4TV7A

Crystal structure of bacillus subtilis gabr at 2.05 angstroms resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
460
structure length
431
Chain Sequence
TITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAALPDDLKEIHIWISFSHMDTDHFPIKSWFRCEQKAASRSYMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEDTRRTEQDILSHAAGLQLEIFGMSRFRPALIIGFARLKEEDIQEGVQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the aminotransferase domain in Bacillus subtilis GabR, a pyridoxal 5'-phosphate-dependent transcriptional regulator
pubmed doi rcsb
source organism Bacillus subtilis 168
molecule tags Transcription
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 132
structure length 431
sequence length 460
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4tv7A01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4tv7A02
3QPGA 2IA1A 1T38A 3BCXA 3P9CA 2HP1A 1HKQA 2CW0F 4ZM4A 3HDOA 3IWFA 4ADDA 2VMTA 3DEUA 2EB7A 1W3UA 2XKOA 1USTA 2L01A 1OKRA 4WYAA 4Q4ZF 2XROA 4A2UA 4P9UA 3VODA 2HWVA 1ON1A 3FRKA 3W1JA 3L9FA 4CDGA 3RYPA 5AONA 4LLGF 1SZKA 3J81K 4LG0B 1GCKA 3II0A 2HUUA 1SD7A 1HXDA 3GZCA 4KA4A 2HQRA 1RV4A 1K78B 1AHGA 3EUCA 1G4DA 1BIBA 4Q48A 2HOEA 4UHMA 4F5IA 4XJOA 5D6FA 3V7RA 1O3TA 1FX7A 1U5TC 1R1VA 2JGTA 1GVJA 1XMKA 3LY1A 3HVYA 2Q7WA 2KJBA 4LC3A 2OGAA 5F64A 1TTYA 3M5UA 2E7WA 2P5LC 3J80K 1NHAA 1X0MA 4LNLA 1H9GA 3RPUA 4WXDA 1TW2A 1ARSA 4RIZA 4KIGA 3J80Z 3NUBA 2W7FA 2XHKA 3VB2A 4ENNA 4ZDLA 1R5GA 2BI3A 1I5ZA 4W91A 3K69A 1TNTA 2HOXA 3KKIA 1IXRC 3EDPA 3L09A 3EI9A 2GWRA 2XAFA 1XEYA 3NUIA 1BJ4A 2D1HA 2VMUA 2W84A 2W85A 4OU0A 4PVFA 1HBXG 4H0EA 2LF7A 3NU8A 5H20A 2KRFA 1TNSA 2HUFA 4W1XA 3L2CA 3VP6A 1TPLA 5IT3A 2EH6A 3FD0A 5BPIA 5E3KA 3KEQA 1W7MA 3E6DA 4KMUX 3GYHX 4ENKA 4F5GA 3GWZA 1B9HA 4CHUA 2PQ8A 4GYIA 5CYVA 3MCZA 1KKJA 3DC1A 4L9TA 1LW4A 2F5DA 3FMRA 3DF8A 5E18F 5HVQC 3IC7A 1IAWA 1LW5A 1LC7A 1H0MA 1WYVB 3U2RA 4CBRA 3FZ6A 3I59B 3EI5A 4A6DA 4N9HA 4MQVA 4GE9A 3B73A 3RBFA 3N97A 1R7JA 2E7IA 4YFNF 2D63A 3DQVC 2X5DA 3QPTA 2JPBA 3R0JA 2W8JA 1FG7A 4AD9A 2KIFA 1GXQA 4BQAA 1LC8A 2M45A 3MQ0A 1DJUA 1BIAA 4O6ZA 1XB4A 5CVUA 1YIZA 3RIRA 3TOAA 2G9WA 3WKRA 1Z6RA 1LC5A 4P9FA 3VEPA 2Q2EA 2VE8A 4KMFA 3VFZA 1HKSA 2QBYB 2ZKZA 2GZWA 4D0PA 2LF8A 1J2XA 5BJ3A 2PJPA 4E77A 4ESBA 1ZLJA 3BZ6A 2C6YA 2JTVA 4G6QA 4LLLA 2PMHA 1SVVA 1ZRFA 3RKWA 5K5QA 2D2WA 5HLHA 4JE5A 2FNAA 2O8XA 1YIYA 3KE2A 1AIAA 2YU3A 5ILUA 1MJ9A 2CH2A 4KAMA 1QZYA 4ATQA 4HZFA 1S07A 2RFVA 1FP1D 1TASA 2FOKA 4HV5A 3B1EA 1CQ7A 1IN7A 4ZASA 1IZ1A 3R61A 3BWOA 3ELEA 3F8BA 3PQJA 1GXPA 1T3IA 2F8JA 2FBIA 1WSUA 4ITGA 1FYLA 2FYFA 2XVCA 4U88A 4ETSA 1R58A 4WF2A 1IX7A 3N4MA 1RZ4A 1QZ9A 3EIBA 1GC4A 2ZC0A 1AJSA 2STTA 1DDNA 1KQ0A 1U08A 3CLOA 3ZMDA 2FBHA 3ECDA 5FLXK 1QZZA 4OIQF 1FC4A 2FNUA 3DODA 2VN2A 3F22A 4MQQA 3ZMVA 3GETA 4N9IA 4ADBA 3IWZA 2YKUA 2QQBA 2VIBA 4AO4A 5D8KB 4XAUA 1JG8A 3NYSA 2HZTA 2W24A 1AMAA 2QB2A 3B8XA 4U2HA 2UXNA 1CQ6A 3EIAA 4HLXA 3K40A 1E17A 4I0AA 3AEOA 1SAXA 3M8FA 1FC3A 3E3VA 2AEVA 4KUMA 2RNJA 1MAPA 2YR2A 2JJHA 2FMYA 3GO5A 2Z3YA 3DFGA 1W23A 2A6HF 4Y17A 4JEVA 4HQMA 1M32A 3ATHA 3FFHA 1HSTA 2PFBA 1BQDA 3BCBA 1C9CA 3ZQ7A 1S29A 4CXFA 2BBYA 5DCMA 1OXOA 3NU7A 5LHAA 1Z6TA 3I64A 5ICEA 2DU9A 4G9YA 3WU1B 2O0YA 2WK7A 4ESJA 2OGEA 3I4JA 1P2FA 2IPQX 2Y0MA 1JS6A 4IPAA 3CAIA 2HDCA 4I8AA 3BS8A 5FT5A 1U2WA 1IRGA 3KGXA 5H6QA 4OT8A 3ELPA 3PDBB 4FX4A 4L0YB 2Z1ZA 4I01A 3MEBA 4LG0A 3WX9A 1QJ3A 4PGHA 5ILSA 2VGUA 2VE9A 1Y0UA 1T6SA 5LH9A 1W7PB 3CO7C 2VI9A 5M4BA 4Y15A 4GDYA 2L3DA 1BW0A 5H6RA 3A2BA 1DFOA 3BOQA 4GRXA 1BI3A 1DGDA 1QJ5A 3TDZC 4UNOA 1U8RA 3CUQB 1XCVA 4K2EA 2L4AA 1SFUA 3M8EA 3WGCA 2V1XA 3VOMA 5L3EA 2P6SA 4RGRA 3V7CA 5K5RA 2DKBA 4A5NA 1IX8A 3U1DA 2ZNZA 1KL1A 1WYTB 1KQ9A 3F3XA 2WV0A 1TQIA 2ELHA 4KFCA 2V6CA 3BY6A 1B5PA 3HTSB 3V4GA 3FVSA 3M7GA 2NS0A 1VJOA 4A0YA 3K1MA 1AHXA 5LGUA 3FTBA 4TMRA 1MZBA 1RI7A 1TARA 4ATPA 4AH3A 2EFNA 5K8BA 2CJHA 4OC9A 4XLPF 4KT5C 1WRJA 4A6RA 4GYGA 3R6SA 2CB1A 4CICA 2O6GE 4U0VA 5DEQA 2A68F 5M49A 3MEXA 1WSTA 3HT4A 4A6TA 2HTJA 4MKJA 1ZG5A 4P55A 1ZAOA 3LFKA 2ESNA 4EGZA 2E1NA 1CZEA 1UU1A 3L7WA 3ZPLA 4MEYF 2VT3A 4L9NA 5FT4A 2EV6A 1IX6A 4CXRA 5G0AA 3F72A 4A0FA 4WBTA 3F8CA 2VMNA 1A04A 4HV6A 5L3GA 2QUFA 3JU7A 2JISA 4WXFA 1LVAA 3IRQA 5CLSA 2K02A 2RC4A 3WTYC 1G3TA 3HSRA 2P4WA 3R0AA 5FO5A 1ZHFA 3T8RA 2VC0A 4K2MA 2EO5A 4Y13A 3AENA 1YJYA 2QM3A 1DJEA 2XH1A 2YX7A 4IY7A 1FPQA 2Z5UA 2OD5A 3DKWA 3GZ6A 3FSLA 2GMSA 3NEUA 1IXSB 2L54A 3QBOA 1C0NA 1G6NA 3LV2A 2YPRA 4AWXB 4RKCA 4CZZA 1EJIA 2EZ1A 3EZ1A 4IXAA 1AJRA 2NYXA 4A5MA 1CJ0A 2R3SA 1ZGJA 3ZMUA 2Q8KA 2KJCA 4M6YA 2EFWA 2OQGA 3ABUA 2Z9UA 4RB3C 2TPLA 4GE7A 1YW7A 4FL0A 5E1WA 2FXAA 2Z1YA 4M2MA 3K2ZA 2AY5A 1XI9A 4LW2A 4YFXF 3WODF 1SZSA 5IT9K 3HIFA 4JF1A 1ELQA 2PI0A 1P92A 4UVAA 2FQ3A 2E7UA 3IHUA 2BI2A 3FM3A 1J59A 3N5MA 4O6JA 3HTUA 4BA4A 4F5KA 4ZWVA 1ZGAA 3TFTA 4HW0A 1MJBA 4WXHA 1E5EA 3I58A 3BJOA 1ASGA 4L9JA 4UXNA 3GW2A 1CQ8A 4MQPA 3ZZJA 4A0GA 2OA4A 4HF2A 1YJZA 4P96A 3TGNA 2AS5F 4AIJA 2C0RA 5EQCA 5ICCA 3E6BA 4KXKA 2IA0A 2QLRA 2K4JA 4HLYA 3RQ1A 1F5TA 3FQ8A 2V1UA 4E70A 2W7GA 1AWCA 2VBXA 3FKDA 3EI8A 1KYZA 1ARGA 2R0TA 4IXOA 3DRDA 2GMUA 1TOKA 5EEHA 1T2KA 2A07F 4HF1A 1T0FA 3AEJC 4BYYA 1D3YA 4R79A 2H6CA 1J04A 3AEMC 2M1BA 4RAYA 5ICGA 2RDPA 3V8LA 4W5KA 3AENB 1MDZA 3DU4A 1G3SA 3QU6A 2YCNA 2QVOA 3I71A 3KETA 2KIUA 2OAZA 2VMXA 1FLIA 3KFWX 1GC3A 3AEJA 1H0CA 3E2ZB 1JHHA 4HA8A 3NRAA 1IXCA 2CINA 2DR1A 4S05A 3E6CC 5HLIA 3MKJA 3KP7A 3K28A 1JF9A 4RB2C 4EB5A 3E2ZA 2AY8A 2W7EA 1AKAA 1XSXA 5LRRA 3LWSA 2OBPA 4XLNF 4QWQA 3E97A 1FZPB 2P7CB 3DZZA 2D66A 5TF5A 1AY4A 4M6XA 3G7QA 4JBAA 2BI5A 4AOAA 2E7XA 4L0ZB 5HXXA 3DPTA 4M71A 5ILVA 1B4AA 3GFIA 2OKKA 2DO7A 2R7DA 5LHHA 1WWXA 2VYCA 2J5PA 2QMAA 5IWQA 1ORDA 3FVXA 4RGXA 1VTNC 3F6TA 3KP2A 1TOEA 1XMAA 2F5EA 2V9VA 2C44A 5G4JA 2VOOA 2C7TA 2VT2A 2VLHA 1O4SA 1G3WA 3P6KA 2M8EA 4YG2F 5E1XA 1ZC9A 5E8GA 2ISYA 1V4RA 3I16A 5BMZA 3BV0A 2ZBKA 2HOYA 3H92A 2G7UA 1XN7A 1HW5A 1V72A 4MGRA 2WK8A 4BMKA 4M74A 4EMYA 1MGVA 5ICFA 3ELKA 4RM1A 4OCAA 2VI8A 2OQXA 2YX4A 3WTTC 1IW7F 3EUHA 1LKCA 2VBZA 1PDNC 1TQPA 3HLMA 1WYVA 1Z3ZA 2XAGA 4L5IA 1O7FA 2ORDA 1O3QA 1X2AA 3SZPA 1ZRDA 1FYMA 1AKCA 5L3DA 1WYUB 3FQAA 4RAEA 3REOA 5LGNA 4EQQA 8AATA 1ARIA 4ZYGA 2BV6A 2FRHA 2WC2A 1B8GA 3TO7A 3QGUA 3RBLA 3O2PE 1V2FA 2YHKA 1B5OA 1FP2A 2V0YA 1ASNA 2BYJA 3OOPA 4XJLA 3Q8NA 2CGPA 2AEUA 2GQQA 3ZP5A 1KU3A 4A00A 4EVIA 1R1TA 1P4XA 5JR3A 2QA3A 2Z67A 4CVQA 2A5YB 5HDGA 4ZYDA 3P9IA 2AY6A 2EV0A 4AIHA 4O5VA 1LNWA 1EG5A 3CQ5A 2OZ6A 1C7GA 1IAXA 4OMYA 2Z9WA 2ZNYA 3KE3A 2PMUA 2A61A 3QHXA 2XAJA 4WYGA 2JSCA 1P4AA 2VBYA 1ELUA 1GC2A 5E5IA 5JAYA 4Q31A 2MLKA 2FSWA 1AIBA 1YYVA 4LMYA 2H09A 2QWWA 1S3JA 3HOSA 1IUYA 3RPQA 1H9TA 2X8UA 4WXCA 3DYDA 3ISPA 1ECXA 3HRMA 4W1VA 1M6SA 1Z9CA 1BI0A 3PQKA 1FT9A 4WLJA 3HSEA 3WU0A 2JJGA 2MD5A 1G4XA 4B8XA 1EH7A 4OMAA 3BWGA 1ASAA 4AZKA 3KGWA 2DPDA 5K5OA 2A6EF 5EUEA 4U7BA 2XIGA 1AAWA 1J7KA 4M72A 1USSA 2HYFA 3BPXA 4HYEA 2BIAA 3WTSC 3I54A 4JEWA 1MDOA 4RAZA 3Q9SA 4Q5SF 4B9BA 1D7RA 2FNIA 5DV5A 4R5ZA 2CFBA 4XJMA 3P9KA 4XSZF 4KYOA 2PG4A 1IVRA 3WE2A 3ULQB 3E6MA 6PAXA 4A0HA 3FVUA 2K86A 3EI7A 2VC1A 4BNCA 4A72A 4I98B 5FD5A 2FEZA 2GAUA 3I0TA 3ZMSA 3T0YA 4HVKA 1Z1DA 3ECHA 2CSTA 5HLGA 1AOYA 2VGWA 3F0HA 4CYDA 4O3MA 4LFUA 1O69A 5BS6A 5AIQA 2PLYA 3F6VA 4FHTA 1N2TA 3MAJA 4F5HA 4G94A 3CO6C 1U6GA 7AATA 3NX3A 2RN7A 1ZLKA 1OYIA 2HOZA 4LW4A 2AY1A 1GDEA 2D61A 5FGMA 4G8XA 3LQQA 2GSAA 1W7PD 4XK1A 2VMSA 3NQOA 1SF2A 3LAPA 5EIGB 4LB5A 1VEFA 4MHGA 3WTZA 3DR7A 1B9IA 2MLGA 1STZA 2MC3A 5DJ1A 1LDDA 2ADUA 5CJ9A 4ENJA 4A6EA 1SMYF 1XDUA 1JE8A 2GA2A 2RGVA 3D0SA 3G0TA 4NOGA 3BPVA 4BA5A 1C7NA 2CANA 5L3CA 2W7LA 5CVRA 4XSXF 1KYWA 3T32A 3I59A 4OYTA 4ADCA 5DD8A 2HUIA 4Q76A 4G7OF 5CVJA 2VMZA 2DT5A 2A69F 3FWEA 5DUKA 1DPUA 2NAZA 2BWNA 4EJVA 1P3WA 3FCRA 3ZZKA 1KU7A 1JS3A 2LNBA 3FX3A 3JSOA 2EGYA 5J8QA 1ASEA 4DQ2A 1ZN2A 2R5EA 3RUYA 2QB3A 2D45A 3KCCA 2W7MA 2XAHA 4Q75A 1HW1A 1JHFA 2P5VA 4PZJA 4DGTA 4N0BA 4BHDA 4K2IA 3HRUA 5FFZA 2D1VA 3C18A 4I0BA 4GO1A 2CSOA 1MLYA 3GFJA 1FOKA 3B46A 1YFHA 4A0XA 1J5YA 1LDKB 1PFFA 1PG8A 2PB0A 2YOBA 2Z9OA 1O62A 3P1TA 4ENMA 2E7JA 3FM5A 2Z20A 2ZMEB 2DGLA 4WXGA 3SZTA 2CJDA 2DAOA 2BKWA 2MH2A 2QYOA 5EAAA 5FT8A 1S09A 4CO8A 1S06A 3WZFA 4EU1A 3EQLF 2RQPA 3WTUC 1BQAA 1G7WA 2EFQA 1QBJA 4LNMA 3KEOA 3MZHA 3T8TA 3VK2A 3T5XA 3ML6A 3CJNA 5HDNA 5IT9Z 4Q6RA 2JG2A 3PDXA 1R23A 2VOPA 3F23A 2Z99A 1KQ8A 5FD6A 3GVAA 2OKJA 5A2QK 2AY7A 2QQAA 3AELA 2CO5A 1HKTA 1AY5A 2ESHA 1S0AA 1YAAA 3GZDA 3ZMZA 5L3BA 1CS1A 2CFXA 3BJ6A 3MC6A 1MAQA 1MGTA 2ZXJA 1D7VA 1ZG3A 2VGSA 3GSBA 1D5VA 3M1EA 4J5UA 3ASAA 3BWNC 2HTSA 4XJPA 2DFIA 1FG3A 4A0RA 1RV3A 3UWCA 3ASBA 3A9ZA 2XAQA 2BI1A 4WD2A 2EJRA 2GB3A 2ZSLA 1L3LA 1WYTA 1R5HA 4OIPF 2JZYA 4I7HA 2P8TA 1IF1A 4EM2A 4BQ0A 1C4KA 2YKYA 1UFMA 2W7IA 1FWZA 1B9NA 2VBWA 2CWEA 2FM1A 4L18B 1M7YA 1DPRA 1FYKA 2VGZA 2O03A 4G7HF 2DOUA 4F5LA 1I48A 3I5TA 3HBXA 1UHMA 2VMRA 2EZ2A 4GEBA 1ONVA 3MFKA 2H94A 2Y48A 3VOEA 5J6XA 1N31A 3I53A 2X4HA 3LAJA 1IUGA 3GFMA 1UKJA 4MSOA 3F8NA 5M4DA 1ASCA 5E1ZB 3ECOA 4HAMA 1HW2A 4LD5A 4BHCA 3R4KA 4UV9A 3ZRPA 1SD5A 5G09A 4JEXA 2VXZA 3S2WA 1TATA 1L0OC 4Y0DA 5AIPA 2QBYA 4MY5A 3FZ7A 3KP5A 4ASNA 2UWMA 4GXOA 2NMPA 4H51A 2G7HA 1YS6A 1FSHA 1REPC 1BJWA 5EAVA 2W7DA 3MZYA 3Q9VA 4F7ZA 1EQBA 4EJOA 3LA2A 1RUOA 3HHHA 4MQ9F 1LDJA 3HRSA 3TO9A 1BJOB 1ZARA 2QBTA 1TW3A 2ZJGA 1MJAA 4JE5D 1D2FA 2Y75A 2EA4A 1AKBA 4R8HA 1QQIA 4M9ZA 4I2OA 2XGXA 1IN5A 2LKPA 3A9XA 3CTAA 5DD4A 3EZSA 4UQVA 1EV7A 3O3KA 1F9NA 3MAFA 5F9SA 2ZMEA 3LG0A 3G3ZA 2JT1A 1B1BA 4QLCU 9AATA 4ZZLA 3GUDA 2FBKA 4BAYA 1MLZA 5FB2A 1DP7P 2AXLA 2EFOA 4KNYA 4IXZA 4EGYA 4UV8A 1R1UA 4BHPA 3E6GA 1Q1HA 5LBQA 1PP8F 2AY3A 2JJEA 4RGUA 3U9GA 4WCGA 4GSAA 3E2YA 4OOIA 1AHYA 4W1WA 2YRRA 2R5CA 4UHNA 3TFUA 2K7LA 4M9XA 5J8FA 3MBBA 5EUDA 1OYYA 4OINF 1IRFA 3PD6B 3TQXA 4WB0A 2XBNA 1K78A 1D8KA 2IW5A 3LWFA 1F4KA 1LB2A 2M5WA 4Y0HA 4KN4X 4EFFA 2VMQA 3NNKA 2W8VA 3PPLA 5EUNA 3COAC 3JAMZ 4GGGA 1YTYA 3QPHA 1I1SA 1ZYRF 2YRIA 1GEYA 3AEMA 2VMWA 3PAAA 1B59A 3WTWC 1WKGA 2X5FA 3TOBA 1I27A 1OMIA 5HS9A 1XGNA 1ZOBA 1MKMA 4XRFA 1V3FA 4KYWA 3GXOA 1O3RA 3PGYA 1YG2A 1M0QA 5E8IA 3AOWA 1WKMA 3FXUA 3KZZA 4R1HA 4RJYA 4MTDA 4ZLVA 5DB5A 1LEAA 1ZG1A 2NRAC 3DV8A 5JI6A 3QN6A 4RB0A 1P6RA 5HS7A 4IRGA 2DTRA 4AZJA 4ZZDA 2OZUA 3K1PA 2Z9XA 3JW4A 1BT4A 4I09A 1D7UA 4R8DA 2STWA 2YCTA 2EPJA 2VGVA 4RKDA 2WK9A 5F8VA 3LVLB 1XSDA 1V2DA 2HGCA 4MQRA 3AV7A 5FLXZ 1IN6A 4HOBA 5LHIA 4JEYA 2EFPA 2ZSMA 4EMSA 4HBLA 5I92A 3V7SA 3SFZA 4KIBA 5HOOA 1E2XA 2W7JA 3EI6A 1CL2A 1S7AA 1I1GA 1DUXC 1KA8A 1MDMA 2BWPA 2HS5A 3RI6A 2FMLA 3FZVA 4IHSA 2W7KA 2ISZA 1M0PA 1CL1A 3BCAA 4YIIA 5DCFA 2PB2A 3V8JA 3NDNA 4M73A 2RKHA 2VLFA 2BE5F 5F1RA 3K1NA 1IN4A 2BI9A 4G6DA 4FT8A 4OTLA 4E3QA 3CQ6A 3F6OA 2HEOA 2DGMA 3L8AA 5EIGA 3K0LA 3P7NA 1GBNA 2DGKA 1UU0A 5LHGA 3AOVA 1M0OA 4IRHA 1BS0A 2FU4A 1ARHA 3GBXA 1RUNA 1ARTA 4TN4A 3CDHA 2ZCWA 3PDBA 2CG4A 1SFXA 3LVJA 2XASA 3IKVA 3E2FA 2DPUA 3CUOA 3JWAA 3MADA 1TOIA 3PD6A 3O6BB 3E5XA 1BJAA 4BHBA 5E20A 4WP0A 3HSFA 4JF0A 1Z05A 2EK5A 2IT0A 3RKYA 4OBUA 2OQRA 4UOYA 3R4TA 4CXQA 3H3UA 3WGHA 1OYWA 4EJUA 3W1HA 1P4WA 1GHCA 5JVTA 2L02A 5FFXA 2FF4A 3FZ8A 2NNNA 2MA3A 3E77A 2OU2A 4ZAHA 1UHWA 3W1IA 4IX8A 3IRRA 4WYCA 1E5FA 1ASFA 1YJSA 5ERIA 3NTJA 2HQNA 4UVBA 4RLGA 4IYOB 1T39A 5D5UB 2HORA 2DK5A 1U5TB 3WTXC 2COMA 1KGSA 3KZYA 1GEWA 2ZYJA 3GEZA 3TO6A 2RVCA 1VP4A 5A2QZ 3CUQC 2E54A 2V79A 1UU2A 2DKJA 5D5XB 3FF5A 1QITA 1TOJA 3K7YA 4ZM3A 4Y0IA 1KU2A 2IP2A 4I02A 1I29A 4WK8F 3NYTA 2M87A 2W25A 5M46A 4U0YA 1ON2A 1B9MA 4F5JA 3R60A 3I5UA 5DJ9A 3DP7A 1DJ9A 5EFSA 1SD6A 3ABTA 2GA1A 2KIMA 3IF2A 4AVPA 1YLFA 1QPMA 4L9VA 2EA2A 5D4RA 1QGPA 1WYUA 5LGTA 3FFRA 4WYEA 5K1YA 3FMSA 1SMTA 1U78A 4QGRA 4E1OA 1U3EM 1LJ9A 2IA2A 4ZSWA 2FNPA 4BXUA 4ITXA 2CY8A 1ASLA 2HR3A 3B1DA 4Q47A 3GR9A 1PUEE 1X29A 2QQ9A 4L5JA 3ZRRA 1W7LA 4DNCA 3J81Z 4UVCA 2L4MA 3LQRA 4HDVA 1YOOA 3DXJF 2VMVA 3LVMA 5DX5A 3FXRA 3T1BA 3HL2A 1FBQA 2HKOA 1JXSA 1LEBA 1HQCA 1FBUA 2CQKA 2XRNA 2CTZA 1PP7U 2YCPA 2Z9VA 2D65A 4IF4A 4OMZA 5F6FA 3WGBA 1RVYA 3TKYA 2CJGA 5FT6A 2UZKA 3NRVA 3QM2A 3KP6A 3AEPA 1XGSA 2XKPA 3EYIA 2H27A 3D6KA 1QIRA 2A3SA 1GD9A 3FXQA 2D5YA 2DLLA 1AMRA 1M4NA 4AIKA 2DW4A 2ZUKA 3GF2A 2WWYA 3QU3A 5D5VB 4A12A 1B4XA 3F9TA 5D5WB 4MTEA 3GZ5A 1V2EA 2DI3A 2P7VB 4ZYEA 1W4MA 1KMJA 1QISA 1FY7A 1Y4IA 4DBCA 4MKKA 3CBFA 3W6KB 2OATA 2W8UA 2B0LA 3C1DA 4HX7A 1YS7A 4XBFA 3JWBA 1ULYA 2DQLA 4DQ6A 1KL2A 2VIAA 4K2BA 1AHFA 3H7FA 5LEKA 2IVMA 3V8KA 2R7FA 4F5MA 2BIEA 4E3RA 3IKTA 4R2NA 4ZYHA 3A8UX 4ZSYA 3ROUA 2QLZA 3BJAA 2VMOA 1XD7A 3ISLA 1KMKA 2EWNA 2YSRA 2D7YA 3PJ0A 5BPDA 3F21A 3WLXA 3HUGA 3QRFF 4PGGA 3LSTA 1N8PA 3RCHA 2DBBA 2GXGA 1R00A 2VMYA 1AMSA 4RS8A 4A6UA 3QP6A 4KICA 2LSOA 1MD0A 4OIRF 1ZRCA 1WQ2A 4ZDPA 2XUBA 3FHZA 4LK0F 1ZODA 1BJOA 3FDBA 3JTHA 1OHWA 1SPAA 1M0NA 4EV0A 3HRTA 1FNNA 4NQWA 2P6TA 5J8CA 5JHUA 3LA3A 2W8WA 1WKHA 4EB7A 1IBJA 5ED4A 1BI1A 3D5LA 2V1DA 3VK3A 4WYFA 1QNTA 1FBSA 1KU9A 1EH6A 3M9AA 4M2JA 4U1TA 2PO3A 3H14A 2ZFWA 4M9SA 1BKGA 3WCNA 4NHJA 5HS8A 3BDDA 3RTRA 4L0OA 5KK1A 5E4ZA 5CVVA 4IHTA 3W6JB 1O57A 3HQTA 1XGMA 4KDPA 3COGA 1UB9A 3F8FA 2CYYA 1OPCA 4EM1A 4PFNA 2ETHA 3KP3A 2BHXA 3MAUA 4W8IA 3H3ZA 1BN5A 3MAFB 3L44A 3HOTA 2X3LA 1K7AA 3IHJA 2ACJA 1JGSA 3IL2A 2P5KA 3TATA 2XV4S 1W5SA 2WTEA 3JZLA 2V1PA 3DXWA 1XDSA 4ZWMA 2O61A 3QI6A 2BEOA 2Q0OA 3QAHA 1DKAA 2TDXA 4IJAA 3RCHB 2F5CA 3GLXA 3ZN0A 4RGSA 3GJUA 1G3YA 1AICA 4HX4A 3WG9A 3RKXA 4U7DA 1QGNA 1CF7B 1GC0A 2VODA 5TJJA 1XCBA 1Z7DA 3SXYA 3BWNA 1XSVA 1G7XA 4WYDA 3HHGA 5DCMB 3ZMTA 4UUVA 4M2KA 5HDMA 1OHVA 2DQRA 3B02A 4HDUA 2GQNA 3E5UA 4B09A 1X28A 4F4EA 1AY8A 4GCVA 4RB1A 5BOXA 5D4SA 2IRFG 1G4VA 1K6OA 5C6UA 5L3FA 3VAXA 1I41A 2JRTA 4ZH4F 4WLHA 1ODDA 4RJ0A 2GXBA 3KP4A 4ZDOA 2CH1A 4U0WA 2YKVA 2JPCA 4CBSA 3G8MA 4IYOA 2O0RA 1O61A 5DYMA 3E9KA 4YIFA 2K27A 3E5QA 1S7OA 4PDKA 4R5FA 4UHTA 3FQ7A 4Z2YA 4JK1X 4LB6B 3F8MA 2O1BA 2QZ8A 4UHOA 3DXVA 1T98A 4B98A 3C3WA 2BYLA 1YQAA 2HKXA 4S04A 1R36A 4IVNA 4RITA 4XQ2A 3SQNA 1S8NA 2HYGD 5BJ4A 3WTVC 3RI4A 1O7LA 2F2EA 4FFCA 3JTGA 2JJFA 1AJSB 1Z7UA 1ASDA 1LK9A 2ZP7A 3ZN1A 4HF0A 4TV7A 3KLNA 2FN6A 3CQ4A 3WY7A 1CGPA 4ADEA 4KN7X 4ISYA 3TDUC 2X0LA 2O3FA 4CGZA 1X3UA 4WWCA 5D95A 5LRSA 3BROA 5DUIA 4LK1F 5D6EA 3ZRQA 2ZO4A 2PN6A 4AO9A 4FX0A 5TRDA 1OHYA 2R5CB 3JSPA 2YKXA 5CVIA 3L00A 2C81A 2HP2A 2PEXA 5G2PA 1BI2A 1LQ1A 2QENA 1FSEA 1DTYA 2H6BA 4IW7A 4LGWA 2Z33A 1ZH5A 1SFFA 3BB8A 4PCQA 1HSJA 3C7JA 1F1ZA 2HFHA 1YNUA 1BC8C 5JFRA 1MDMB 2G6WA 5HHYA 3TCMA 1RIOH 3DPLC 5D8LB 1IAYA 2ZJ2A 3B1CA 1SD4A 1O3SA 2BWOA 1CF7A 1UCRA 1D7SA 3EETA 3DR4A 2RV8A 4ESFA 2BGCA 3N0LA 1WI9A 1OATA 1C7OA 1PMMA 3BP8A 1BBYA 3LA7A 2GIVA 3GWPA 1W7NA 3AAFA 1IN8A 2PBIA 5BQTA 1YIOA 2M30A 1W7PA 1BJNA 1AHEA 2D7ZA 3G73A 2MH9A 3HYIA 4OIOF 2AY4A 1TQMA 2VONA 1BM9A 2HZPA 1W5TA 3WE3A 2W57A 1OXPA 1B6AA 1D8JA 3AATA 3UAKA 3JW9A 3LVKA 3ERED 3JAMK 1ASBA 2KKOA 4JQFA 3J7AO 2W7HA 2FQ6A 3PFIA 1YW9A 3N75A 3QOPA 4MEXF 1GEXA 1BC7C 4KIFA 4PFFA 4ON0A 2R2NA 3RJPA 3KLOA 1LS3A 4LJZF 4P7YA 2AY9A 1RNLA 2VMPA 3BN1A 3RDIA 4P3MA 4LLNA 4EJWA 3Q5FA 3GZDC 1ASMA 3VK4A 1J0RA 4XEWA 2W8TA 2BYVE 1K79A 5G4IA 3ACZA 1U5TA 1KKPA 5LEJA 1SZUA 1EH8A 1RVUA 1YW8A 4F5FA 3UE8A 2K4BA 2FA5A 3OP7A 1AAMA 3WCOA 2DK8A 2E1CA 4WB0B 3PA9A 1S6LA 2F5FA 3OV8A 1TLHB 3R9AA 3MWMA 4GE4A 2D64A 2Z61A 1Z91A 4YFKF 3PIUA 3WKSA 3K9TA 3HMUA 1DGEA 4P5OA 3GFLA 2EV5A 1YO5C 4WXBA 1SFEA 1XGOA 2UXXA 4EJTA 3I4PA 2WKAA 3TQNA 2LDUA 1I43A 5G2QA 2FE3A 4A0ZA 1MDXA 5D5SA 4N0WA 1QO0D 4IRIA 1I6XA 1ZREA 1OR7A 2NNYA 3MC6C 1J75A 4G7ZF 1S08A 2O7CA 4HX8A 5AX8A 2AATA 3FMQA 1J32A 3NYUA 4J8LA 2BIGA 5LLQA 3SHFA 3CUQA 1PMOA 3USFA 4EM0B 5HDKA 4PIWA 1TBXA 3OKSA 2IJLA 4IXSA 4JEZA 2MBFA 5EEGA 3QP5A 1BOAA 4HF8A 4OBVA 4NB5A 3RYRA 4LNJA 5DDGA 1AX4A 5E17F 1TOGA 1R22A 1J9IA 4BH9A 1AMQA 1C0WA 3A9YA 1IJIA 4WX9A 2AY2A 4MNUA 5KVRA 3BC8A 3WGGA 1H1CA 3WGIA 2VGTA 3EYYA 3GX4X 1CZCA 3JTXA 2J5OA 4HQEA
chains in the Genus database with same CATH superfamily
3QPGA 2IA1A 3G6EI 1F36A 1T38A 3BCXA 4AYBN 4B4CA 4FQGA 4BDZA 3P9CA 2HP1A 4A93J 1HKQA 2CW0F 2FUG2 1IGNA 1DGWY 5EZHA 4ZM4A 3HDOA 3IWFA 4ADDA 2VMTA 2QSFX 1ETXA 3DEUA 1AHDP 2EB7A 3CCMI 4E7JA 4XKCA 1W3UA 2XKOA 3S3OA 1USTA 2L01A 3W3CA 2ZJPF 1OKRA 4WYAA 4Q4ZF 1MMSA 1WCMJ 2L9NA 2XROA 5E79C 4A2UA 4P9UA 1WPKA 3VODA 2HWVA 2WAFA 3JRAA 1OCPA 1ON1A 2VJJA 3FRKA 1RKTA 2LOOA 2MC4A 3CCRI 3W1JA 3OIPA 3BR1A 3L9FA 5AONA 3RYPA 4CDGA 1UAAA 4LLGF 1SZKA 3CZ6A 2CS3A 3J81K 4LG0B 1GCKA 3II0A 4XN3A 2HUUA 1SD7A 1HXDA 3GZCA 4KA4A 2HQRA 1RV4A 1K78B 1AHGA 3EUCA 1G4DA 1BIBA 4Q48A 2HYJA 2HOEA 4UHMA 4F5IA 4XJOA 5D6FA 3H35A 2PX9A 3V7RA 1O3TA 1FX7A 1ERDA 3GTPJ 1U5TC 2BY0A 1R1VA 2JGTA 1GVJA 1XMKA 3ZQQA 1ETYA 1MBFA 3HVYA 3LY1A 2CU7A 2Q7WA 2KJBA 4LC3A 1S9HA 2OGAA 4NQWB 5F64A 1TTYA 4GDFA 4LOCA 5IOYA 3M5UA 2E7WA 2P5LC 4BXXJ 4CCLA 3J80K 1NHAA 1R5ID 1X0MA 4LNLA 1H9GA 2L9SA 4IKFA 3RPUA 4WXDA 1TW2A 2VKEA 1ARSA 4RIZA 4PJNA 4KIGA 3J80Z 3NUBA 4FTHA 4A3JJ 1BL0A 2W7FA 2XHKA 1YJWI 3HC7A 3VB2A 4ZDLA 4ENNA 1R5GA 2BI3A 3WHBA 1I5ZA 4I99C 4W91A 5GAGJ 3K69A 1TNTA 2DFHA 2HOXA 1IXRC 3KKIA 3EDPA 1FIAA 3L09A 3EI9A 2GWRA 2XAFA 3IV5A 1X58A 4XK4A 1XEYA 2HVRA 3NUIA 4YEJA 1BJ4A 2D1HA 2VMUA 2W84A 2W85A 4OU0A 4PVFA 1HBXG 3BTJA 1HDPA 1LKXA 2LF7A 4H0EA 5H20A 1T33A 3NU8A 2KRFA 1TNSA 2CQQA 2HUFA 4W1XA 3L2CA 3VP6A 1N77A 1TPLA 5IT3A 1S7EA 2EH6A 1R6RA 4AIDA 3FD0A 1B72A 3W6VA 5BPIA 2X6YA 3KEQA 4BJTA 5E3KA 1W7MA 3G1MA 3E6DA 5M3MJ 1MBHA 4M3DA 4KMUX 2DOFA 2GOXB 3GYHX 4ENKA 4F5GA 3LMMA 3GWZA 1B9HA 4CHUA 3OOUA 2WAEA 2PQ8A 4XOPA 1TP4A 4XIDA 3S2HJ 4GYIA 1MMNA 2Y0SA 3DBHB 3MCZA 5CYVA 4DYQA 1KKJA 3DC1A 4L9TA 1LW4A 2F5DA 3FMRA 3K4MA 3DF8A 5FROA 5E18F 5HVQC 1S5LC 3IC7A 1IAWA 1LW5A 3VYRB 1LC7A 3JCUC 1H0MA 2DTZA 1WYVB 3U2RA 4CBRA 3FZ6A 3AG2H 3I59B 2LY2A 3EI5A 4A6DA 4N9HA 1U8BA 2Y69H 2LMDA 4MQVA 4GE9A 3B73A 3RBFA 3N97A 3N05A 1R7JA 2E7IA 3DPUA 3PGYA 4YFNF 2D63A 1N78A 3DQVC 2AXTC 2X5DA 3QPTA 1AU7A 2YU9J 2JPBA 3R0JA 3ABKH 2W8JA 3GTMJ 4S0HB 2RAEA 1FG7A 3BG5A 3CCUI 4AD9A 1DQUA 4BY1J 2KIFA 1GXQA 4BQAA 1LC8A 2M45A 3MQ0A 4B3AA 3A1YA 1DJUA 1VQ5I 3ZQLA 1BW5A 3CJRB 1BIAA 2QCOA 2MFZA 4O6ZA 3AG3H 3SEQA 1XB4A 3MVPA 5CVUA 4BQNA 1YIZA 3RIRA 3OIOA 2ZXIA 3BZCA 3TOAA 2G9WA 3EPZA 3WKRA 5EG0B 1Z6RA 1LC5A 4P9FA 3VEPA 2Q2EA 2VE8A 4KMFA 3VFZA 1HKSA 1E3OC 2ZKZA 2QBYB 2GZWA 4IQJA 2KZVA 4D0PA 2LF8A 1LFPA 1J2XA 3PNTA 5BJ3A 2PJPA 1TWHJ 4E77A 2Q2EB 4ESBA 1V5EA 2I5UA 3DCFA 4BBSJ 1ZLJA 3BZ6A 2C6YA 1PJRA 3C2GA 2JTVA 3PO3J 4G6QA 4LLLA 2PMHA 4RM3A 3FK7A 1SVVA 2Y9ZA 3DEEA 3RKWA 4CSWA 1ZRFA 4J01A 5K5QA 2D2WA 5HLHA 2CUJA 4JE5A 1H88C 2FNAA 4NC6A 2O8XA 3HZJA 3KE2A 2NVUB 2YU3A 5IYBJ 1AIAA 1YIYA 5ILUA 1MJ9A 2CH2A 4KAMA 1QZYA 4ATQA 4HZFA 1S07A 2YS9A 2RFVA 1FP1D 2JVHA 3PIOF 2M4KA 4ABZA 1TASA 2FOKA 1JUMA 4HV5A 3FK6A 3B1EA 1CQ7A 2EINH 1IN7A 1BR1A 4ZASA 1IZ1A 2KRHA 3R61A 3BWOA 3ELEA 3F8BA 2I8DA 3PQJA 2KZGA 3LSMA 1GXPA 1T3IA 2F8JA 5GPAA 1X3ZB 2FBIA 1WSUA 2F48A 9ANTA 1FYLA 4ITGA 2FYFA 2XVCA 4NBQA 1R58A 4U88A 4ETSA 4MLOA 4WF2A 1IX7A 3EUKL 5EUDA 3N4MA 3RZOJ 4A3CJ 1RZ4A 1QZ9A 3EIBA 5E3LA 2JVGA 5F0CA 2F4MB 1GC4A 2ZC0A 1H8AC 1AJSA 4A3EJ 2STTA 1DDNA 1KQ0A 1U08A 3CLOA 4V2FA 3ZMDA 3LSPA 1JKQC 2FBHA 4V19K 3ECDA 3GTQJ 5FLXK 1QZZA 4OIQF 1FC4A 2R5YA 5KHDA 2FNUA 4D5CA 3DODA 2RNGA 2VN2A 3BG3A 3H0DA 3F22A 4MQQA 3ZMVA 1Z7LA 4AU7A 3GETA 4N9IA 4ADBA 3IWZA 3I4NJ 2YKUA 2QQBA 2VIBA 4DYCA 4AO4A 2EZLA 5D8KB 5J47A 4XAUA 1JG8A 2QGUA 3NYSA 2HZTA 2W24A 1AMAA 1VQMI 2QB2A 3B8XA 3VSKA 4U2HA 3BG9A 2UXNA 1CQ6A 3EIAA 4HLXA 1X2NA 1X2MA 5FLMJ 1RETA 4B48A 3K40A 3LSKA 4XN0A 4J00A 4I0AA 1E17A 3H5NA 1NTCA 1SAXA 3M8FA 3AEOA 1FC3A 4DZJA 3E3VA 5KAFC 4KUMA 2RNJA 3BQYA 2AEVA 2JK3A 1MAPA 3Q0UA 2YR2A 1K61A 2JJHA 3MKZA 2FMYA 3GO5A 1Z3YA 2Z3YA 3DFGA 1W23A 2A6HF 4Y17A 3GZNB 4JEVA 4HQMA 1M32A 4C2MJ 3ATHA 5B1AH 4RDUA 1HSTA 2PFBA 3FFHA 1QVTA 3QODA 1BQDA 3BCBA 1C9CA 1U0JA 3ZQ7A 1S29A 4CXFA 2BBYA 5DCMA 1OXOA 3NU7A 5LHAA 1Z6TA 2B7EA 3I64A 5ICEA 5B3SH 2DU9A 4G9YA 5DM6F 3WU1B 1X19A 4ITVA 3RQ4A 4F91B 1D1CA 2O0YA 2WK7A 4ESJA 2OGEA 3I4JA 1P2FA 4XL9A 2IPQX 2Y0MA 3KYLA 2JA7J 1JS6A 3M3YJ 2LTPA 4IPAA 3CAIA 5GTHC 2HDCA 4I8AA 1IO2A 3BS8A 2ICWG 2L9VA 5FT5A 1U2WA 2ELKA 1IRGA 3KGXA 5H6QA 4OT8A 3ELPA 3PDBB 4FX4A 4L0YB 2Z1ZA 4I01A 3MEBA 4LG0A 3WX9A 2XSDC 4F93B 2E2HJ 1QJ3A 5C3EJ 1YJNI 4PGHA 3BT9A 1VQ8I 5ILSA 5J40A 5HNHA 2VGUA 2VE9A 1Y0UA 1T6SA 1FTZA 5LH9A 2DPDA 1W7PB 3CO7C 2VI9A 3PIPF 1R9TJ 1XTAA 5M4BA 4Y15A 4GDYA 2L3DA 3ASOH 1BW0A 5H6RA 3A2BA 1DFOA 3BOQA 5IY5H 4GRXA 5M3FJ 1BI3A 1DGDA 1QJ5A 1SVMA 3TDZC 4XLEA 4UNOA 1U8RA 3FDYA 1NK3P 3CUQB 2ID3A 1XCVA 5FKLA 4K2EA 2L4AA 1SFUA 2VQLA 3M8EA 3WGCA 5GADJ 4C30A 2V1XA 3VOMA 4OAZA 1Y6IA 3S8PA 5L3EA 2P6SA 5EYRA 2IGOA 4RGRA 2CW8A 3V7CA 5K5RA 2DKBA 1WJFA 1GVDA 2VJIA 4A5NA 1IX8A 4BGDA 5K7ZA 3U1DA 2ZNZA 4MIMA 3A01B 1SANA 1W1WE 4D7MA 1KL1A 1WYTB 1WVRA 1KQ9A 3CD6I 2M7AA 3F3XA 2WV0A 1TQIA 2ELHA 3ZGKA 2O8KA 4KFCA 2V6CA 3BZKA 1TT0A 2XF6A 3BY6A 1B5PA 3HTSB 2OUMA 3V4GA 4C2TA 2V9PA 3FVSA 3M7GA 2GM4A 2NS0A 3O8GA 2OJED 1VJOA 4A0YA 3K1MA 1AHXA 5LGUA 3FTBA 1QVUA 4TMRA 1MZBA 1RI7A 4Y33A 1TARA 4ATPA 4AH3A 2EFNA 5K8BA 3J7YJ 2CJHA 4OC9A 4XLPF 5F27A 4KT5C 2ID6A 1WRJA 4A6RA 4GYGA 3R6SA 4UUSB 2WB1A 2K9MA 2CB1A 1OQYA 4CICA 5FJ8J 2O6GE 4U0VA 5DEQA 2A68F 5M49A 3MEXA 1IRZA 1WSTA 3HT4A 4DJAA 2UV1A 4A6TA 2HTJA 4MKJA 1ZG5A 1NH3A 4P55A 1ZAOA 3LFKA 2ESNA 4EGZA 1A36A 2E1NA 4C3JJ 1CZEA 1UU1A 3L7WA 4FE7A 1N25A 3ZPLA 2VT3A 4L9NA 4MEYF 5FT4A 2EV6A 1IX6A 2OTJI 1JKRC 4CXRA 3HOYJ 5G0AA 3F72A 4A0FA 3FXJA 4WBTA 3F8CA 2R7WA 2VMNA 2UUZA 3ABMH 1A04A 3SEZA 4HV6A 5L3GA 3BTIA 2QUFA 3JU7A 2WADA 2JISA 4WXFA 1LVAA 1M1EB 3IRQA 5CLSA 2K02A 2RC4A 3WTYC 1G3TA 1SFKA 3DKXA 3A01A 3HSRA 2P4WA 3H9GA 1JTXA 3R0AA 3MN2A 1ZHFA 5FO5A 3T8RA 1WJDA 2VC0A 4C9YA 4K2MA 2EO5A 3PJRA 2JRMA 4Y13A 2EIMH 3AENA 1YJYA 2QM3A 2BXZA 3AG4H 3CLQA 1DJEA 1TWCJ 2YX7A 2XH1A 4IY7A 4XNFA 1FPQA 2Z5UA 2OD5A 3BR3A 1TWFJ 3DKWA 3GZ6A 1G2HA 2XGEA 3DLAA 3FSLA 2GMSA 3NEUA 3HGGA 1IXSB 2L54A 2Z1DA 3QBOA 2MGQA 1X1DA 4CCNA 1C0NA 1G6NA 2R7QA 3LV2A 2E1OA 2YPRA 4JX5A 4AWXB 4RKCA 3GTOJ 4CZZA 1EJIA 2EZ1A 4E4HA 5M5XJ 4LG3A 4QPQA 3EZ1A 4IXAA 4CYCB 1AJRA 3L2VA 2NYXA 4A5MA 3UNGC 1CJ0A 2R3SA 2R7VA 2Y31A 3IUOA 1ZGJA 3ZMUA 2Q8KA 2KJCA 2RREA 4M6YA 2EFWA 4IHVA 1OCCH 2OQGA 3ABUA 5H2FC 5HLTA 2Z9UA 4RB3C 2TPLA 4GE7A 1YW7A 4FL0A 2X1CA 5E1WA 1OCRH 2FXAA 2Z1YA 3JRGA 4M2MA 3BG7A 3K2ZA 2AY5A 3OS1A 3QOEA 1FOXA 2Y0SN 3ZQHA 1XI9A 4LW2A 4YFXF 1W0TA 3WODF 1SZSA 5IT9K 3HIFA 5KNLA 3CCQI 4JF1A 1ELQA 1YOVB 2PI0A 1P92A 4UVAA 2FQ3A 4YRVA 1B72B 2E7UA 3IHUA 2OCEA 3V42A 4W1UA 1JJ8C 2BI2A 2FOWA 3FM3A 1J59A 3N5MA 4O6JA 3HTUA 1TWGJ 3QPSA 4BA4A 4F5KA 4ZWVA 3MKWB 1ZGAA 3TFTA 4HW0A 1MJBA 4WXHA 1E5EA 1BR4A 3I58A 2WAQN 3BJOA 1ASGA 4L9JA 4UXNA 3PUBA 5IYCJ 3GW2A 1CQ8A 4MQPA 1Y1WJ 3ZZJA 2DCEA 2M7BA 4A0GA 2OA4A 4HF2A 1YJZA 3FKJA 1SVLA 2TRTA 3H0GJ 4P96A 3TGNA 2A6TA 5ICCA 4AIJA 3E6BA 2AS5F 2C0RA 4KXKA 2IA0A 4QIWN 2K4JA 3W2WA 4HLYA 2QLRA 1F5TA 3RQ1A 3FQ8A 1TC3C 2V1UA 4E70A 2W7GA 3KEYA 2VBXA 1AWCA 3FKDA 3LSGA 4RAGA 3OMYA 3EI8A 1KYZA 1ARGA 2R0TA 4IXOA 1R49A 3DRDA 2BVLA 4DOZA 1ZR2A 2GMUA 4NUBA 1TOKA 5EEHA 1T2KA 2A07F 4HF1A 1T0FA 3AEJC 3NWTA 2QKLB 5GTIC 4BYYA 3P5JA 1D3YA 2P0WA 1ZGWA 2N8GA 4R79A 2H6CA 2XAUA 3PM1A 2GLOA 3RSNA 1J04A 3AEMC 2M1BA 4RAYA 5ICGA 2RDPA 3V8LA 4W5KA 3AENB 1MDZA 3DU4A 1G3SA 3QU6A 2YCNA 2QVOA 3I71A 3KETA 2KIUA 2OAZA 2VMXA 2HZDA 1FLIA 3KFWX 1GC3A 2VASA 2R0QC 1H0CA 3AEJA 3E2ZB 1VZ0A 1FOYA 1JHHA 2DODA 4HA8A 1IXCA 5C4XJ 2CINA 2QQ8A 3NRAA 2K3PA 2DR1A 4S05A 3E6CC 5HLIA 4YELA 1JI8A 2LKSA 1AKHB 2ZB9A 2VQHA 2GXAA 3KP7A 3MKJA 1P7IA 3G1LA 3K28A 3H1CA 1JF9A 4RB2C 4EB5A 3E2ZA 2AY8A 2W7EA 1AKAA 2BVMA 2JA8J 1XSXA 3DBLB 5LRRA 3LWSA 2OBPA 1HF0A 4XLNF 2CQ7A 4QWQA 3E97A 1FZPB 2P7CB 3VYUB 3DZZA 2D66A 5TF5A 1AY4A 4M6XA 3G7QA 4JBAA 3ZQFA 1P7JA 2E7XA 4L0ZB 3DBRB 2BI5A 4AOAA 4XOTA 5HXXA 3DPTA 2HNHA 4M71A 4XLFA 4GFBA 5ILVA 1B4AA 3GFIA 2OKKA 3OYHA 1EKEA 4IX7A 2DO7A 2R7DA 1CQTA 5LHHA 1WWXA 3JRCA 1YX3A 2VYCA 2J5PA 2XB0X 2EZHA 4XKVA 2QMAA 5IWQA 1ORDA 1JKPC 3FVXA 4RGXA 1VTNC 1VFCA 2WY8Q 4FETA 3KP2A 3F6TA 1TOEA 1XMAA 2F5EA 2V9VA 2C44A 5G4JA 3RKQA 2HOTA 2VOOA 2C7TA 2VT2A 2VLHA 2IGNA 4Y4RA 1G3WA 1O4SA 3P6KA 2M8EA 3KYDB 4YG2F 5E1XA 1ZC9A 5E8GA 2ISYA 2V4JC 3M1CA 4B47A 1ZKGA 2VIXA 4RAFA 1V4RA 3ZCOA 3I16A 5BMZA 3BV0A 2K9QA 2ZBKA 3MKLA 4CCMA 2HOYA 2EIJH 3AFHA 3H92A 4BE1A 2G7UA 1XN7A 1HW5A 4IZZA 1V72A 4XRMA 2EILH 1HLVA 4MGRA 3D5SC 2WK8A 3BR0A 4M74A 4BMKA 4EMYA 1LE8A 5ICFA 1MGVA 3ELKA 4RM1A 1GT0C 4OCAA 1JT0A 2VI8A 3OY9A 2OQXA 2YX4A 3WTTC 2WAQA 1IW7F 3EUHA 1LKCA 2NS8A 1BW6A 2VBZA 3BG6A 1PDNC 3DU5A 4M6VA 4ZTJA 1TQPA 3HLMA 3BQZA 1WYVA 1Z3ZA 2XAGA 4L5IA 3TP0A 3G1OA 1O7FA 5DS9A 2CUEA 3MMYB 2ORDA 1O3QA 2HQAA 2NVQJ 1X2AA 3SZPA 1B8IA 1FYMA 1ZRDA 5L3DA 1AKCA 1WYUB 3FQAA 3HOZJ 4RAEA 3REOA 5EJCA 1T8IA 5LGNA 4EQQA 8AATA 1ARIA 1X1AA 2CRGA 1JUPA 4ZYGA 2QKMB 2BV6A 2FRHA 2P81A 2WC2A 1B8GA 3TO7A 3QGUA 3RBLA 3O2PE 4CYCA 1V2FA 1MMAA 4B3XA 1MMGA 2E19A 2YHKA 1B5OA 3OR1C 1FP2A 3QYEA 2V0YA 2F5VA 1ASNA 3OOPA 5GPCA 2BYJA 3W2AA 2CGPA 3Q8NA 4XJLA 2AEUA 2GQQA 3ZP5A 1KU3A 4A00A 1OJLA 2H1KA 2HDDA 4EVIA 1R1TA 4XQFA 1P4XA 3JRDA 5JR3A 3CC2I 2QA3A 2Z67A 4CVQA 2A5YB 2GIZA 3CP2A 4HSRA 5HDGA 4ZYDA 4F55A 3P9IA 1W5CC 4RMNA 2AY6A 3DEWA 2LR8A 2EV0A 2NVYJ 4O5VA 4AIHA 1LNWA 3DU6A 4IOCF 1EG5A 3G4SI 2JJ7A 1LFBA 4E7HA 3CQ5A 3H5AA 3HPGA 2OZ6A 3F0CA 1C7GA 4OMYA 1IAXA 2DA1A 2Z9WA 2ZNYA 3KE3A 2PMUA 2A61A 3QHXA 2IS2A 2XAJA 4G12A 1IRXA 3OL4A 4WYGA 2JSCA 3H36A 1P4AA 2VBYA 1ELUA 1GC2A 5E5IA 2XSJC 5JAYA 4Q31A 3K4JA 1ZQ3P 2LP0A 2LY1A 2MLKA 2FSWA 1AIBA 5FKMA 3VDXA 1YYVA 2BXYA 1HDDC 2KIQA 2O9LA 4LMYA 1JT6A 3HOWJ 2H09A 2QWWA 1S3JA 3HOSA 1IUYA 1QHHD 3RPQA 1H9TA 3FISA 4WXCA 2X8UA 4GRIA 3DYDA 3ISPA 1ECXA 4KT6A 3HRMA 5CQEA 4W1VA 1M6SA 1Z9CA 1BI0A 1RKWA 1PVEA 3PQKA 1FT9A 3K70D 4WLJA 3HSEA 3WU0A 2JJGA 2MD5A 1G4XA 2VJ4A 2O5RA 4B8XA 4BY7J 4BXFA 3JRIA 1EH7A 4OMAA 3BWGA 2VKVA 2DMUA 2ZMEC 3OS2A 1ASAA 4AZKA 5E3MA 3OS0A 4IO9F 3KGWA 2K85A 3S93A 4B43A 4DGWB 3OYMA 3CCVI 2DA5A 1PUFA 2D5VA 5K5OA 2A6EF 2DA2A 5EUEA 2DJNA 4U7BA 4FASD 3S1NJ 1ETQA 2DFEA 1K83J 2XIGA 1AAWA 1J7KA 3LL7A 4MFDA 1IDZA 1VQLI 4M72A 1EA3A 1USSA 2HYFA 3BPXA 4HYEA 4QPOA 2BIAA 2DA4A 3K4NA 3WTSC 3I54A 4JEWA 1MDOA 1T0FC 2HDWA 4RAZA 3Q9SA 4Q5SF 4B9BA 2KDOA 1D7RA 2FNIA 5DV5A 4A3DJ 2KPMA 4R5ZA 2CFBA 4L5EA 5IP9J 4XJMA 3P9KA 1UG0A 4XSZF 4KYOA 2E71A 1NK2P 2PG4A 1IVRA 1XG1A 3U1KA 3WE2A 3ULQB 3E6MA 6PAXA 2NVTJ 3FVUA 2K86A 3EI7A 2VC1A 4A0HA 4PK4A 3DLLF 3FXOA 4PJJA 3CMAI 2XPWA 4BNCA 2LYCA 4I98B 5FD5A 4A72A 2FEZA 4PSXA 2GAUA 3I0TA 3ZMSA 2DFFA 4I76A 3T0YA 5IP6A 4HVKA 1Z1DA 3ECHA 3VSLA 2CSTA 5HLGA 1AOYA 1YE9A 2VGWA 3F0HA 5DM7F 4CYDA 4O3MA 4LFUA 1O69A 5BS6A 5AIQA 2PLYA 3F6VA 2LBFB 3TL4X 5GAHJ 4FHTA 1N2TA 3MAJA 4F5HA 4G94A 3QYFA 4IQ4A 3CO6C 1U6GA 7AATA 3NX3A 3CMMA 2RN7A 1ZLKA 2JUGA 3H3VK 1OYIA 2HOZA 4LW4A 2AY1A 1GDEA 2D61A 3HEFA 5FGMA 4G8XA 5EDNA 3LQQA 5B5EC 1BA5A 2GSAA 1W7PD 4XK1A 3VYTB 2VMSA 3WU2C 3NQOA 1SF2A 3LAPA 1MIJA 5EIGB 4LB5A 1VEFA 2OV7A 4MHGA 3WTZA 3DR7A 1B9IA 2X1EA 1ITYA 3Q0WA 2MLGA 1STZA 2JUCA 2MC3A 1FJLA 1LDDA 2ADUA 5CJ9A 2CW7A 4D7NA 4A6EA 4ENJA 1SMYF 5DJ1A 3JREA 1XDUA 1JE8A 2M4GA 4XONA 3OYDA 2GA2A 4FCYA 1SVOA 2K40A 2RGVA 2F4OB 3D0SA 5M5YJ 3G0TA 1Q1VA 4NOGA 3BPVA 4BA5A 3B6AA 1C7NA 4RM2A 1F43A 5L3CA 2CANA 2LD5A 2W7LA 2VL8A 5CVRA 1Z21A 4XSXF 1KYWA 5EZGA 2IS1A 3I59A 3QPLA 4RLQA 5DD8A 4OYTA 2HUIA 4M3BA 3T32A 4Q76A 1UG2A 4IHYA 4G7OF 5CVJA 2VMZA 3I55I 2DT5A 2VLAA 2A69F 3FWEA 5DUKA 5IP7J 1DU0A 3ABLH 1DPUA 2NAZA 2BWNA 4EJVA 1P3WA 4DBQA 3QYBA 3FCRA 5B66C 3ZZKA 1KU7A 1HC8A 1JS3A 2LNBA 3FX3A 3JSOA 2EGYA 3CF2A 3ZQIA 3S1QJ 1ASEA 5EQCA 4DQ2A 1ZN2A 2R5EA 5J8QA 3RUYA 2QB3A 4XORA 3CMEI 3CCSI 3FBIB 2D45A 3KCCA 1VQPI 2W7MA 1ETOA 2XAHA 3OIQA 4Q75A 2EBIA 1HW1A 1JHFA 2P5VA 4PZJA 4ZJZA 4N0BA 4DGTA 4BHDA 4QTRA 4K2IA 2ZC2A 3HRUA 5FFZA 2D1VA 3C18A 4I0BA 4GO1A 2CSOA 1MLYA 3GFJA 1FOKA 3B46A 2KDZA 2Q1ZB 1YFHA 1R71A 4C2UA 2X6XA 4X6AJ 1OCZH 4PUSA 1J5YA 1LDKB 4A0XA 3OYGA 1PFFA 1PG8A 2LFBA 3SFIA 3E1SA 4KYWA 2PB0A 2YOBA 2Z9OA 1O62A 3P1TA 5FKNA 4ENMA 1ACIA 2E7JA 2LLKA 2WA0A 4ZYAA 4A3FJ 3FM5A 3RCOA 2Z20A 2ZMEB 3IAS2 3K7AJ 3DKYA 4II3A 2DGLA 4WXGA 1J09A 2VI6A 3OR2C 3SZTA 2CJDA 2DAOA 2BKWA 2MH2A 2QYOA 5EAAA 3OYFA 3CJTB 1S09A 4CO8A 5FT8A 1S06A 3WZFA 4EU1A 4ZC3A 3EQLF 2RQPA 3WTUC 1BQAA 1G7WA 2EFQA 2XDVA 1ETKA 3TW6A 1QBJA 2M8GX 4LNMA 3KEOA 3TW7A 3MZHA 3T8TA 3OL3A 4ANJA 3VK2A 3T5XA 3J7ZI 3ML6A 2M0MA 3CJNA 5B1BH 5HDNA 4BJ6C 3IH3A 5IT9Z 3GTJJ 4Q6RA 4XKBA 2JG2A 3PDXA 2M2EA 2MYSA 1R23A 3B6CA 3Q0VA 4PFPA 2QEXI 2VOPA 3F23A 2Z99A 1KQ8A 1QPIA 1X1BA 3HBLA 3GVAA 5F08A 5FD6A 2ME6A 2OKJA 5A2QK 4CA0A 2AY7A 2QQAA 3AELA 5JLXA 2CO5A 3G2BA 1HKTA 1AY5A 2ESHA 1I3AA 1QRYA 1S0AA 3JR9A 1KZHA 3M8JA 1YAAA 2JMWA 3GZDA 3ZMZA 1QHGA 5L3BA 2ELJA 1CS1A 2CFXA 3BJ6A 1FIPA 3MC6A 2VKDA 3K6GA 1MGTA 1MAQA 2ZXJA 2OC6A 3MKYB 1D7VA 2KFDA 1ZG3A 2VGSA 2AHQA 3GSBA 1D5VA 3M1EA 4AVZA 4J5UA 1E0EA 3ASAA 2HTSA 4M3FA 3BWNC 2DFIA 1Y39A 1FG3A 1VQNI 4XJPA 4A0RA 1RV3A 3UWCA 3ASBA 1ZTRA 3A9ZA 5FKOA 3H5RA 2XAQA 2BI1A 4WD2A 2EJRA 2GB3A 2ZSLA 1L3LA 1WYTA 1R5HA 4OIPF 2JZYA 4I7HA 2P8TA 3S14J 1MNMC 1IF1A 2OTLI 4NC8A 4EM2A 1C4KA 2YKYA 4BQ0A 3KIOA 1UFMA 2W7IA 1FWZA 4NDLA 2NOJB 2HQ5A 1B9NA 4Y3OA 2VBWA 4B1RA 4DBRA 2CWEA 2CV2A 2FM1A 4L18B 1M7YA 1DPRA 1FYKA 2VGZA 3A0BC 2O03A 4G7HF 3QQAA 2DOUA 1I48A 4F5LA 2JSPA 3I5TA 3HBXA 1UHMA 4II2A 2VMRA 3S17J 2EZ2A 4GEBA 1ONVA 3MFKA 2H94A 2OCCH 2JQ7A 2Y48A 2WBMA 3VOEA 3RQIA 2JA2A 5J6XA 1YITI 1N31A 3I53A 4CUGA 2X4HA 3LAJA 1IUGA 3NWSA 1YRNB 3GFMA 1T08B 1UKJA 4MSOA 3F8NA 5M4DA 1WJAA 5E1ZB 1ASCA 3ECOA 4HAMA 1AA7A 1HW2A 5E3NA 4RBOA 4LD5A 4BHCA 3R4KA 4UV9A 3ZRPA 1I6HJ 1SD5A 5G09A 4JEXA 2VXZA 4Z6YA 3S2WA 1TATA 1S72I 4AYBA 2DYRH 1IC8A 1K6YA 2XRLA 5K7HA 3BR2A 3DTKA 1XC5A 1L0OC 4Y0DA 5AIPA 2QBYA 4MY5A 3FZ7A 3KP5A 4ASNA 2UWMA 4GXOA 2O7OA 2PJRB 2NMPA 1MH3A 1LVKA 4H51A 3KPHA 2G7HA 1YS6A 5IPAA 1FSHA 2R5ZA 2CFOA 5JHFA 1REPC 1BJWA 5EAVA 1TL8A 1WH5A 3HB9A 3QWLA 2W7DA 3MZYA 3Q9VA 4F7ZA 1EQBA 2X6WA 4EJOA 3LA2A 1RUOA 3HHHA 4MQ9F 1LDJA 3HRSA 3TO9A 1BJOB 2W82A 1ZARA 2VB6A 3O8HA 1QU3A 2QBTA 1TW3A 2ZJGA 1MJAA 2KQRA 2COBA 4JE5D 4NC7A 1D2FA 3OWTA 1X4OA 2EA4A 2Y75A 3IAM2 1AKBA 4NNJA 1A6QA 1QQIA 4R8HA 3S15J 2R7TA 1A35A 4M9ZA 4I2OA 2XGXA 1IN5A 2LKPA 3A9XA 3HUGB 2V1NA 3ZOBA 1ZR4A 2LC2A 2OF7A 3CTAA 5DD4A 4A3IJ 3EZSA 3CC4I 3CC7I 3EUAA 4UQVA 2NXNB 3HKZN 1EV7A 3O3KA 1F9NA 3MAFA 5F9SA 2ZMEA 3OYKA 3CF5F 1OCOH 2CJJA 4UY8I 3LG0A 3G3ZA 1IDYA 2JT1A 4A3KJ 2EIKH 1B1BA 4QLCU 9AATA 4ZZLA 2NS7A 3GUDA 3JRFA 1IJWC 4XLHA 2MSYA 3L2QA 2FBKA 2R7XA 4BAYA 3HKZA 4BEHB 3OYBA 4H4KC 1APLC 1MLZA 2DT7B 4IHWA 5FB2A 1DP7P 2AXLA 2BY2A 2EFOA 4KNYA 4IXZA 4EGYA 1MSFC 4UV8A 1FMVA 2LG4A 1R1UA 2H8WA 3K4LA 4BHPA 3E6GA 1Q1HA 5LBQA 1WI3A 1PP8F 2AY3A 2JJEA 4RGUA 3U9GA 1ETVA 4WCGA 1POGA 3GCMA 3E2YA 4GSAA 3OYCA 1MBEA 4OOIA 1AHYA 2BHYA 4W1WA 2YRRA 2R5CA 4UHNA 3TFUA 1G8XA 2K7LA 1MBGA 4M9XA 5J8FA 5FRMA 1OYYA 4OINF 1IRFA 3MBBA 2XF5A 3PD6B 4WB0A 3TQXA 2XBNA 1K78A 3Q3SA 1D8KA 1YX5A 2IW5A 3LWFA 1K4TA 1F4KA 1LB2A 2M5WA 3KZIC 4Y0HA 4KN4X 4EFFA 2VMQA 2R7OA 2W7NA 2EZIA 2W8VA 3NNKA 1OFCX 3PPLA 2F6CA 5EUNA 3COAC 3JAMZ 4D1QA 4DZPA 1Y56A 4GGGA 1YTYA 3QPHA 1I1SA 1ZYRF 2YRIA 1GEYA 3AEMA 1X1PA 2VMWA 2EPFA 2VPRA 1B59A 3GLLA 3WTWC 1WKGA 2X5FA 3PAAA 3TOBA 1I27A 1OMIA 3LFUA 5HS9A 2DOEA 1XGNA 1ZOBA 1MKMA 3SDBA 1Y1VJ 4XRFA 1V3FA 5TGTA 1ORKA 2HOSA 4A3GJ 2L7KA 5J1RA 3GXOA 1FOWA 3LSJA 4PFOA 1QZEA 1YG2A 5F04A 4EEFG 5E8IA 5F0FA 1O3RA 1M0QA 3AOWA 1WKMA 3FXUA 3KZZA 2IBDA 4R1HA 1SEUA 4RJYA 4MTDA 4FISA 4ZLVA 5DB5A 1LEAA 1X4PA 1LFUP 1ZG1A 2LVSA 3OYLA 2XPVA 2NRAC 1YIJI 3DV8A 5JI6A 3QN6A 3S3MA 4RB0A 2VQGA 1P6RA 5HS7A 1E3HA 4IRGA 2DTRA 3LSRA 3EUHC 4ZZDA 4AZJA 4BS9A 2OZUA 3K1PA 2Z9XA 3JW4A 1BT4A 3UR3C 4I09A 1D7UA 4R8DA 2STWA 2YCTA 2EPJA 2VGVA 4RKDA 2R5YB 1G59A 2WK9A 5F8VA 3LVLB 4BQQA 1BOBA 1XSDA 1JJ6C 4DIQA 2IEKA 1V2DA 2HGCA 4MQRA 3AV7A 3WHCA 2WY7Q 2VUMJ 2DA7A 5FLXZ 1IN6A 4HOBA 2Y9YA 3LSIA 3IH4A 2KL4A 5LHIA 2I10A 4JEYA 2EFPA 4IL6C 2V9KA 2ZSMA 1WJ5A 4EMSA 5HODA 4HBLA 5I92A 1WJEA 2AQFA 3SFZA 3V7SA 1XPXA 4BBRJ 4KIBA 1EF4A 2X85A 5HOOA 2LK2A 1E2XA 2W7JA 3EI6A 1CL2A 1S7AA 3ESWB 4BU2A 4C3IJ 1I1GA 3ERMA 1DUXC 1KA8A 1MDMA 2BWPA 2HS5A 1XS9A 3RI6A 2FMLA 3FZVA 4IHSA 4CH7A 2W7KA 2ISZA 1M0PA 1CL1A 3BCAA 4YIIA 3VPRA 5DCFA 3HJEA 2PB2A 1D0XA 5C44J 2Y30A 3V8JA 4XLCA 3NDNA 4M73A 2RKHA 2VLFA 2BE5F 3RPUD 5F1RA 3K1NA 1IN4A 5J4VA 2BI9A 4G6DA 3PUFA 4FT8A 4OTLA 2L2OA 4E3QA 3CQ6A 3F6OA 1PYVA 3ZXSA 2HEOA 1UMQA 2DGMA 2XC7A 3L8AA 3KYCB 2X9DA 5EIGA 3K0LA 1ENHA 3P7NA 2XF7A 3FXLA 3IP4B 1GBNA 2CV0A 2DGKA 3L2RA 1UU0A 5LHGA 3AOVA 1M0OA 4IRHA 1VNDA 1BS0A 2FU4A 1ARHA 3GBXA 1RUNA 1ARTA 2TCTA 1R4NB 2ECCA 2Z9VA 4TN4A 3CDHA 2ZCWA 3PDBA 2CG4A 1W36D 1SFXA 4PJ0C 2XASA 3IKVA 3E2FA 3LVJA 3E7LA 2DPUA 3CUOA 3JWAA 3MADA 1Y8RB 2LBFA 2L7MP 3PNYA 1TOIA 3PD6A 3O6BB 3E5XA 1BJAA 4BHBA 3L1PA 5E20A 4WP0A 2HPIA 2R7SA 3HSFA 4I6ZA 4JF0A 1I39A 1Z05A 2EK5A 3MZ8A 2IT0A 2VKHA 3RKYA 3KX2A 4OBUA 2OQRA 4UOYA 3R4TA 4HEA2 2BHZA 4CXQA 3H3UA 4W97A 3WGHA 4HPQA 1OYWA 4EJUA 1MBKA 1YJ9I 1P4WA 3AL0B 3W1HA 2M0CA 1GHCA 5JVTA 2L02A 5FFXA 2FF4A 3ZRGA 3FZ8A 1BJZA 4BEHA 4HNTA 2NNNA 2MA3A 3E77A 2OU2A 1BR2A 2G0EA 3DTEA 4ZAHA 1UHWA 5EF6A 3W1IA 2NOGA 5EG0A 2DDAA 2VJ5A 3FIWA 3LNQA 4IX8A 2ZXHA 3IRRA 4WYCA 1E5FA 1ASFA 1YJSA 5ERIA 3NTJA 2HQNA 4UVBA 1W0UA 2VPLA 2A5WA 1QA6A 4RLGA 4OAYA 1FTTA 4IYOB 1T39A 5D5UB 2BY1A 5CQGA 2HORA 2DK5A 1U5TB 3WTXC 4JX6A 2COMA 2L7FP 1KGSA 3KZYA 1GEWA 3H9QA 4D5FA 1I50J 1VQ7I 2ZYJA 3GEZA 3TO6A 2E1MB 1OR7C 2RVCA 1T56A 3CP8A 5F1JA 2E2JJ 1VP4A 5A2QZ 3CUQC 2E54A 2V79A 4IHXA 1UU2A 2DKJA 5D5XB 4LIUA 2VQCA 3FF5A 3GTGJ 1QITA 1TOJA 3K7YA 4ZM3A 2V7FA 4Y0IA 1KU2A 2IP2A 4I02A 4UB6C 3S3NA 4WK8F 1I29A 3NYTA 2M87A 2HPMA 1D5YA 4PJMA 3U21A 2CV1A 2W25A 2K9LA 5M46A 2LREA 4G6TB 4U0YA 4XMYA 1MW7A 2DA6A 1RPWA 1ON2A 3S1MJ 1B9MA 1Z0XA 2CQXA 4F5JA 3R60A 3I5UA 5DJ9A 1R4MB 3DP7A 4E7SA 2LKXA 2KISA 2KT0A 2M9HA 1DJ9A 1IV6A 2IGMA 5EFSA 1SD6A 2CUFA 3CCLI 4N4OB 3ABTA 1ETWA 2GA1A 3BTCA 2X48A 2KIMA 4AC0A 3IF2A 4AVPA 1YLFA 1QPMA 2V26A 4L9VA 2EA2A 2JN6A 2L5QA 2BW3B 5D4RA 5CPRB 1QGPA 1WYUA 5LGTA 3FFRA 5K7FA 4WYEA 1E3PA 3F9KA 5K1YA 3FMSA 1SMTA 1U78A 3A4CA 4QGRA 4E1OA 1U3EM 3HGYA 1LJ9A 3CMYA 2IA2A 4ZSWA 2FNPA 4BXUA 4ITXA 2CY8A 1ASLA 3UKGA 3CESA 2HR3A 1FEXA 2R92J 3B1DA 1KONA 2WB1N 3OSGA 4Q47A 3SZGA 3GR9A 1PUEE 1X29A 2QQ9A 1RR8C 4L5JA 3ZRRA 1W7LA 4DNCA 3HOXJ 1X3WB 3J81Z 3ZQCA 4UVCA 2L4MA 2K5CA 3LQRA 3OYAA 4HDVA 1YOOA 3DXJF 2VMVA 3LVMA 5DX5A 3FXRA 3T1BA 4BL0B 3HL2A 2KLOA 1FBQA 1WJCA 2X6OA 2HKOA 1GUUA 1JXSA 1LEBA 3BR5A 1EJ9A 1HQCA 2DMPA 1FBUA 4A3MJ 2CQKA 2XRNA 2CTZA 1UELB 1OLTA 1UHSA 3A0HC 1PP7U 1YRNA 2D65A 2YCPA 4IF4A 3VWBA 2R7ZJ 5EEAA 4OMZA 5F6FA 3WGBA 2Y2ZA 1RVYA 3K4KA 3TKYA 4AM3A 2H1LA 4RA2A 1RESA 2CJGA 5FT6A 4A69C 2UZKA 3NRVA 3QM2A 1A6IA 3OYEA 3KP6A 3AEPA 1WH7A 3FHNA 1XGSA 2XKPA 3NARA 3EYIA 2H27A 3D6KA 1QIRA 2A3SA 4F52A 3FXQA 1GD9A 3CCJI 2D5YA 2DLLA 1AMRA 1M4NA 1X1CA 2WV1A 4AIKA 4JP0A 2DW4A 2ZUKA 3LSHA 3GF2A 2WWYA 4CZCA 3QU3A 5D5VB 2K9NA 3S32A 4A12A 2ZJQF 1B4XA 3F9TA 5D5WB 1VQ6I 4MTEA 1WHUA 3GZ5A 1V2EA 2DI3A 2P7VB 4E7ZA 1W4MA 4ZYEA 1IG7A 1KMJA 1QISA 2BW3A 1FY7A 3HOVJ 2FJ1A 1Y4IA 4DBCA 4MKKA 2KHMA 3CBFA 4U87A 1VI0A 3W6KB 2W4SA 4HSTA 2OATA 2W8UA 2B0LA 3C1DA 4HX7A 1YS7A 3TP3A 1AKHA 4XBFA 4BQOA 5JLWA 3JWBA 1ULYA 2DQLA 4DQ6A 1KL2A 2VIAA 4K2BA 2V6EA 1AHFA 3H7FA 4Y7NJ 1RR7A 3A2KA 5LEKA 2IVMA 2LH9A 1Z3XA 2R7FA 3V8KA 1VQKI 4F5MA 2BIEA 4E3RA 3IKTA 4R2NA 1MBJA 4ZYHA 3A8UX 2BZTA 4ZSYA 3X2QH 3ROUA 2QLZA 3BJAA 2VMOA 1XD7A 3ISLA 5EGOB 2EWNA 2OPTA 2YSRA 4AUXA 1KMKA 2D7YA 3PJ0A 5BPDA 3F21A 1MSEC 2ECBA 3WLXA 3HUGA 3QRFF 1T95A 4PGGA 2JWTA 3LSTA 1N8PA 3RCHA 2DBBA 2E60A 1R00A 2GXGA 2VMYA 3L2WA 1AMSA 2DOAA 2XPUA 4V2GA 4RS8A 1VQ4I 4A6UA 1V54H 3BR6A 3QP6A 4KICA 4B44A 2LSOA 5KAIC 1MD0A 4OIRF 1ZRCA 3D1NI 1WQ2A 4ZDPA 2XUBA 3W2VA 4LK0F 3FHZA 1ZODA 4IEJA 2FX0A 2HU9A 1BJOA 4CCJA 3FDBA 3JTHA 1OHWA 1SPAA 2DA3A 2ZSHB 4EV0A 3HRTA 1M0NA 1FNNA 4Y52J 4NQWA 2P6TA 2CH0A 5J8CA 4YIRX 5JHUA 4A3BJ 3LA3A 4FE4A 3OYNA 2W8WA 2R5ZB 1WKHA 4EB7A 2IAIA 1NG7A 1IBJA 5ED4A 3CJQB 1BI1A 3D5LA 1XMXA 5J4YA 2V1DA 3VK3A 3I9V2 5J3LA 4WYFA 1QNTA 2BOLA 4M3EA 1FBSA 1KU9A 1EH6A 2E5NA 3M9AA 4M2JA 4U1TA 2XGCA 1XX5A 2E2IJ 3BTLA 2PO3A 3H14A 2ZFWA 3D5RC 4KITB 2CQNA 4M9SA 1BKGA 2A05A 3C2HA 3WCNA 4NHJA 5HS8A 3FXMA 3BDDA 3RTRA 1H89C 4PJLA 5GAEJ 4L0OA 1TT5B 2AO9A 1FMWA 5KK1A 5E4ZA 2CMPA 3TEDA 1LUJB 3PFYA 5CVVA 4IHTA 3W6JB 1O57A 3HQTA 1XGMA 4KDPA 3COGA 1UB9A 3F8FA 1OPCA 2CYYA 4EM1A 3AKZA 1SC7A 4PFNA 2ETHA 5J1UA 3KP3A 2BHXA 3MAUA 4W8IA 3H3ZA 2DXIA 4IOAF 1BN5A 1WFXA 3MAFB 2XB5A 3L44A 2ZFUA 3HOTA 4LITA 5KCMA 2KRCA 1K7AA 2X3LA 3IHJA 2ACJA 5E3OA 3K70C 1JGSA 3IL2A 2HVQA 2P5KA 3OYJA 1GLNA 3TATA 2XV4S 1UJ8A 1W5SA 2WTEA 3PSIA 3JZLA 2V1PA 1HA8A 3DXWA 1XDSA 4ZWMA 2O61A 2DMNA 3QI6A 2BEOA 2Q0OA 3QAHA 1DKAA 1JUSA 2TDXA 5C4JJ 2DT6A 4IJAA 3RCHB 2F4IA 1DGRM 4X1EA 2HXOA 2F5CA 2FD5A 1P9QC 5FLVA 1OCTC 3GLXA 2RQQA 4RGSA 3ZN0A 3HOUJ 3GJUA 1G3YA 3SDGA 1AICA 4HX4A 3WG9A 1TWAJ 3PNVA 4BJ5C 2EQRA 2H8RA 4E7KA 1V5GA 3RKXA 4U7DA 1QGNA 1CF7B 3J7AY 1GC0A 3E0JB 2VODA 5TJJA 1XCBA 1Z7DA 3SXYA 3ASNH 2B63J 3GMEA 3BWNA 1XSVA 1G7XA 2JA5J 4WYDA 3HHGA 1WGXA 5DCMB 3ZMTA 4UUVA 4M2KA 2EZKA 5HDMA 3HM5A 1OHVA 2DQRA 3B02A 4HDUA 2GQNA 3E5UA 4B09A 4N4NB 1X28A 4F4EA 1D1BA 1AY8A 4GCVA 3OYIA 4RB1A 5BOXA 3K4BA 5D4SA 4BDYA 1K6OA 2IRFG 1G4VA 1LE8B 2L0KA 1TZLA 5C6UA 5L3FA 3VAXA 3PL8A 1I41A 2MD0A 2JRTA 4ZH4F 2Z2SB 1ODDA 4XKWA 2M3AA 3M4OJ 4RJ0A 4WLHA 2GXBA 3KP4A 4ZDOA 2CH1A 4U0WA 2YKVA 2JPCA 4CBSA 3G8MA 2MABA 4IYOA 1RRJA 1O61A 2O0RA 5J1YA 5DYMA 3E9KA 4YIFA 1I3QJ 4JYKA 3WG7H 2K27A 1VQ9I 3E5QA 4F3QA 5FRNA 1S7OA 4PDKA 4R5FA 4UHTA 3FQ7A 4Z2YA 1MNDA 4JK1X 3CQZJ 2ZSIB 1MNEA 3PO2J 1DP3A 1Y0NA 4LB6B 3F8MA 4JX4A 2LRDA 4E7LA 2O1BA 2QZ8A 4UHOA 3DXVA 1T98A 4B98A 1NG6A 3C3WA 2BYLA 4RLFA 1YQAA 2HKXA 4S04A 5GP9A 1WZ2A 1R36A 4IVNA 2W48A 1GDTA 4RITA 4XQ2A 3SQNA 1S8NA 2HYGD 5BJ4A 4HNUA 3WTVC 4E6KG 3RI4A 5FKKA 3CDLA 1O7LA 3K2AA 2F2EA 2HXIA 4FFCA 3JTGA 2W1OA 2JJFA 1AJSB 1UZCA 2BY3A 1Z7UA 1ASDA 1LK9A 2ZP7A 3ZN1A 4HF0A 4TV7A 3KLNA 2FN6A 3CQ4A 3WY7A 3K10A 2FQ4A 1CGPA 4KN7X 4ISYA 4ADEA 3TDUC 2X0LA 4CCKA 1OISA 2O3FA 4CGZA 4BACA 1X3UA 3GTKJ 1O4XA 4WWCA 1JGGA 5LRSA 3TMOA 5D95A 3BROA 5DUIA 2GBYA 4CCOA 4LK1F 5D6EA 3ZRQA 2ZO4A 3FXKA 2PN6A 1A31A 4AO9A 1ZELA 1HCRA 2MG4A 5M5WJ 4DYRA 2W00A 4FX0A 5TRDA 3CCEI 5BNGA 1OHYA 2R5CB 3JSPA 4HG2A 5CKTA 2YKXA 5CVIA 3L00A 2HVSA 2C81A 2HP2A 2PEXA 4E7IA 5G2PA 3JRBA 1BI2A 1LQ1A 2QENA 2JA6J 1FSEA 4M3GA 1DTYA 2H6BA 2QSGX 4IW7A 4LGWA 2Z33A 1ZH5A 1SFFA 3BB8A 4PCQA 2ZJRF 4OWRB 1HSJA 1SAUA 2ZXWH 3C7JA 2PMZN 1F1ZA 3I3LA 2HFHA 1IV8A 1MMDA 1BC8C 1YNUA 5JFRA 1MDMB 2G6WA 5HHYA 1GV2A 1HOMA 3TCMA 2KP6A 1RIOH 1ZK8A 3DPLC 5D8LB 1IAYA 1JTYA 3A03A 2ZJ2A 1YHQI 1SD4A 4XRSG 1O3SA 3B1CA 2BWOA 1CF7A 1UCRA 1D7SA 3EETA 1V55H 2RV8A 4ESFA 3DR4A 2BGCA 5IYDJ 1WI9A 4PSWA 2QA4I 3N0LA 3IH2A 1OATA 1C7OA 1PMMA 3BP8A 1BBYA 3LA7A 5LFAA 3I4MJ 4LIVA 2GIVA 2HI3A 3CDIA 4BUPA 1W7NA 3AAFA 3GWPA 1IN8A 2PBIA 5BQTA 1YIOA 4F92B 2R7UA 4XLAA 2M30A 1W7PA 1D0ZA 1BJNA 3AG1H 3HXLA 1AHEA 2D7ZA 3G73A 2MH9A 3DWLE 2MW8A 3HYIA 4OIOF 2AY4A 1TQMA 4MO7A 4KJZA 3TBIA 2VONA 1BM9A 1Z67A 1V5FA 2AQEA 2ME0A 2HZPA 1W5TA 3ONQA 3WE3A 2W57A 3L2UA 1OXPA 4EATA 1B6AA 1D8JA 3AATA 3UAKA 2YUSA 3JW9A 1LPQA 3ERED 3JAMK 1ASBA 3LVKA 2KKOA 4JQFA 3J7AO 2W7HA 2E1MC 5EGOA 2FQ6A 3PFIA 1K4SA 4XR6A 1YW9A 3N75A 3QOPA 1JKOC 4MEXF 1GEXA 5DTDA 1DU6A 1SFOJ 1VF9A 1BC7C 4KIFA 4PFFA 2DJIA 4ON0A 4D9JA 2QF7A 2DMQA 3RJPA 3HG9A 2DDBA 3JRHA 2R2NA 3KLOA 1LS3A 1N75A 4LJZF 4P7YA 2AY9A 1RNLA 2L7ZA 3VYSB 2GOMA 2LY9A 4XRSA 2VMPA 3BN1A 2X51A 2Z16A 3RDIA 2K9SA 2R93J 4P3MA 4LLNA 4EJWA 3Q5FA 1VQOI 1ASMA 3GZDC 3VK4A 1J0RA 2R4GA 4QSHA 4XEWA 2XGDA 5IOZA 4ADCA 2W8TA 2BYVE 1U9OA 1K79A 5G4IA 2B9SA 3PSFA 3ACZA 1U5TA 1KKPA 5LEJA 1SZUA 1EH8A 1Y8QB 3MD2A 1YW8A 1RVUA 3UE8A 2K4BA 4F5FA 2FA5A 3OP7A 3OSFA 2CUZA 3BLYA 1AAMA 3GTLJ 3WCOA 1YI2I 2DK8A 2E1CA 4WB0B 3LOCA 3I56I 2R7RA 3PA9A 1RC9A 1S6LA 2F5FA 3OV8A 1TLHB 3ZQGA 4X0GA 3S1RJ 3R9AA 3MWMA 2IS4A 3AL0C 4GE4A 4BE2A 2D64A 3FBNB 4UUSA 2Z61A 1Z91A 2DN0A 4YFKF 3PIUA 4A3LJ 3WKSA 3K9TA 2IS6A 3HMUA 1D0YA 1DGEA 4P5OA 3GFLA 2EV5A 5JVGF 1YO5C 4WXBA 3G71I 1SFEA 1XGOA 2UXXA 4EJTA 3I4PA 2WKAA 3TQNA 3A02A 2LDUA 1I43A 5G2QA 3SJMA 2FE3A 4XM3A 3S2DJ 3CCYA 4A0ZA 1MDXA 5D5SA 2E36A 1Z77A 1WJBA 2HOAA 1B8IB 4N0WA 2E35A 1QO0D 1U9NA 2EH3A 4IRIA 1I6XA 2L9RA 2NVXJ 2PMZA 3C2BA 1ZREA 3M07A 1OR7A 4UB8C 2NNYA 3MC6C 3GBGA 2E34A 1J75A 1W36C 1GV5A 4G7ZF 1S08A 4ZTFA 2VXDA 2O7CA 3RZDJ 4HX8A 4DW6A 2IXSA 5AX8A 2AATA 4BE0A 3FMQA 5TISC 3HDDA 1J32A 4J19A 3NYUA 3SYTA 4J8LA 3FKIJ 2K3FA 4XICA 2E5ZA 5LLQA 2BIGA 1MH4A 3SHFA 4HRIA 5F0HA 3CUQA 1PMOA 3H9JA 3USFA 4JOMA 2IGKA 4EM0B 1IUFA 4HNVA 5HDKA 4PIWA 1TBXA 3OKSA 2IJLA 4IXSA 2X1DA 3NAUA 4UUTA 4JEZA 2DMTA 2MBFA 5EEGA 4C3HJ 5HNFA 3K4CA 3QP5A 1BOAA 3ZR8X 3DTIA 2QSHX 4HF8A 4NB5A 4OBVA 4MFEA 2KMUA 2DYSH 3RYRA 4LNJA 1PUFB 5DDGA 1AX4A 3HPHA 5E17F 3S16J 1TOGA 5LD2C 4P1WA 4KISA 1R22A 1J9IA 4BH9A 4BKXA 1AMQA 2PJRA 1D1AA 1C0WA 2M34A 1IJIA 4WX9A 2AY2A 3A9YA 1A5JA 4MNUA 5KVRA 3BC8A 3WGGA 1H1CA 3WGIA 2VGTA 3EYYA 3GX4X 1CZCA 3JTXA 2J5OA 4HQEA
chains in the Genus database with same CATH topology