHTA 1B8IB 1TASA 3AELA 1SZKA 1MH3A 1ZN2A 1YIJI 1P2FA 4ASNA 4CUGA 1QZYA 1AIAA 2IS6A 4XLFA 5ICGA 2IA1A 2BY3A 1X2MA 1X28A 4XKCA 1G4XA 3BR1A 3FM3A 2V1DA 2VLHA 2YKVA 1G4VA 1WI3A 3FXMA 3AAFA 2CGPA 3QM2A 5AONA 5J8CA 4NC6A 1CQTA 3C2GA 2QBYA 1F9NA 2ME6A 2XHKA 2BWNA 3LSMA 3QRFF 4GCVA 4B47A 3BTCA 2R7VA 1YOOA 1TTYA 2YSRA 1Z1DA 3HHHA 2J5PA 1R00A 3BPVA 4KN4X 5L3EA 1UZCA 1K4TA 3GETA 2BYJA 3A03A 3DWLE 2NS0A 1ENHA 5D5WB 1AJSA 3SXYA 2WWYA 4UHNA 1V54H 1GD9A 3WTWC 4BU2A 3BWNC 1I3AA 4A3IJ 3HIFA 2UV1A 3KEQA 4ZYHA 1W0TA 1XSVA 3IP4B 3CLQA 3E2ZA 5C3EJ 3P7NA 1FEXA 4HNUA 4II3A 3HOVJ 1V2FA 2JISA 2P7CB 3WTVC 1FOKA 3O2PE 5FJ8J 3I0TA 3I59A 3USFA 3P5JA 4EV0A 1W7MA 1DFOA 3L2UA 1PVEA 2E19A 5ILVA 2ID3A 1TQMA 3W2WA 3OYFA 1BR1A 2IS4A 2CH2A 4NNJA 2RC4A 4YIFA 1AHDP 2PJPA 1AKAA 1HW2A 3RKXA 2NNYA 3TKYA 3GZCA 5E4ZA 3F72A 3ECDA 4CCKA 1D0ZA 5BJ3A 2EZHA 3OSGA 1IJWC 2VBXA 4XQFA 2EFOA 4YFKF 2EA2A 2W7FA 3OS1A 1D8JA 1XN7A 2QA4I 4A00A 2OTJI 2HP1A 4ESFA 1TLHB 1SFEA 1GT0C 3PO3J 1FC4A 2HNHA 2Q1ZB 3LVLB 1BC8C 1ZKGA 3A9YA 3R4KA 4HNTA 1VQ6I 4GFBA 4DBRA 2FBHA 4W1UA 3ROUA 5JHUA 4G7OF 1O7LA 4KMFA 4IXSA 5FT6A 3QPTA 5DEQA 3Q0WA 4RLFA 4IHWA 5CVRA 1EQBA 1ORDA 1SMTA 3IUOA 1MLYA 1YIYA 4Y0IA 2XAQA 5EUDA 1W5TA 3WLXA 4M2KA 2VQLA 1ZGWA 2ZXWH 4IRGA 5AIPA 4LB5A 2KISA 1L3LA 2L0KA 1AMRA 5J1RA 2GXBA 3ISPA 5B5EC 5H20A 4UHTA 3S14J 3QOEA 5IP6A 1ARGA 1S5LC 1E3HA 2LNBA 1TNTA 1FSHA 3L7WA 2YCPA 3TO7A 2VN2A 1D0YA 3H14A 2WC2A 5DCMA 1XD7A 2ELHA 4BHBA 1B59A 1PJRA 4RLQA 5LLQA 2BWOA 4AVZA 2BIAA 3DODA 4A0YA 2XB5A 4EU1A 3R60A 3DU5A 3F0HA 5GP9A 3GZDC 3EETA 4M3FA 2XGXA 1Y1VJ 1WVRA 2Z2SB 5DUKA 5GAEJ 5IT3A 4E7IA 1ASDA 1DJUA 2K9MA 3FKIJ 5FROA 3IH4A 4UUSB 2IGOA 2WY8Q 3TW7A 1EH8A 3CDIA 2KDZA 4ZM4A 1B8IA 3DFGA 3DTEA 1SVMA 1BI3A 4CCNA 2QKMB 3GZ6A 1R7JA 4PJMA 2D63A 2E36A 3NYSA 4DZJA 3TCMA 3QYEA 2ZMEB 4IHVA 4WYFA 2C44A 4I02A 1JXSA 2PBIA 2R5EA 4LG0B 1FY7A 1T6SA 2CINA 1MDMB 3VAXA 1GC2A 3BCAA 3C7JA 4BHCA 2CQNA 2EK5A 4WLJA 2K86A 2X1CA 3EQLF 1X58A 1VQ5I 1ZH5A 3E6MA 3BR3A 1LE8B 1N8PA 1JUSA 3OYIA 3G73A 4B1RA 3BC8A 2A61A 1JJ8C 4BQ0A 2ZFWA 3E1SA 3W2VA 4YFNF 1ARSA 2RN7A 2ORDA 2GMUA 3DLAA 1S3JA 4M6XA 2XSDC 1S7EA 2HPIA 2QLRA 2Z5UA 4A6RA 2DOEA 4HZFA 3PDBB 1AHXA 3I55I 4P55A 1S07A 3HDDA 3A4CA 1IN8A 4DOZA 3L8AA 4WB0B 2D5VA 2WAQA 4ZAHA 3W6KB 2VJIA 4EVIA 4ATQA 1QA6A 3AL0C 4GDYA 4Q6RA 3K4CA 1J0RA 4DQ2A 3CCMI 2XPVA 2BEOA 4I99C 3S32A 3N4MA 2FE3A 3C1DA 4PJJA 2C6YA 2LKSA 1IRFA 1RNLA 2VKDA 5HS8A 2E71A 4XR6A 1PP8F 4A5MA 2E60A 4KJZA 4P96A 1Q1VA 5IY5H 2UUZA 5K5RA 2Z1YA 2VKHA 4OMAA 4WYEA 2BVLA 4E7LA 4Y0DA 2GOXB 3BG7A 2JA5J 3S2DJ 3FQAA 4IXZA 3EUHA 3LNQA 3IH3A 3LVKA 3HYIA 2BOLA 2VBZA 4LD5A 5DD8A 3S8PA 2O0RA 3RBLA 2D2WA 1LKXA 1WJCA 1BI1A 5CKTA 1YJNI 1R49A 5F9SA 1WZ2A 2Z9OA 3LWFA 1AMQA 3A0HC 3GLXA 3PSIA 3SZTA 1PUEE 3L44A 2YX4A 3FXKA 3TGNA 4DGWB 1X1PA 3I54A 3EUCA 1LKCA 2Y0MA 1S06A 4GDFA 4LG3A 4K2EA 5DV5A 2P5KA 2RNGA 1G3SA 4WXHA 1B5OA 1BJWA 3G4SI 4YFXF 5GADJ 4UV8A 1WKHA 1LK9A 1T98A 5F6FA 3S3OA 1QHHD 5FLVA 1VQ4I 3LSIA 1O7FA 2KT0A 1BL0A 5HDMA 2IGKA 2OPTA 3PUBA 1FG7A 1B9IA 1JG8A 4I01A 3HRSA 5L3CA 3OSFA 4W97A 1WYVB 1ZG3A 4V2FA 2D1HA 1U9NA 3CJNA 1K83J 1EJ9A 4HF2A 4QLCU 3JRCA 3OKSA 1GDEA 3E9KA 4XSZF 2P5VA 3HXLA 4RITA 3I56I 3M07A 3OYBA 1TC3C 1WYTB 2L7KA 4UV9A 4W91A 1U08A 2CJGA 5EIGB 2DA2A 4JX5A 3ELKA 2QSGX 2X5DA 4RJYA 3MAUA 3CUQC 4MQ9F 4RAEA 3GWPA 1ZODA 3E0JB 1B72A 4UVCA 1GC0A 2HUFA 3MWMA 1WSTA 3JU7A 1FOYA 3CD6I 3KP6A 3FXUA 4UUSA 5E8IA 3U1KA 1M1EB 2K3FA 1HF0A 2M2EA 2CW0F 2FQ4A 3OR2C 4EJUA 5JHFA 5CQGA 4NQWB 3GBGA 3B6AA 4L9NA 3VEPA 3K70C 2O9LA 1AMSA 4Z6YA 1KMJA 4BY7J 2FF4A 5G2QA 4Y33A 3J7AO 2CQKA 3BZKA 3M8EA 3MKZA 2PQ8A 1LFPA 3K4NA 4LG0A 1K7AA 1REPC 1BOAA 3CTAA 1MDMA 2XUBA 3F9KA 3KP3A 1LJ9A 4E3RA 2BHZA 4HBLA 1BC7C 2FEZA 4ADDA 4X6AJ 3TDUC 1LE8A 3N5MA 3WX9A 2E54A 4CYDA 1ASGA 3D1NI 4BQAA 1D7SA 4HW0A 1ASCA 2P8TA 4M3EA 2RFVA 5E1WA 2L9SA 5HS7A 3VK3A 1U0JA 1R4MB 4RGSA 5FRMA 1KA8A 2KMUA 4FQGA 2HZDA 5EZGA 3OYGA 2HKOA 1E3PA 1B9HA 3I16A 3DBHB 1SAXA 4WB0A 3FK7A 4D5CA 3OIQA 5BPIA 4PK4A 2BXYA 3R4TA 1R5ID 2GZWA 4C9YA 2O5RA 2R7TA 4MLOA 2VUMJ 3JRAA 4PSWA 2NVQJ 5M5YJ 3B73A 4GYIA 1LS3A 3U1DA 3ASNH 5GTHC 1ARHA 2JJ7A 2PJRA 1WH5A 3FVXA 2CG4A 2RVCA 3HG9A 1ZRCA 3FZ7A 2LC2A 5EUEA 3BJ6A 2O6GE 2CTZA 2PMHA 4KIBA 1A31A 4B43A 2BI2A 3QODA 2HOZA 3KPHA 2O3FA 2WAQN 1XX5A 3PUFA 3QYFA 3EYIA 4AYBA 5H6RA 2R7ZJ 4U1TA 4M6YA 2TRTA 5DS9A 4BKXA 1MIJA 3P9KA 2KIQA 2DXIA 3KE3A 4MNUA 4BJTA 4CH7A 3MEBA 5EEHA 3JRDA 5FKLA 1I27A 2JMWA 3QU6A 2IA0A 1HDPA 2WKAA 3EIAA 3E3VA 2GA2A 4DBCA 4ANJA 5CVVA 2X9DA 3GCMA 3SEZA 3UAKA 4XKBA 1RESA 1ACIA 2QB3A 2GOMA 3L2WA 4CGZA 2VMQA 5FB2A 2JWTA 1J04A 3BQYA 4NBQA 1R5GA 3HOWJ 3HHGA 2HWVA 3QPSA 1BS0A 3PNYA 1RV3A 3BR5A 1PMOA 3VB2A 3S1MJ 1B5PA 4B3AA 4KT5C 4OINF 3FXQA 1Z9CA 2VMYA 2DOAA 3C18A 3A9ZA 2PO3A 3HJEA 1V55H 1YHQI 1UCRA 3K6GA 3QYBA 2HU9A 1WYVA 4J8LA 3RKYA 1NK2P 2KLOA 3GTLJ 1IAWA 2HOSA 3BG3A 4L5JA 2CFXA 3TL4X 1JGGA 6PAXA 1YAAA 3OYMA 5GPCA 3OYLA 1KGSA 2BHXA 2Q7WA 4IY7A 2LDUA 2VIAA 2VIBA 5KNLA 3A0BC 1V2EA 1WYTA 2BI9A 4ZM3A 3SDGA 4FX4A 4A93J 1J5YA 1VTNC 5EIGA 4BQNA 2VQCA 4HDUA 3TO9A 2HTJA 3OOPA 4L9VA 1MKMA 1NG6A 2DA1A 3DBLB 4E7ZA 2DOUA 1NK3P 1FOXA 3OP7A 5G4JA 2GM4A 4E4HA 3I4JA 5J4VA 3G7QA 2EGYA 1BW0A 4A0ZA 2L02A 4NQWA 3KKIA 3GTMJ 2JUCA 4B98A 4A12A 1D8KA 3LL7A 1IUYA 3JAMK 1RV4A 1SPAA 2FNUA 1P92A 1MAQA 1BA5A 5ICFA 1TOKA 3J80Z 3ASAA 1XB4A 2R93J 3ERMA 5FLXZ 1I41A 4EB7A 3BJOA 1I1GA 4PJ0C 5K1YA 2WA0A 4P1WA 4I76A 1TL8A 1TW2A 4IKFA 1ARTA 2XRLA 1V72A 1ETXA 5DX5A 2V6EA 1TW3A 2CUFA 1IW7F 2HPMA 3P1TA 1JTXA 2R5YB 3QPHA 1YTYA 3J7ZI 1XC5A 1LUJB 4EJVA 4B8XA 4FL0A 3DKXA 2W7EA 3LSJA 1AKBA 3FQ7A 3FTBA 4RM1A 1VZ0A 5DJ1A 5G09A 2N8GA 3EI8A 3A01A 2DTRA 4A5NA 1M0OA 3CDHA 3IKVA 1NH3A 2CH0A 2FU4A 3IAS2 1UMQA 2XIGA 2QQBA 3BP8A 1TWGJ 4C2MJ 4XJLA 2HDCA 4OTLA 4EQQA 4QPQA 1LEBA 2HTSA 2CJJA 1TQPA 2L4MA 4DIQA 1AIBA 2CSOA 4RAFA 4BAYA 1ETYA 1YIZA 4BBRJ 3BLYA 2AXTC 3NDNA 3KX2A 1MBEA 1B4AA 2HKXA 3M1EA 4A69C 1IJIA 4KIFA 5HLGA 4GEBA 2L01A 5TGTA 1CQ8A 1ZLKA 1XEYA 4WXBA 4HAMA 1N78A 3BDDA 5IPAA 2H1KA 3I53A 4PCQA 2GXGA 2YKUA 2VMRA 3IWZA 4XJOA 2EFWA 3PAAA 5KHDA 4XLNF 2EZ1A 4V2GA 3OYEA 3FISA 4ZH4F 2Y9ZA 2VOPA 3D5RC 3GWZA 3Q9VA 4G94A 1VQMI 3WE2A 3JZLA 2Q2EB 3MAFB 3E6GA 1SC7A 2CW8A 1H89C 3AEJA 5FD6A 2DQRA 4G8XA 3S1NJ 3ZZJA 3BV0A 3JW9A 3D0SA 1HSTA 4AYBN 1KKPA 4L0ZB 2KFDA 3ZN1A 1AA7A 2GQQA 2FUG2 2O03A 4FTHA 3PIOF 2K4BA 4M71A 1SVLA 3E7LA 1AY5A 4GE9A 1WGXA 3ZRQA 5C4JJ 1G7XA 1LC7A 2CS3A 3PQKA 2L2OA 4G9YA 4OIOF 3W1HA 1D1AA 1QZ9A 5LEKA 3COGA 2PMZA 1SFKA 3FXJA 3S1QJ 3TFTA 3OYJA 1YQAA 1S9HA 4AC0A 1IX8A 1FYKA 1IG7A 2KRCA 1MBKA 1MSEC 2XC7A 1VFCA 4A6TA 3CMMA 2HDWA 2IS1A 2V6CA 1D1CA 2UWMA 1HW5A 1RR8C 2L4AA 4BE0A 1ON1A 3I64A 3VPRA 2GLOA 1FMVA 4PJNA 1C7OA 1IXCA 5F0CA 3AG1H 1BR2A 5LRRA 1D2FA 3S15J 5F0HA 1IN4A 3GZ5A 2BYLA 3HOSA 2ZC0A 4N9HA 2VGSA 1JHFA 3G8MA 4UHMA 2PB2A 1AJSB 4WXDA 2V79A 2QKLB 1WJDA 1XMAA 2RDPA 2VASA 2Y2ZA 3H5NA 3H92A 2VMWA 4DYRA 2QQ9A 3K4MA 1E17A 2ICWG 2V1UA 1N77A 2KQRA 2CFOA 3M1CA 1P3WA 1F5TA 2Z20A 3WGGA 4C3IJ 1FIAA 2IW5A 3Q8NA 1TATA 3SFZA 1JKOC 3ZPLA 5G4IA 1XMKA 2ZO4A 2OBPA 2PG4A 2ZFUA 3EUAA 2DA7A 4HX8A 4YIIA 3RYRA 3BWNA 4RA2A 3CQZJ 1UU1A 3WG9A 3EZSA 2VMTA 2VMSA 2R7QA 2XGDA 4HF0A 3PFIA 3AL0B 1AY4A 3CCLI 2X4HA 4U0VA 4CSWA 5BOXA 4H51A 1W7PD 2EPJA 3NWTA 1AAMA 2W7JA 2R5YA 2ID6A 4ZLVA 1K4SA 3S1RJ 5FFZA 3AATA 3BB8A 2X6OA 1LNWA 1TOGA 2W7IA 4UQVA 4L5EA 3PD6B 1C0NA 2EH6A 3VOEA 3F8MA 2W82A 5HLTA 2CSTA 4EMYA 2QENA 3BR2A 1K6OA 5F0FA 2OZ6A 2W8UA 2JA6J 2QB2A 1JF9A 2D1VA 1BN5A 4ZTFA 2X0LA 1CZCA 2FMYA 1R58A 3FIWA 1JJ6C 3NYTA 3IL2A 4CCJA 4AIJA 1ASBA 2PB0A 4PFFA 4ZSWA 2XB0X 9AATA 2YKYA 1LFBA 2E2HJ 2OGAA 2FMLA 2BWPA 4Q76A 2NAZA 4WK8F 2W84A 5GPAA 5M5XJ 2H27A 1J2XA 1D3YA 3BWOA 3CESA 4JOMA 1YJZA 1ZELA 2DT5A 2QGUA 2KP6A 1NG7A 5EFSA 4IVNA 3W6JB 4ESBA 1G4DA 4CICA 1YJYA 1GBNA 4UUTA 1VJOA 1E3OC 4KXKA 2LR8A 4E7HA 1I29A 3U9GA 1X19A 2EZLA 4RB1A 1LC8A 4ITGA 2MC4A 1J75A 1IDYA 3H35A 4XM3A 5FO5A 3H3VK 1LVKA 2B0LA 2W8TA 3K7AJ 4OU0A 1HC8A 1AY8A 2VC0A 1DP3A 1QO0D 3LQQA 1Z7LA 5DJ9A 4MSOA 1Z21A 5G0AA 3A02A 2Q2EA 3KYLA 4GGGA 5FKMA 1H8AC 5DCMB 3U21A 1VQOI 4GE4A 3CO7C 4F5FA 4O5VA 3F6VA 1CGPA 2XRNA 5KVRA 2OCCH 2E2IJ 2CU7A 1KL2A 3BS8A 4JF1A 1QQIA 4A72A 4HVKA 2H1LA 3BPXA 5HLHA 2HVSA 1AMAA 2MD5A 5J1UA 3RSNA 1YW7A 1WYUB 2K9SA 1SFOJ 1FBUA 2M9HA 2AEVA 4B09A 2HQNA 3V8KA 1J9IA 1OFCX 3HZJA 2M34A 3CCEI 3Q3SA 5DD4A 2ZSMA 1YNUA 3OL3A 3CUOA 3CUQB 3GZDA 2MH9A 4AD9A 1JUPA 2GXAA 1X29A 1BJZA 5F8VA 3UWCA 2ISZA 3FMSA 5LGTA 3BTJA 4AWXB 4A3CJ 1CQ6A 3KEOA 5IOZA 5ICCA 4X0GA 2DKJA 3HMUA 2CQ7A 1MGVA 2I5UA 1W7NA 1ZR2A 2GAUA 3H9GA 3S3MA 5TISC 1IUFA 3VDXA 2QSHX 1BW5A 1SAUA 2XAGA 3P9IA 4F5KA 4DW6A 1UU0A 3AEMA 1MDOA 2ZJPF 7AATA 2PMZN 4ITXA 4QIWN 4ZZLA 3G1LA 3LSTA 3I9V2 1Z91A 3L09A 1NHAA 2XAFA 3E5UA 4CBRA 3R0AA 3K4LA 4I6ZA 4OWRB 3BCBA 1OLTA 1SMYF 1M0QA 3KYDB 3F6OA 2XPWA 4AZJA 3KETA 2PMUA 1JS3A 3FXOA 3A9XA 2G7HA 3CO6C 1GC3A 1G6NA 2AY8A 2KKOA 3JSPA 2F5CA 2CJHA 3LOCA 4M72A 3KZIC 4XOPA 2WV1A 1Z0XA 1O3RA 3BWGA 4MIMA 1ZOBA 3PA9A 3RUYA 3TMOA 1HCRA 2Q8KA 3OL4A 1PUFA 2M30A 3LSRA 2NOGA 1FT9A 3TQNA 3V8JA 5BJ4A 2LMDA 1T95A 1Y8RB 5E18F 1TT0A 3EUKL 3A2KA 3FK6A 3CQ6A 2DFEA 3M9AA 3PD6A 1GDTA 2XPUA 1C7NA 4FE7A 2ZSHB 2OCEA 3NEUA 3HOTA 4E70A 2ME0A 2DA5A 3H0GJ 4D0PA 4G6QA 1UHSA 4BGDA 2ZSIB 3BROA 1IO2A 2E7XA 2M4KA 4PUSA 2ZJQF 1SFUA 1U2WA 3HTUA 4N0WA 1USTA 3WU2C 3BG5A 1U8BA 4F5HA 3K4JA 4JK1X 3HVYA 1D5VA 3UKGA 1ZAOA 4XMYA 2HZTA 3GX4X 1VQ7I 3MZ8A 4P7YA 1D7VA 2L7MP 1WHUA 1GV2A 5CPRB 4RKCA 1X3ZB 4IJAA 1HKTA 3FCRA 3S2HJ 3ABTA 1JS6A 3EPZA 3ZQLA 1APLC 3A8UX 4HX7A 3GR9A 2VKVA 3DEUA 5LGUA 3RQ1A 3GO5A 2FYFA 1A6QA 1YJ9I 1AICA 3WZFA 3NU7A 4YRVA 2LG4A 2XAUA 4MQVA 5D6FA 2HYJA 2CW7A 2F8JA 4LLNA 1BJAA 2BY2A 3GTJJ 1WCMJ 2VODA 3WU0A 5HDGA 4JEVA 2HR3A 3WGIA 1AHEA 3QWLA 4E77A 1YS6A 2X48A 5HOOA 2AATA 3KP7A 2IVMA 3KEYA 1SZUA 1WYUA 3CCQI 2VBWA 2CWEA 2L9VA 3ABKH 2ZJRF 4O3MA 3DPUA 4FFCA 2F5DA 3RCOA 3T8RA 4CDGA 1B72B 4HF1A 4RAZA 3G6EI 1P4AA 3FVSA 1UG2A 3CF2A 1LW4A 4M3DA 2DK5A 2EA4A 3ZZKA 2RKHA 1D0XA 2E5ZA 1P4WA 1W7PB 2IEKA 3CUQA 3DEEA 2DU9A 3DPLC 4LGWA 2OQXA 5D5SA 4XBFA 3AEMC 3ASBA 3ULQB 9ANTA 1P7JA 1YW8A 4OAZA 2Z67A 4AH3A 3DU6A 3GEZA 2M8EA 5LRSA 2COMA 2JRTA 3OYNA 1KQ0A 5JFRA 3SZPA 2FX0A 1CL1A 3QPGA 2ZC2A 1SANA 1YE9A 1T2KA 1EF4A 4W1XA 3VYTB 1GC4A 1HQCA 1GEXA 4XLCA 5LGNA 2K3PA 2CV1A 3CDLA 3WE3A 1D7RA 2DOFA 3LAPA 2HP2A 2Z1ZA 4M3BA 3QI6A 2HOXA 2DMUA 3QOPA 1ZG1A 4KFCA 2KIMA 2JZYA 1FMWA 3TP0A 1BI0A 5BPDA 2ISYA 1OHYA 2JPCA 2DW4A 5JLWA 4R5FA 3AEOA 3ZQQA 2IT0A 4FX0A 5EQCA 3K1MA 5IP9J 2COBA 3Q9SA 4CZZA 5FKOA 1IN7A 3FZ8A 3CP8A 3FWEA 4XKWA 4DBQA 2MC3A 4IHTA 1WFXA 1RUNA 3DZZA 2EQRA 1SF2A 3H1CA 1XGSA 1C4KA 1AKCA 3K7YA 1RETA 1DGWY 4BNCA 3KZZA 3F8CA 1RPWA 4CHUA 2EIJH 3LSGA 2IA2A 5F08A 1XI9A 3KGXA 3DXWA 3NU8A 2DAOA 1RKWA 1IX6A 3FX3A 1JGSA 3DR4A 3WGHA 2E34A 4ZWMA 4KICA 3W6VA 2XF6A 4JBAA 2PN6A 4B48A 5J47A 2JUGA 1SFXA 1BT4A 4EJTA 3AG2H 2M8GX 3Q5FA 2BXZA 3VYRB 2KIUA 3IRQA 3HT4A 4ZYAA 1OCZH 3FZVA 4XL9A 3VSLA 2A07F 1KQ9A 1ETQA 2IRFG 4G12A 4Y13A 1VQLI 2IP2A 2VYCA 4XORA 4OMZA 3HUGB 3MCZA 1ZYRF 1J7KA 4F5GA 2HZPA 4ON0A 3CJRB 3JW4A 5HHYA 1WQ2A 3C3WA 3SZGA 4F5LA 2GBYA 1FJLA 3ZMVA 4FASD 5HXXA 5ILUA 3R9AA 1ETVA 3BT9A 3LV2A 1QBJA 1QZZA 4CYCB 3VK4A 2V9KA 3LAJA 4Z2YA 4KUMA 2FSWA 2EINH 3HSFA 2DA3A 3KLOA 1TT5B 1FIPA 2KDOA 2LOOA 5F1JA 1QRYA 2R7OA 5EGOB 3G71I 1AWCA 4LMYA 4OIPF 4MKJA 2LBFA 3AENB 3JWAA 4A3JJ 2DDBA 2M7BA 2RQQA 4G7ZF 2EV6A 4XIDA 1ZTRA 1N75A 3VSKA 5J1YA 3RCHB 2ECCA 3O6BB 4OIRF 4RJ0A 3ZRGA 1C9CA 3DC1A 4XKVA 3RKQA 3WGCA 1K78B 2AY6A 4R5ZA 2CMPA 3LWSA 3VP6A 1QVTA 4KMUX 5KCMA 1S8NA 2LK2A 3SEQA 5D4SA 2ZXIA 2YKXA 3F22A 2E7IA 1KZHA 1LPQA 1T3IA 1Y4IA 5CVIA 2D45A 4QPOA 1FTZA 3FFRA 1GVJA 2L7ZA 3W3CA 1K79A 1W7PA 2Z16A 5K5QA 3IHUA 1CJ0A 2JGTA 1Z77A 5M46A 2IJLA 1BM9A 2VI9A 3W1JA 2NYXA 1IUGA 1U9OA 3FZ6A 2E7WA 2QUFA 4F7ZA 3RZOJ 4BQQA 1GCKA 3MFKA 3AG3H 3DTIA 2F5VA 5K7ZA 3HBLA 2R7WA 3EYYA 2GQNA 2VQGA 1TNSA 4U88A 3MMYB 2XKOA 2XF5A 2Y30A 2DKBA 3OS2A 5B1BH 3K69A 2FA5A 1EH7A 1FZPB 3B1CA 4AUXA 2OA4A 1IAXA 5E3OA 1BR4A 1B4XA 2GWRA 1FBQA 3A01B 1QGNA 1R1VA 3RI6A 1X2NA 1Y6IA 2GB3A 1S0AA 1OCCH 3M4OJ 1T38A 3QN6A 4W5KA 1L0OC 4Q48A 4Y3OA 2K40A 1B9NA 1SEUA 4A3GJ 1F43A 2I8DA 1V5FA 2BV6A 4BACA 4A3BJ 3QGUA 1Y1WJ 4JE5D 2VGUA 3WTXC 4H0EA 2AY2A 1WKMA 2JSCA 1V5EA 2QCOA 4IRHA 4CO8A 2W8WA 3N0LA 2K02A 4U7BA 1RI7A 1MNEA 1S09A 2AY5A 3QHXA 2DLLA 2HYFA 3BTLA 3F21A 3KYCB 1YW9A 4ABZA 1ELQA 1M0PA 2OQRA 5ICEA 1ASLA 1GEYA 1RVUA 3I5UA 1NTCA 3F0CA 5ERIA 2PI0A 3W1IA 2AY1A 2FJ1A 3O3KA 3C2BA 1TZLA 2X1DA 1YFHA 1ASAA 2XGEA 1DTYA 4A0RA 3EIBA 1IGNA 4LK1F 5I92A 1GXQA 5A2QK 4IL6C 3J80K 3L9FA 1OATA 4U87A 4S04A 5FLXK 2OAZA 3HUGA 2DFHA 5E8GA 2WBMA 2TPLA 5D8LB 4BDZA 4A3EJ 3COAC 2O8XA 2ADUA 4WP0A 2KIFA 1TWCJ 2K9LA 2MLGA 4JEWA 3H36A 3WTZA 1KU7A 2QM3A 1MMGA 1TWFJ 2FRHA 5LHIA 1ONVA 1WKGA 2LYCA 2I10A 5ED4A 2Y69H 5E79C 2ZNZA 3CQ5A 4IX8A 2ZJ2A 3LY1A 4I7HA 3L1PA 3MZYA 2JA8J 1MMNA 3GTKJ 2B7EA 2IS2A 5JLXA 4CYCA 3KZYA 4A3MJ 1MMDA 1PG8A 1DQUA 1PP7U 2OGEA 4WXGA 1R71A 4WYCA 2NOJB 4HYEA 2ETHA 3WGBA 2BGCA 5EGOA 4C3JJ 1YG2A 2E1OA 2AHQA 1O69A 3BY6A 4MFDA 1JI8A 2D65A 3JTHA 1WJFA 3AENA 2HYGD 4M9ZA 2OTLI 3CAIA 2QEXI 1T8IA 3RCHA 2DFFA 2NNNA 2ZXHA 4NDLA 2OV7A 3F8NA 1Z6RA 2FOKA 1B1BA 3JRGA 5D95A 2EBIA 4LB6B 4IOCF 1K78A 2HOTA 3B8XA 4F5IA 2VMOA 2B63J 1VI0A 4U7DA 4RAGA 4AOAA 3JCUC 4B44A 5LBQA 4WLHA 2FOWA 1CF7B 3LQRA 3FHZA 2TCTA 2RQPA 5IYBJ 2W85A 4BUPA 1AU7A 1YI2I 5EG0B 2H6BA 3DLLF 4F91B 1IX7A 2MSYA 2X1EA 2DPUA 1TPLA 2O8KA 2H09A 1I43A 2OUMA 2Z3YA 5ILSA 1HDDC 3JWBA 3JTXA 3HTSB 2XVCA 3T1BA 2AY7A 4RB2C 1W4MA 4C3HJ 2IXSA 1BJNA 3DRDA 3QQAA 3HQTA 1QVUA 5DM6F 3CCYA 1MNMC 4LIUA 4LJZF 4IQ4A 4CA0A 1VQPI 2FNIA 1D7UA 2VGWA 1Y0UA 1J32A 3BN1A 2XV4S 1O62A 4A3LJ 1FWZA 3GW2A 3GTOJ 4H4KC 1OCRH 3TO6A 1TWAJ 1Y39A 1O3SA 3R6SA 1S72I 4W8IA 5EEGA 1DPUA 2VE9A 4MEXF 2GIZA 2VJJA 1RIOH 1OCOH 4B4CA 4HLYA 1OCPA 2A6TA 3GLLA 2HDDA 5LH9A 2AO9A 1ETWA 4GXOA 3T0YA 3HB9A 3OYKA 2JRMA 1P7IA 1DGRM 1FP1D 2OQGA 4KITB 2VT3A 1WI9A 4ZYDA 1EH6A 1Z7UA 2X6YA 3WTYC 2E1MC 4IF4A 3HSRA 1X1AA 5J4YA 3ZQIA 5EDNA 1MJAA 3T32A 1D5YA 2BIGA 3NAUA 4ITVA 1YX5A 2LRDA 1N2TA 1IDZA 1HKSA 5M3FJ 3OV8A 1A04A 2RV8A 4I09A 4BHPA 1MDXA 5LHHA 4EGZA 1SD4A 1FOWA 2FM1A 2ELKA 4JEXA 3HSEA 2YR2A 2A05A 1UAAA 4LFUA 2BE5F 2V26A 2Y48A 3ABLH 4PGGA 3RZDJ 5DB5A 4LOCA 4CXFA 4ETSA 1ERDA 2OC6A 1F36A 5L3FA 1W23A 3GZNB 1TOEA 1YO5C 2Y0SA 1I39A 1R1TA 1Z67A 4IEJA 5FFXA 4P5OA 4A3FJ 1G2HA 2MGQA 3TDZC 1OYIA 4MGRA 1OYYA 2F2EA 1YITI 3NX3A 4RM2A 3V7CA 4EB5A 2G6WA 2OU2A 1EKEA 2UXXA 4D1QA 2M4GA 4IHSA 1IV6A 3ZOBA 2LF8A 3HGGA 2BVMA 1U6GA 4D9JA 5JVTA 2JQ7A 2DMTA 2E2JJ 3SFIA 2F4MB 2EJRA 3GUDA 4ZC3A 3ZP5A 1V4RA 1W3UA 4XJMA 4MQPA 2QF7A 4DGTA 3G2BA 5EEAA 2DYSH 3JAMZ 2VMZA 2Z61A 5FRNA 2A5YB 1MBHA 1CZEA 2LY1A 2HS5A 2YRRA 2M0MA 4RAYA 2C81A 5HDNA 4KYWA 3GTGJ 4EM2A 2CY8A 2DT7B 2KHMA 3WG7H 1RVYA 1VQKI 1USSA 1RKTA 4R79A 2LKXA 1YYVA 3N75A 2LFBA 2OATA 2W57A 1R36A 3NWSA 3JSOA 3HPHA 1BJOA 5LD2C 3HOXJ 4YIRX 1YIOA 4KAMA 3WY7A 4BE2A 1XSXA 1JUMA 1TOJA 2YHKA 4W1WA 4UHOA 5HODA 4KT6A 3RI4A 2BZTA 1ECXA 2VB6A 2W48A 2EZKA 2P7VB 1OMIA 3FM5A 3IC7A 5GAHJ 4IXAA 3WTUC 1CF7A 3F6TA 2W00A 2V1NA 4FETA 3E2FA 3RBFA 2HGCA 4F3QA 5EG0A 4RM3A 3I4MJ 3IV5A 2HORA 4Y0HA 2GMSA 5FKKA 3BCXA 5BQTA 4XLPF 1SZSA 4BL0B 2H6CA 1XCVA 2V7FA 1Y56A 3J7YJ 1A6IA 2BW3B 3F3XA 1LDDA 3VYSB 1YX3A 2BIEA 5J6XA 3H5RA 2W7DA 1MJ9A 3RQIA 4HLXA 4MEYF 3D6KA 3S16J 1W0UA 1B6AA 5D8KB 4L0YB
chains in the Genus database with same CATH<