3AV7A

Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
404
structure length
404
Chain Sequence
b'SMLGDVERFFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRYGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEGMKVEILEEKLKELKSQGKKVKVVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVAYVPGEAFYAHRDVKNTMRLNFTYVDEDKIMEGIKRLAETIKEELKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0207
publication title Structural insight into kynurenic acid excretion mechanisms of kynurenine aminotransferase in the hyperthermophilic archaeon Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 153
structure length 404
sequence length 404
chains with identical sequence C
ec nomenclature ec 2.6.1.7: Kynurenine--oxoglutarate transaminase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3av7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3av7A01
1QJ5A 1X2AA 2WK8A 2VMWA 1ARHA 4ADDA 3JU7A 1D2FA 2R0TA 4B98A 1AJSA 1YIZA 3JTXA 2ZP7A 4JEWA 4A6UA 4RIZA 4IYOB 3E2YA 2GSAA 4KAMA 4F5JA 2AATA 4ITXA 2ZY4A 2OGEA 1ZODA 3BC8A 3FCRA 5TF5A 2O1BA 1PG8A 4ITGA 2VMVA 5M4BA 1IJIA 1UU2A 3FKDA 1I43A 3H7FA 3LY1A 1AAMA 2VMOA 1C9CA 1ELQA 1QITA 2W8VA 3MC6C 3NTJA 1DTYA 2HP1A 5J8QA 3DRDA 4W1WA 3DZZA 4GEBA 2NMPA 1TARA 3DYDA 4F5FA 4F5GA 2AY6A 4JEYA 4AO9A 4HF8A 4E77A 2R5EA 2Z1ZA 1ASLA 1V2EA 4KYOA 3PD6B 4TMRA 4UHMA 1WYTB 4H51A 1D7UA 2W7HA 4JEXA 3WCNA 2VGUA 4OBVA 2AY5A 2RFVA 2ZJGA 1P3WA 1AMAA 3MBBA 4XJPA 2YKXA 5BJ3A 1WSTA 1X28A 2BIAA 4F4EA 1XI9A 5EAVA 2O7CA 1OXOA 1MDOA 4KXKA 1TOIA 4E3QA 4A6RA 1QIRA 2G6WA 3FZ6A 3K7YA 1AMQA 5M49A 3RBFA 3KGWA 2C0RA 4FL0A 1ECXA 4Q76A 1GC4A 3ACZA 2FQ6A 3CQ6A 4OT8A 8AATA 4BHDA 4LNLA 5M46A 2CTZA 3NYSA 3KE3A 1LW4A 3F9TA 3QGUA 4WBTA 4WYFA 5EUEA 1DJEA 4ZSYA 1ZOBA 2JISA 2YRIA 2D63A 3FQAA 2CJHA 3LV2A 4P7YA 4ADCA 3EI9A 1AKAA 3AEJC 4IYOA 3MADA 4LW4A 1KKJA 3FQ7A 1TOJA 3PAAA 4BQ0A 2VMYA 1CJ0A 3B1EA 1C4KA 2WKAA 3OP7A 4MQPA 1W7MA 3VK3A 4ADEA 1S06A 2D7ZA 2AEVA 3EIAA 1BJ4A 4WXBA 1LC5A 2E7JA 2X3LA 3B8XA 1OHVA 3KGXA 4ZWMA 3HL2A 1EQBA 3I4JA 4WD2A 3A9XA 1Z7DA 5EUNA 4MSOA 5F8VA 4HVKA 3RQ1A 5EUDA 2AY7A 2GQNA 4GSAA 3AENB 1UKJA 4IXOA 2AY1A 4M2JA 3PD6A 2Z9XA 2CB1A 1WYTA 2YHKA 1FC4A 3GETA 4EB5A 1GD9A 1DGEA 1BS0A 1YOOA 4U1TA 1D7SA 1XEYA 2CSTA 4W1XA 4JE5A 5DJ9A 1SZSA 3LWSA 4N0WA 2YKYA 1AY4A 1GEYA 3FFHA 1X29A 2WK9A 2Q7WA 2D65A 2ZYJA 4ZDOA 3PGYA 3EI6A 3B46A 3RCHB 1S0AA 2ZY5A 4WYEA 4ATPA 1O69A 3QM2A 1D7VA 3UAKA 1IX6A 1AIAA 1GBNA 3UE8A 2V1PA 1BQDA 4EU1A 2QMAA 3A8UX 2VIAA 3DODA 3GSBA 2VGZA 3JW9A 4LW2A 4EFFA 4IX8A 2Z61A 2ZC0A 3N75A 1SFFA 1IAXA 3H14A 4A00A 1G7WA 4WYGA 3G0TA 2DKBA 3GZDC 1WYVB 1LKCA 2YRRA 1BT4A 1D7RA 5IWQA 1BW0A 2BI1A 3M5UA 1ASAA 3MC6A 1DFOA 1M0OA 3FFRA 2DGMA 3WGCA 1KL2A 2AY8A 2XBNA 1GEWA 5G4JA 3B1CA 4MKKA 4OBUA 5G09A 5D95A 3BWNC 1AHGA 4A0RA 2QB3A 3AENA 1BQAA 2VGSA 3PJ0A 1IAYA 3ZRQA 1TOGA 4GRXA 1B5PA 3PA9A 3PPLA 4PFNA 1S07A 3FQ8A 2BI3A 3II0A 2BHXA 3TFTA 1ASDA 1DGDA 3ASBA 1RVUA 3DR4A 3PDBB 3EZSA 1M0QA 4TN4A 3HT4A 1M32A 2HUIA 2D5YA 4ZASA 1AICA 2YKUA 3AOWA 2FM1A 2PO3A 3D6KA 2BKWA 4GDYA 1AJRA 2X5DA 3RCHA 1LC7A 1VJOA 3QPGA 2D7YA 2VIBA 3G8MA 1E5FA 1MDZA 1AAWA 1V2DA 3PDXA 2HORA 5E3KA 1U08A 1EJIA 4F5HA 4WB0B 3HDOA 3WGBA 1B4XA 3ECDA 4JEVA 5G2QA 3VOMA 3AEJA 1G4XA 1TASA 3BS8A 4JF0A 1AX4A 1O61A 1CS1A 1UU0A 1YJZA 3L8AA 2X8UA 2YKVA 4P3MA 1WYVA 2Z1YA 4WYDA 2D64A 3FZ8A 4BA5A 4LNJA 3ZZKA 4DQ6A 3FDBA 1ARTA 1JG8A 4OYTA 3I16A 4RJYA 1Z3ZA 1M7YA 2W7KA 3T32A 2BWNA 3NYTA 3FSLA 3RI6A 2W8TA 3P6KA 2W7JA 2HUUA 2HOXA 2CH1A 3BCBA 5DX5A 2EPJA 2VMTA 2GMUA 2EZ2A 2DKJA 2W7DA 3HLMA 3FZ7A 4UHOA 4CBSA 1UU1A 5F9SA 4F5MA 3P1TA 4E1OA 3F0HA 1ASCA 2OGAA 4IXZA 2BIGA 2W7MA 2BYLA 1ARSA 2V0YA 1N31A 4J8LA 2HP2A 3AELA 1ARGA 5G0AA 3CQ5A 3ZRRA 1AY5A 4R2NA 3BN1A 3PDBA 1KMJA 3AEPA 3VK2A 2YCTA 3VP6A 5FT6A 3WY7A 3BV0A 4UOYA 1TPLA 3LVLB 1GEXA 4ZM3A 4ISYA 1YJYA 4PVFA 1PFFA 1ORDA 2W8UA 3HMUA 4RAEA 2PB0A 4UQVA 3NU7A 1B5OA 1X0MA 2OKKA 3HVYA 3E6GA 4IXSA 1O62A 2W7IA 1RVYA 1O4SA 3E77A 4F5LA 4MQQA 1V72A 5FT8A 1VP4A 1LK9A 2HOZA 3E2FA 4LNMA 3NDNA 1KL1A 4RKCA 2Z9VA 4WB0A 3PIUA 3Q8NA 2BYJA 3GBXA 2ZUKA 4A0GA 4Y0DA 3ISLA 2GMSA 3G7QA 1IVRA 2CJDA 2W7LA 4ZAHA 5AX8A 1AIBA 3GZDA 4RLGA 4UHNA 3W1IA 4I8AA 5HHYA 1MLYA 2W8JA 1W3UA 4XJLA 1PMOA 1BJOB 5HDMA 2AY3A 2VMRA 1ASBA 1B9IA 2VI8A 1AHXA 1ELUA 1T3IA 4F5KA 4WYAA 2JJGA 3BWNA 3LVMA 3EI7A 4AOAA 1BKGA 3NU8A 3FVUA 4ZM4A 4JF1A 3K40A 4Q31A 4F5IA 1J04A 2VYCA 2ZY3A 3N5MA 3NNKA 4OCAA 1MGVA 3LVJA 1C0NA 3E9KA 3LVKA 3WX9A 1C7NA 4CXRA 2R2NA 4A72A 4XQ2A 5G4IA 1OHWA 1RV4A 3FRKA 5EIGB 4AZKA 1J32A 2VMUA 2OQXA 2Z9UA 4O6ZA 4MQRA 3L44A 4W91A 4R8DA 3CAIA 3ELPA 4Q6RA 5G2PA 3AATA 2BWPA 2JG2A 2PB2A 3MEBA 2JJFA 1CQ7A 1SF2A 2QA3A 4DBCA 1FG3A 3DXWA 5D5SA 4NOGA 3A9ZA 1QGNA 2EO5A 3ZZJA 3VAXA 3VK4A 4GE9A 1ASNA 4K2IA 1I29A 1DJUA 1CZEA 2VMQA 1V2FA 5DJ1A 2OATA 3RBLA 3GR9A 5BJ4A 5E4ZA 5FT5A 1YIYA 3CQ4A 2Z20A 4Y0HA 5E5IA 3EI5A 2BI2A 3AEOA 3FTBA 2AY9A 4ZLVA 1WYUB 1ARIA 2EZ1A 4N0BA 2CANA 4QGRA 4E3RA 4WP0A 3E2ZB 4MGRA 1AHYA 4Y0IA 1M6SA 4RITA 4JE5D 2CINA 1E5EA 3JWAA 5EAAA 1BJOA 3R9AA 1WKHA 9AATA 4GE7A 3WKSA 4ZDPA 1CL2A 3LG0A 2TPLA 3USFA 2R5CB 1DJ9A 1GCKA 4WXGA 2Z67A 1CL1A 4BA4A 5EQCA 1C7OA 3NUIA 4LC3A 1LS3A 3FVXA 3GJUA 4TV7A 4IY7A 4OMAA 1GDEA 1C7GA 2F8JA 5I92A 1KKPA 2X5FA 2QLRA 5EIGA 3ATHA 1ASMA 4A0HA 3FDDA 1JS3A 2E54A 1ASFA 3NX3A 3W1JA 4ADBA 2O0RA 3R4TA 7AATA 2BIEA 4R5FA 2CH2A 1S08A 4WLHA 2AY2A 2D66A 3NYUA 3TCMA 2YOBA 4K2MA 4W5KA 3WKRA 2VGWA 2GB3A 4CXQA 3NUBA 1QZ9A 1M0PA 2FNIA 2VGTA 4CVQA 2HOYA 4DGTA 2VLFA 1LC8A 4IW7A 3KKIA 2BI5A 1M0NA 1G4VA 3MAFB 3QHXA 4XAUA 2VGVA 4ZDLA 1H0CA 1RV3A 4AO4A 3RUYA 3BB8A 1TATA 1AY8A 1TOKA 1S09A 4WXFA 3EZ1A 1AMRA 1KMKA 1WYUA 2W7FA 1MAPA 1W7LA 2EGYA 1ASEA 3E2ZA 1CQ8A 2ZSMA 3QN6A 3MKJA 1SZKA 1JS6A 1SPAA 1LW5A 2QBTA 3BWOA 3TATA 2VI9A 3A9YA 1ASGA 1DKAA 2AEUA 4RM1A 2YCNA 2CY8A 2HZPA 3ASAA 3BCAA 2E7IA 4XJOA 2R5CA 2DR1A 4OTLA 2DGLA 2ZSLA 2FN6A 2VMXA 2C81A 3DXVA 1OXPA 1AHFA 1AKCA 3GZCA 1IX8A 3JZLA 1YAAA 1ZC9A 3IF2A 4AZJA 2OKJA 4R5ZA 1GC0A 3UWCA 2JJHA 1IX7A 3HBXA 4FFCA 5K8BA 1WKGA 2EH6A 1PMMA 2HUFA 3DR7A 2W7GA 4XEWA 4ATQA 2YCPA 3EUCA 1JF9A 1W7NA 1Y4IA 4XJMA 3TQXA 3WLXA 1N2TA 3ELEA 1AHEA 4WLJA 5FT4A 3F6TA 3B1DA 3HQTA 4A6TA 4BMKA 1MAQA 5JAYA 5M4DA 3FVSA 4ZSWA 3JWBA 4M2KA 2DGKA 4K2BA 2W8WA 1IBJA 3EI8A 2VMSA 1OATA 2VLHA 3GWPA 4B9BA 3DU4A 1AJSB 3WCOA 3CBFA 1VEFA 1CZCA 2CJGA 3MAFA 1TOEA 4OC9A 4XK1A 4EB7A 3DC1A 1FG7A 3QI6A 1GC2A 2VMZA 3TFUA 3AEMA 2JGTA 1H1CA 2AY4A 3QBOA 2ORDA 4W1VA 1GC3A 2BI9A 3IHJA 4RKDA 2VMPA 3BCXA 4M2MA 4MY5A 3W1HA 5HXXA 1I41A 2JJEA 4J5UA 4U2HA 5LH9A 1BJWA 2WK7A 1M4NA 4A0FA 1AMSA 4RJ0A 3COGA 3WZFA 2ZY2A 3OKSA 2D61A 1SVVA 4Q75A 2C7TA 1QISA 2BWOA 2FNUA 3K28A 3N0LA 5C6UA 1B8GA 4AH3A 2E7UA 1MDXA 1YNUA 1G7XA 2C44A 1IUGA 3NRAA 4PFFA 3AV7A 2FYFA 2XH1A 4GE4A 3FD0A 3ZRPA 3AOVA 1QJ3A 4ZWVA 4W8IA 4MKJA 5EFSA 5DB5A 3AEMC 1YJSA 4EMYA 1N8PA 4CBRA 3MAUA 1EG5A 1MLZA 3A2BA 1AKBA 3I5TA 4PIWA 1CQ6A 2QB2A 2DOUA 1B9HA 2CFBA 2W7EA 1I48A 4WYCA 1BJNA 2VMNA 5LHAA 1SZUA 2Z9WA 4JEZA 1OHYA 3EIBA 4L0OA 1W23A
chains in the Genus database with same CATH superfamily
1QJ5A 1X2AA 2WK8A 2VMWA 1ARHA 4ADDA 3JU7A 1D2FA 2R0TA 4B98A 1AJSA 1YIZA 3JTXA 2ZP7A 4JEWA 4A6UA 4RIZA 4IYOB 3E2YA 2GSAA 4KAMA 4F5JA 2AATA 4ITXA 2ZY4A 2OGEA 1ZODA 3BC8A 3FCRA 5TF5A 2O1BA 1PG8A 4ITGA 2VMVA 5M4BA 1IJIA 1UU2A 3FKDA 1I43A 3H7FA 3LY1A 1AAMA 2VMOA 1C9CA 1ELQA 1QITA 2W8VA 3MC6C 3NTJA 1DTYA 2HP1A 5J8QA 3DRDA 4W1WA 3DZZA 4GEBA 2NMPA 1TARA 3DYDA 4F5FA 4F5GA 2AY6A 4JEYA 4AO9A 4HF8A 4E77A 2R5EA 2Z1ZA 1ASLA 1V2EA 4KYOA 3PD6B 4TMRA 4UHMA 1WYTB 4H51A 1D7UA 2W7HA 4JEXA 3WCNA 2VGUA 4OBVA 2AY5A 2RFVA 2ZJGA 1P3WA 1AMAA 3MBBA 4XJPA 2YKXA 5BJ3A 1WSTA 1X28A 2BIAA 4F4EA 1XI9A 5EAVA 2O7CA 1OXOA 1MDOA 4KXKA 1TOIA 4E3QA 4A6RA 1QIRA 2G6WA 3FZ6A 3K7YA 1AMQA 5M49A 3RBFA 3KGWA 2C0RA 4FL0A 1ECXA 4Q76A 1GC4A 3ACZA 2FQ6A 3CQ6A 4OT8A 8AATA 4BHDA 4LNLA 5M46A 2CTZA 3NYSA 3KE3A 1LW4A 3F9TA 3QGUA 4WBTA 4WYFA 5EUEA 1DJEA 4ZSYA 1ZOBA 2JISA 2YRIA 2D63A 3FQAA 2CJHA 3LV2A 4P7YA 4ADCA 3EI9A 1AKAA 3AEJC 4IYOA 3MADA 4LW4A 1KKJA 3FQ7A 1TOJA 3PAAA 4BQ0A 2VMYA 1CJ0A 3B1EA 1C4KA 2WKAA 3OP7A 4MQPA 1W7MA 3VK3A 4ADEA 1S06A 2D7ZA 2AEVA 3EIAA 1BJ4A 4WXBA 1LC5A 2E7JA 2X3LA 3B8XA 1OHVA 3KGXA 4ZWMA 3HL2A 1EQBA 3I4JA 4WD2A 3A9XA 1Z7DA 5EUNA 4MSOA 5F8VA 4HVKA 3RQ1A 5EUDA 2AY7A 2GQNA 4GSAA 3AENB 1UKJA 4IXOA 2AY1A 4M2JA 3PD6A 2Z9XA 2CB1A 1WYTA 2YHKA 1FC4A 3GETA 4EB5A 1GD9A 1DGEA 1BS0A 1YOOA 4U1TA 1D7SA 1XEYA 2CSTA 4W1XA 4JE5A 3N4RA 5DJ9A 1SZSA 3LWSA 4N0WA 4K05A 2YKYA 1AY4A 1GEYA 3FFHA 1X29A 2WK9A 2Q7WA 2D65A 2ZYJA 3N4XA 4ZDOA 3PGYA 3EI6A 3B46A 3RCHB 1S0AA 2ZY5A 4WYEA 4ATPA 1O69A 3QM2A 1D7VA 3UAKA 1IX6A 1AIAA 1GBNA 3UE8A 2V1PA 1BQDA 4EU1A 2QMAA 3A8UX 2VIAA 3DODA 3GSBA 2VGZA 3JW9A 4LW2A 4EFFA 4IX8A 2Z61A 2ZC0A 3N75A 1SFFA 1IAXA 3H14A 4A00A 1G7WA 4WYGA 3G0TA 2DKBA 3GZDC 1WYVB 1LKCA 2YRRA 1BT4A 1D7RA 5IWQA 1BW0A 2BI1A 3M5UA 1ASAA 2FKIA 3MC6A 1DFOA 1M0OA 3FFRA 2DGMA 3WGCA 1KL2A 2AY8A 2XBNA 1GEWA 5G4JA 3B1CA 4MKKA 4OBUA 5G09A 5D95A 3BWNC 1AHGA 4A0RA 2QB3A 3AENA 1BQAA 2VGSA 3PJ0A 1IAYA 3ZRQA 1TOGA 4GRXA 1B5PA 3PA9A 3PPLA 4PFNA 1S07A 3FQ8A 2BI3A 3II0A 2BHXA 3TFTA 1ASDA 1DGDA 3ASBA 1RVUA 3DR4A 3PDBB 3EZSA 1M0QA 4TN4A 3HT4A 1M32A 2HUIA 2D5YA 4ZASA 1AICA 2YKUA 3AOWA 2FM1A 2PO3A 3D6KA 2BKWA 4GDYA 1AJRA 2QSRA 2X5DA 3RCHA 1LC7A 1VJOA 3QPGA 2D7YA 2VIBA 3G8MA 1E5FA 1MDZA 1AAWA 1V2DA 3PDXA 2HORA 5E3KA 1U08A 1EJIA 4F5HA 4WB0B 3HDOA 3WGBA 1B4XA 3ECDA 4JEVA 5G2QA 3VOMA 3AEJA 1G4XA 1TASA 3BS8A 4JF0A 1AX4A 1O61A 1CS1A 1UU0A 1YJZA 3L8AA 2X8UA 2YKVA 4P3MA 1WYVA 2Z1YA 4WYDA 2D64A 3FZ8A 4BA5A 4LNJA 3ZZKA 4DQ6A 3FDBA 1ARTA 1JG8A 4OYTA 3I16A 4RJYA 1Z3ZA 1M7YA 2W7KA 3T32A 2BWNA 3NYTA 3FSLA 3RI6A 2W8TA 3P6KA 2W7JA 2HUUA 2HOXA 2CH1A 2WB6A 3BCBA 5DX5A 2EPJA 2VMTA 2GMUA 2EZ2A 2DKJA 2W7DA 3HLMA 3FZ7A 4UHOA 4CBSA 1UU1A 5F9SA 4F5MA 3P1TA 4E1OA 3F0HA 1ASCA 2OGAA 4IXZA 2BIGA 2W7MA 2BYLA 1ARSA 2V0YA 1N31A 4J8LA 2HP2A 3AELA 1ARGA 5G0AA 3CQ5A 3ZRRA 1AY5A 4R2NA 3BN1A 3PDBA 1KMJA 3AEPA 3VK2A 2YCTA 3VP6A 5FT6A 3WY7A 3BV0A 4UOYA 1TPLA 3LVLB 1GEXA 4ZM3A 4ISYA 1YJYA 4PVFA 1PFFA 1ORDA 2W8UA 3HMUA 4RAEA 2PB0A 4UQVA 3NU7A 1B5OA 1X0MA 2OKKA 3HVYA 3E6GA 4IXSA 1O62A 2W7IA 1RVYA 1O4SA 3E77A 4F5LA 4MQQA 1V72A 5FT8A 1VP4A 1LK9A 2HOZA 3E2FA 4LNMA 3NDNA 1KL1A 4RKCA 3H9XA 2Z9VA 4WB0A 3PIUA 3Q8NA 2BYJA 3GBXA 2ZUKA 4A0GA 4Y0DA 3ISLA 2GMSA 3G7QA 1IVRA 2CJDA 2W7LA 4ZAHA 5AX8A 1AIBA 3GZDA 4RLGA 4UHNA 3W1IA 4I8AA 5HHYA 1MLYA 2W8JA 1W3UA 4XJLA 1PMOA 1BJOB 5HDMA 2AY3A 2VMRA 1ASBA 1B9IA 2VI8A 1AHXA 1ELUA 1T3IA 4F5KA 4WYAA 2JJGA 3BWNA 3LVMA 3EI7A 4AOAA 1BKGA 3NU8A 3FVUA 4ZM4A 4JF1A 3K40A 4Q31A 4F5IA 1J04A 2VYCA 2ZY3A 3N5MA 3NNKA 4OCAA 1MGVA 3LVJA 1C0NA 3E9KA 3LVKA 3WX9A 1C7NA 4CXRA 2R2NA 4A72A 4XQ2A 5G4IA 1OHWA 1RV4A 3FRKA 5EIGB 4AZKA 1J32A 2VMUA 2OQXA 2Z9UA 4O6ZA 4MQRA 3L44A 4W91A 4H63Q 4R8DA 3CAIA 3ELPA 4Q6RA 5G2PA 3AATA 2BWPA 2JG2A 2PB2A 3MEBA 2JJFA 1CQ7A 1SF2A 2QA3A 4DBCA 1FG3A 3DXWA 5D5SA 4NOGA 3A9ZA 1QGNA 2EO5A 3ZZJA 3VAXA 3VK4A 4GE9A 1ASNA 4K2IA 1I29A 1DJUA 1CZEA 2VMQA 1V2FA 5DJ1A 2OATA 3RBLA 3GR9A 5BJ4A 5E4ZA 5FT5A 1YIYA 3CQ4A 2Z20A 4Y0HA 5E5IA 3EI5A 2BI2A 3AEOA 3FTBA 2AY9A 4ZLVA 1WYUB 1ARIA 2EZ1A 4N0BA 2CANA 4QGRA 4E3RA 4WP0A 3E2ZB 4MGRA 1AHYA 4Y0IA 1M6SA 4RITA 4JE5D 2CINA 1E5EA 3JWAA 5EAAA 1BJOA 3R9AA 1WKHA 9AATA 4GE7A 3WKSA 4ZDPA 1CL2A 3N7NA 3LG0A 2TPLA 3USFA 2R5CB 1DJ9A 1GCKA 4WXGA 2Z67A 1CL1A 4BA4A 5EQCA 1C7OA 3NUIA 4LC3A 1LS3A 3FVXA 3GJUA 4TV7A 4IY7A 4OMAA 1GDEA 1C7GA 2F8JA 5I92A 1KKPA 2X5FA 2QLRA 5EIGA 3ATHA 1ASMA 4A0HA 3FDDA 1JS3A 2E54A 1ASFA 3NX3A 3W1JA 4ADBA 2O0RA 3R4TA 7AATA 2BIEA 4R5FA 2CH2A 1S08A 4WLHA 2AY2A 2D66A 3NYUA 3TCMA 2YOBA 4K2MA 4W5KA 3WKRA 2VGWA 2GB3A 4CXQA 3NUBA 1QZ9A 1M0PA 2FNIA 2VGTA 4CVQA 2HOYA 4DGTA 2VLFA 1LC8A 4IW7A 3KKIA 2BI5A 1M0NA 1G4VA 3MAFB 3QHXA 4XAUA 2VGVA 4ZDLA 1H0CA 1RV3A 4AO4A 3RUYA 3BB8A 1TATA 2EYQA 1AY8A 1TOKA 1S09A 4WXFA 3EZ1A 1AMRA 1KMKA 2KFPA 1WYUA 2W7FA 1MAPA 1W7LA 2EGYA 1ASEA 3E2ZA 2G7JA 1CQ8A 2ZSMA 3QN6A 3MKJA 1SZKA 1JS6A 1SPAA 1LW5A 2QBTA 3BWOA 3TATA 2VI9A 3A9YA 1ASGA 1DKAA 2AEUA 4RM1A 2YCNA 2CY8A 2HZPA 3ASAA 3BCAA 2E7IA 4XJOA 2R5CA 2DR1A 4OTLA 2DGLA 2ZSLA 2FN6A 2VMXA 2C81A 3DXVA 1OXPA 1AHFA 1AKCA 3GZCA 1IX8A 3JZLA 1YAAA 1ZC9A 3IF2A 4AZJA 2OKJA 4R5ZA 1GC0A 3UWCA 2JJHA 1IX7A 3HBXA 4FFCA 5K8BA 1WKGA 2EH6A 1PMMA 2HUFA 3DR7A 2W7GA 4XEWA 4ATQA 2YCPA 3EUCA 1JF9A 1W7NA 1Y4IA 4XJMA 3TQXA 3WLXA 1N2TA 3ELEA 1AHEA 4WLJA 5FT4A 3F6TA 3B1DA 3HQTA 4A6TA 4BMKA 1MAQA 5JAYA 5M4DA 3FVSA 4ZSWA 3JWBA 4M2KA 2DGKA 4K2BA 2W8WA 1IBJA 3EI8A 2VMSA 1OATA 2VLHA 3GWPA 4B9BA 3DU4A 1AJSB 3WCOA 3CBFA 2A1VA 1VEFA 1CZCA 2CJGA 3MAFA 1TOEA 4OC9A 4XK1A 4EB7A 3DC1A 1FG7A 3QI6A 1GC2A 2VMZA 3TFUA 3AEMA 2JGTA 1H1CA 2AY4A 3QBOA 2ORDA 4W1VA 1GC3A 2BI9A 3IHJA 4RKDA 2VMPA 3BCXA 5KTBA 4M2MA 4MY5A 3W1HA 5HXXA 1I41A 2JJEA 4J5UA 4U2HA 5LH9A 1BJWA 2WK7A 1M4NA 4A0FA 1AMSA 4RJ0A 3COGA 3WZFA 2ZY2A 3OKSA 2D61A 1SVVA 4Q75A 2C7TA 1KAFA 1QISA 2BWOA 2FNUA 3K28A 3N0LA 5C6UA 1B8GA 4AH3A 2E7UA 1MDXA 1YNUA 1G7XA 2C44A 1IUGA 3NRAA 4PFFA 3AV7A 2FYFA 2XH1A 4GE4A 3FD0A 3ZRPA 3AOVA 1QJ3A 4ZWVA 3N4SA 4W8IA 4MKJA 5EFSA 5DB5A 3AEMC 1YJSA 4EMYA 1N8PA 4CBRA 3MAUA 1EG5A 1MLZA 3A2BA 1AKBA 3I5TA 4PIWA 1CQ6A 2QB2A 2DOUA 1B9HA 2CFBA 2W7EA 1I48A 4WYCA 1BJNA 2VMNA 5LHAA 1SZUA 2Z9WA 4JEZA 1OHYA 3EIBA 4L0OA 1W23A
chains in the Genus database with same CATH topology
1QJ5A 1X2AA 2WK8A 2VMWA 1ARHA 4ADDA 3JU7A 1D2FA 2R0TA 4B98A 1AJSA 1YIZA 3JTXA 2ZP7A 4JEWA 4A6UA 4RIZA 4IYOB 3E2YA 2GSAA 4KAMA 4F5JA 2AATA 4ITXA 2ZY4A 2OGEA 1ZODA 3BC8A 3FCRA 5TF5A 2O1BA 1PG8A 4ITGA 2VMVA 5M4BA 1IJIA 1UU2A 3FKDA 1I43A 3H7FA 3LY1A 1AAMA 2VMOA 1C9CA 1ELQA 1QITA 2W8VA 3MC6C 3NTJA 1DTYA 2HP1A 5J8QA 3DRDA 4W1WA 3DZZA 4GEBA 2NMPA 1TARA 3DYDA 4F5FA 4F5GA 2AY6A 4JEYA 4AO9A 4HF8A 4E77A 2R5EA 2Z1ZA 1ASLA 1V2EA 4KYOA 3PD6B 4TMRA 4UHMA 1WYTB 4H51A 1D7UA 2W7HA 4JEXA 3WCNA 2VGUA 4OBVA 2AY5A 2RFVA 2ZJGA 1P3WA 1AMAA 3MBBA 4XJPA 2YKXA 5BJ3A 1WSTA 1X28A 2BIAA 4F4EA 1XI9A 5EAVA 2O7CA 1OXOA 1MDOA 4KXKA 1TOIA 4E3QA 4A6RA 1QIRA 2G6WA 3FZ6A 3K7YA 1AMQA 5M49A 3RBFA 3KGWA 2C0RA 4FL0A 1ECXA 4Q76A 1GC4A 3ACZA 2FQ6A 3CQ6A 4OT8A 8AATA 4BHDA 4LNLA 5M46A 2CTZA 3NYSA 3KE3A 1LW4A 3F9TA 3QGUA 4WBTA 4WYFA 5EUEA 1DJEA 4ZSYA 1ZOBA 2JISA 2YRIA 2D63A 3FQAA 2CJHA 3LV2A 4P7YA 4ADCA 3EI9A 1AKAA 3AEJC 4IYOA 3MADA 4LW4A 1KKJA 3FQ7A 1TOJA 3PAAA 4BQ0A 2VMYA 1CJ0A 3B1EA 1C4KA 2WKAA 3OP7A 4MQPA 1W7MA 3VK3A 4ADEA 1S06A 2D7ZA 2AEVA 3EIAA 1BJ4A 4WXBA 1LC5A 2E7JA 2X3LA 3B8XA 1OHVA 3KGXA 4ZWMA 3HL2A 1EQBA 3I4JA 4WD2A 3A9XA 1Z7DA 5EUNA 4MSOA 5F8VA 4HVKA 3RQ1A 5EUDA 2AY7A 2GQNA 4GSAA 3AENB 1UKJA 4IXOA 2AY1A 4M2JA 3PD6A 2Z9XA 2CB1A 1WYTA 2YHKA 1FC4A 3GETA 4EB5A 1GD9A 1DGEA 1BS0A 1YOOA 4U1TA 1D7SA 1XEYA 2CSTA 4W1XA 4JE5A 3N4RA 5DJ9A 1SZSA 3LWSA 4N0WA 4K05A 2YKYA 1AY4A 1GEYA 3FFHA 1X29A 2WK9A 2Q7WA 2D65A 2ZYJA 3N4XA 4ZDOA 3PGYA 3EI6A 3B46A 3RCHB 1S0AA 2ZY5A 4WYEA 4ATPA 1O69A 3QM2A 1D7VA 3UAKA 1IX6A 1AIAA 1GBNA 3UE8A 2V1PA 1BQDA 4EU1A 2QMAA 3A8UX 2VIAA 3DODA 3GSBA 2VGZA 3JW9A 4LW2A 4EFFA 4IX8A 2Z61A 2ZC0A 3N75A 1SFFA 1IAXA 3H14A 4A00A 1G7WA 4WYGA 3G0TA 2DKBA 3GZDC 1WYVB 1LKCA 2YRRA 1BT4A 1D7RA 5IWQA 1BW0A 2BI1A 3M5UA 1ASAA 2FKIA 3MC6A 1DFOA 1M0OA 3FFRA 2DGMA 3WGCA 1KL2A 2AY8A 2XBNA 1GEWA 5G4JA 3B1CA 4MKKA 4OBUA 5G09A 5D95A 3BWNC 1AHGA 4A0RA 2QB3A 3AENA 1BQAA 2VGSA 3PJ0A 1IAYA 3ZRQA 1TOGA 4GRXA 1B5PA 3PA9A 3PPLA 4PFNA 1S07A 3FQ8A 2BI3A 3II0A 2BHXA 3TFTA 1ASDA 1DGDA 3ASBA 1RVUA 3DR4A 3PDBB 3EZSA 1M0QA 4TN4A 3HT4A 1M32A 2HUIA 2D5YA 4ZASA 1AICA 2YKUA 3AOWA 2FM1A 2PO3A 3D6KA 2BKWA 4GDYA 1AJRA 2QSRA 2X5DA 3RCHA 1LC7A 1VJOA 3QPGA 2D7YA 2VIBA 3G8MA 1E5FA 1MDZA 1AAWA 1V2DA 3PDXA 2HORA 5E3KA 1U08A 1EJIA 4F5HA 4WB0B 3HDOA 3WGBA 1B4XA 3ECDA 4JEVA 5G2QA 3VOMA 3AEJA 1G4XA 1TASA 3BS8A 4JF0A 1AX4A 1O61A 1CS1A 1UU0A 1YJZA 3L8AA 2X8UA 2YKVA 4P3MA 1WYVA 2Z1YA 4WYDA 2D64A 3FZ8A 4BA5A 4LNJA 3ZZKA 4DQ6A 3FDBA 1ARTA 1JG8A 4OYTA 3I16A 4RJYA 1Z3ZA 1M7YA 2W7KA 3T32A 2BWNA 3NYTA 3FSLA 3RI6A 2W8TA 3P6KA 2W7JA 2HUUA 2HOXA 2CH1A 2WB6A 3BCBA 5DX5A 2EPJA 2VMTA 2GMUA 2EZ2A 2DKJA 2W7DA 3HLMA 3FZ7A 4UHOA 4CBSA 1UU1A 5F9SA 4F5MA 3P1TA 4E1OA 3F0HA 1ASCA 2OGAA 4IXZA 2BIGA 2W7MA 2BYLA 1ARSA 2V0YA 1N31A 4J8LA 2HP2A 3AELA 1ARGA 5G0AA 3CQ5A 3ZRRA 1AY5A 4R2NA 3BN1A 3PDBA 1KMJA 3AEPA 3VK2A 2YCTA 3VP6A 5FT6A 3WY7A 3BV0A 4UOYA 1TPLA 3LVLB 1GEXA 4ZM3A 4ISYA 1YJYA 4PVFA 1PFFA 1ORDA 2W8UA 3HMUA 4RAEA 2PB0A 4UQVA 3NU7A 1B5OA 1X0MA 2OKKA 3HVYA 3E6GA 4IXSA 1O62A 2W7IA 1RVYA 1O4SA 3E77A 4F5LA 4MQQA 1V72A 5FT8A 1VP4A 1LK9A 2HOZA 3E2FA 4LNMA 3NDNA 1KL1A 4RKCA 3H9XA 2Z9VA 4WB0A 3PIUA 3Q8NA 2BYJA 3GBXA 2ZUKA 4A0GA 4Y0DA 3ISLA 2GMSA 3G7QA 1IVRA 2CJDA 2W7LA 4ZAHA 5AX8A 1AIBA 3GZDA 4RLGA 4UHNA 3W1IA 4I8AA 5HHYA 1MLYA 2W8JA 1W3UA 4XJLA 1PMOA 1BJOB 5HDMA 2AY3A 2VMRA 1ASBA 1B9IA 2VI8A 1AHXA 1ELUA 1T3IA 4F5KA 4WYAA 2JJGA 3BWNA 3LVMA 3EI7A 4AOAA 1BKGA 3NU8A 3FVUA 4ZM4A 4JF1A 3K40A 4Q31A 4F5IA 1J04A 2VYCA 2ZY3A 3N5MA 3NNKA 4OCAA 1MGVA 3LVJA 1C0NA 3E9KA 3LVKA 3WX9A 1C7NA 4CXRA 2R2NA 4A72A 4XQ2A 5G4IA 1OHWA 1RV4A 3FRKA 5EIGB 4AZKA 1J32A 2VMUA 2OQXA 2Z9UA 4O6ZA 4MQRA 3L44A 4W91A 4H63Q 4R8DA 3CAIA 3ELPA 4Q6RA 5G2PA 3AATA 2BWPA 2JG2A 2PB2A 3MEBA 2JJFA 1CQ7A 1SF2A 2QA3A 4DBCA 1FG3A 3DXWA 5D5SA 4NOGA 3A9ZA 1QGNA 2EO5A 3ZZJA 3VAXA 3VK4A 4GE9A 1ASNA 4K2IA 1I29A 1DJUA 1CZEA 2VMQA 1V2FA 5DJ1A 2OATA 3RBLA 3GR9A 5BJ4A 5E4ZA 5FT5A 1YIYA 3CQ4A 2Z20A 4Y0HA 5E5IA 3EI5A 2BI2A 3AEOA 3FTBA 2AY9A 4ZLVA 1WYUB 1ARIA 2EZ1A 4N0BA 2CANA 4QGRA 4E3RA 4WP0A 3E2ZB 4MGRA 1AHYA 4Y0IA 1M6SA 4RITA 4JE5D 2CINA 1E5EA 3JWAA 5EAAA 1BJOA 3R9AA 1WKHA 9AATA 4GE7A 3WKSA 4ZDPA 1CL2A 3N7NA 3LG0A 2TPLA 3USFA 2R5CB 1DJ9A 1GCKA 4WXGA 2Z67A 1CL1A 4BA4A 5EQCA 1C7OA 3NUIA 4LC3A 1LS3A 3FVXA 3GJUA 4TV7A 4IY7A 4OMAA 1GDEA 1C7GA 2F8JA 5I92A 1KKPA 2X5FA 2QLRA 5EIGA 3ATHA 1ASMA 4A0HA 3FDDA 1JS3A 2E54A 1ASFA 3NX3A 3W1JA 4ADBA 2O0RA 3R4TA 7AATA 2BIEA 4R5FA 2CH2A 1S08A 4WLHA 2AY2A 2D66A 3NYUA 3TCMA 2YOBA 4K2MA 4W5KA 3WKRA 2VGWA 2GB3A 4CXQA 3NUBA 1QZ9A 1M0PA 2FNIA 2VGTA 4CVQA 2HOYA 4DGTA 2VLFA 1LC8A 4IW7A 3KKIA 2BI5A 1M0NA 1G4VA 3MAFB 3QHXA 4XAUA 2VGVA 4ZDLA 1H0CA 1RV3A 4AO4A 3RUYA 3BB8A 1TATA 2EYQA 1AY8A 1TOKA 1S09A 4WXFA 3EZ1A 1AMRA 1KMKA 2KFPA 1WYUA 2W7FA 1MAPA 1W7LA 2EGYA 1ASEA 3E2ZA 2G7JA 1CQ8A 2ZSMA 3QN6A 3MKJA 1SZKA 1JS6A 1SPAA 1LW5A 2QBTA 3BWOA 3TATA 2VI9A 3A9YA 1ASGA 1DKAA 2AEUA 4RM1A 2YCNA 2CY8A 2HZPA 3ASAA 3BCAA 2E7IA 4XJOA 2R5CA 2DR1A 4OTLA 2DGLA 2ZSLA 2FN6A 2VMXA 2C81A 3DXVA 1OXPA 1AHFA 1AKCA 3GZCA 1IX8A 3JZLA 1YAAA 1ZC9A 3IF2A 4AZJA 2OKJA 4R5ZA 1GC0A 3UWCA 2JJHA 1IX7A 3HBXA 4FFCA 5K8BA 1WKGA 2EH6A 1PMMA 2HUFA 3DR7A 2W7GA 4XEWA 4ATQA 2YCPA 3EUCA 1JF9A 1W7NA 1Y4IA 4XJMA 3TQXA 3WLXA 1N2TA 3ELEA 1AHEA 4WLJA 5FT4A 3F6TA 3B1DA 3HQTA 4A6TA 4BMKA 1MAQA 5JAYA 5M4DA 3FVSA 4ZSWA 3JWBA 4M2KA 2DGKA 4K2BA 2W8WA 1IBJA 3EI8A 2VMSA 1OATA 2VLHA 3GWPA 4B9BA 3DU4A 1AJSB 3WCOA 3CBFA 2A1VA 1VEFA 1CZCA 2CJGA 3MAFA 1TOEA 4OC9A 4XK1A 4EB7A 3DC1A 1FG7A 3QI6A 1GC2A 2VMZA 3TFUA 3AEMA 2JGTA 1H1CA 2AY4A 3QBOA 2ORDA 4W1VA 1GC3A 2BI9A 3IHJA 4RKDA 2VMPA 3BCXA 5KTBA 4M2MA 4MY5A 3W1HA 5HXXA 1I41A 2JJEA 4J5UA 4U2HA 5LH9A 1BJWA 2WK7A 1M4NA 4A0FA 1AMSA 4RJ0A 3COGA 3WZFA 2ZY2A 3OKSA 2D61A 1SVVA 4Q75A 2C7TA 1QISA 2BWOA 2FNUA 3K28A 3N0LA 5C6UA 1B8GA 4AH3A 2E7UA 1MDXA 1YNUA 1G7XA 2C44A 1IUGA 3NRAA 4PFFA 3AV7A 2FYFA 2XH1A 4GE4A 3FD0A 3ZRPA 3AOVA 1QJ3A 4ZWVA 3N4SA 4W8IA 4MKJA 5EFSA 5DB5A 3AEMC 1YJSA 4EMYA 1N8PA 4CBRA 3MAUA 1EG5A 1MLZA 3A2BA 1AKBA 3I5TA 4PIWA 1CQ6A 2QB2A 2DOUA 1B9HA 2CFBA 2W7EA 1I48A 4WYCA 1BJNA 2VMNA 5LHAA 1SZUA 2Z9WA 4JEZA 1OHYA 3EIBA 4L0OA 1W23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJ5 A;  1X2A A;  2WK8 A;  2VMW A;  1ARH A;  4ADD A;  3JU7 A;  1D2F A;  2R0T A;  4B98 A;  1AJS A;  1YIZ A;  3JTX A;  2ZP7 A;  4JEW A;  4A6U A;  4RIZ A;  4IYO B;  3E2Y A;  2GSA A;  4KAM A;  4F5J A;  2AAT A;  4ITX A;  2ZY4 A;  2OGE A;  1ZOD A;  3BC8 A;  3FCR A;  5TF5 A;  2O1B A;  1PG8 A;  4ITG A;  2VMV A;  5M4B A;  1IJI A;  1UU2 A;  3FKD A;  1I43 A;  3H7F A;  3LY1 A;  1AAM A;  2VMO A;  1C9C A;  1ELQ A;  1QIT A;  2W8V A;  3MC6 C;  3NTJ A;  1DTY A;  2HP1 A;  5J8Q A;  3DRD A;  4W1W A;  3DZZ A;  4GEB A;  2NMP A;  1TAR A;  3DYD A;  4F5F A;  4F5G A;  2AY6 A;  4JEY A;  4AO9 A;  4HF8 A;  4E77 A;  2R5E A;  2Z1Z A;  1ASL A;  1V2E A;  4KYO A;  3PD6 B;  4TMR A;  4UHM A;  1WYT B;  4H51 A;  1D7U A;  2W7H A;  4JEX A;  3WCN A;  2VGU A;  4OBV A;  2AY5 A;  2RFV A;  2ZJG A;  1P3W A;  1AMA A;  3MBB A;  4XJP A;  2YKX A;  5BJ3 A;  1WST A;  1X28 A;  2BIA A;  4F4E A;  1XI9 A;  5EAV A;  2O7C A;  1OXO A;  1MDO A;  4KXK A;  1TOI A;  4E3Q A;  4A6R A;  1QIR A;  2G6W A;  3FZ6 A;  3K7Y A;  1AMQ A;  5M49 A;  3RBF A;  3KGW A;  2C0R A;  4FL0 A;  1ECX A;  4Q76 A;  1GC4 A;  3ACZ A;  2FQ6 A;  3CQ6 A;  4OT8 A;  8AAT A;  4BHD A;  4LNL A;  5M46 A;  2CTZ A;  3NYS A;  3KE3 A;  1LW4 A;  3F9T A;  3QGU A;  4WBT A;  4WYF A;  5EUE A;  1DJE A;  4ZSY A;  1ZOB A;  2JIS A;  2YRI A;  2D63 A;  3FQA A;  2CJH A;  3LV2 A;  4P7Y A;  4ADC A;  3EI9 A;  1AKA A;  3AEJ C;  4IYO A;  3MAD A;  4LW4 A;  1KKJ A;  3FQ7 A;  1TOJ A;  3PAA A;  4BQ0 A;  2VMY A;  1CJ0 A;  3B1E A;  1C4K A;  2WKA A;  3OP7 A;  4MQP A;  1W7M A;  3VK3 A;  4ADE A;  1S06 A;  2D7Z A;  2AEV A;  3EIA A;  1BJ4 A;  4WXB A;  1LC5 A;  2E7J A;  2X3L A;  3B8X A;  1OHV A;  3KGX A;  4ZWM A;  3HL2 A;  1EQB A;  3I4J A;  4WD2 A;  3A9X A;  1Z7D A;  5EUN A;  4MSO A;  5F8V A;  4HVK A;  3RQ1 A;  5EUD A;  2AY7 A;  2GQN A;  4GSA A;  3AEN B;  1UKJ A;  4IXO A;  2AY1 A;  4M2J A;  3PD6 A;  2Z9X A;  2CB1 A;  1WYT A;  2YHK A;  1FC4 A;  3GET A;  4EB5 A;  1GD9 A;  1DGE A;  1BS0 A;  1YOO A;  4U1T A;  1D7S A;  1XEY A;  2CST A;  4W1X A;  4JE5 A;  5DJ9 A;  1SZS A;  3LWS A;  4N0W A;  2YKY A;  1AY4 A;  1GEY A;  3FFH A;  1X29 A;  2WK9 A;  2Q7W A;  2D65 A;  2ZYJ A;  4ZDO A;  3PGY A;  3EI6 A;  3B46 A;  3RCH B;  1S0A A;  2ZY5 A;  4WYE A;  4ATP A;  1O69 A;  3QM2 A;  1D7V A;  3UAK A;  1IX6 A;  1AIA A;  1GBN A;  3UE8 A;  2V1P A;  1BQD A;  4EU1 A;  2QMA A;  3A8U X;  2VIA A;  3DOD A;  3GSB A;  2VGZ A;  3JW9 A;  4LW2 A;  4EFF A;  4IX8 A;  2Z61 A;  2ZC0 A;  3N75 A;  1SFF A;  1IAX A;  3H14 A;  4A00 A;  1G7W A;  4WYG A;  3G0T A;  2DKB A;  3GZD C;  1WYV B;  1LKC A;  2YRR A;  1BT4 A;  1D7R A;  5IWQ A;  1BW0 A;  2BI1 A;  3M5U A;  1ASA A;  3MC6 A;  1DFO A;  1M0O A;  3FFR A;  2DGM A;  3WGC A;  1KL2 A;  2AY8 A;  2XBN A;  1GEW A;  5G4J A;  3B1C A;  4MKK A;  4OBU A;  5G09 A;  5D95 A;  3BWN C;  1AHG A;  4A0R A;  2QB3 A;  3AEN A;  1BQA A;  2VGS A;  3PJ0 A;  1IAY A;  3ZRQ A;  1TOG A;  4GRX A;  1B5P A;  3PA9 A;  3PPL A;  4PFN A;  1S07 A;  3FQ8 A;  2BI3 A;  3II0 A;  2BHX A;  3TFT A;  1ASD A;  1DGD A;  3ASB A;  1RVU A;  3DR4 A;  3PDB B;  3EZS A;  1M0Q A;  4TN4 A;  3HT4 A;  1M32 A;  2HUI A;  2D5Y A;  4ZAS A;  1AIC A;  2YKU A;  3AOW A;  2FM1 A;  2PO3 A;  3D6K A;  2BKW A;  4GDY A;  1AJR A;  2X5D A;  3RCH A;  1LC7 A;  1VJO A;  3QPG A;  2D7Y A;  2VIB A;  3G8M A;  1E5F A;  1MDZ A;  1AAW A;  1V2D A;  3PDX A;  2HOR A;  5E3K A;  1U08 A;  1EJI A;  4F5H A;  4WB0 B;  3HDO A;  3WGB A;  1B4X A;  3ECD A;  4JEV A;  5G2Q A;  3VOM A;  3AEJ A;  1G4X A;  1TAS A;  3BS8 A;  4JF0 A;  1AX4 A;  1O61 A;  1CS1 A;  1UU0 A;  1YJZ A;  3L8A A;  2X8U A;  2YKV A;  4P3M A;  1WYV A;  2Z1Y A;  4WYD A;  2D64 A;  3FZ8 A;  4BA5 A;  4LNJ A;  3ZZK A;  4DQ6 A;  3FDB A;  1ART A;  1JG8 A;  4OYT A;  3I16 A;  4RJY A;  1Z3Z A;  1M7Y A;  2W7K A;  3T32 A;  2BWN A;  3NYT A;  3FSL A;  3RI6 A;  2W8T A;  3P6K A;  2W7J A;  2HUU A;  2HOX A;  2CH1 A;  3BCB A;  5DX5 A;  2EPJ A;  2VMT A;  2GMU A;  2EZ2 A;  2DKJ A;  2W7D A;  3HLM A;  3FZ7 A;  4UHO A;  4CBS A;  1UU1 A;  5F9S A;  4F5M A;  3P1T A;  4E1O A;  3F0H A;  1ASC A;  2OGA A;  4IXZ A;  2BIG A;  2W7M A;  2BYL A;  1ARS A;  2V0Y A;  1N31 A;  4J8L A;  2HP2 A;  3AEL A;  1ARG A;  5G0A A;  3CQ5 A;  3ZRR A;  1AY5 A;  4R2N A;  3BN1 A;  3PDB A;  1KMJ A;  3AEP A;  3VK2 A;  2YCT A;  3VP6 A;  5FT6 A;  3WY7 A;  3BV0 A;  4UOY A;  1TPL A;  3LVL B;  1GEX A;  4ZM3 A;  4ISY A;  1YJY A;  4PVF A;  1PFF A;  1ORD A;  2W8U A;  3HMU A;  4RAE A;  2PB0 A;  4UQV A;  3NU7 A;  1B5O A;  1X0M A;  2OKK A;  3HVY A;  3E6G A;  4IXS A;  1O62 A;  2W7I A;  1RVY A;  1O4S A;  3E77 A;  4F5L A;  4MQQ A;  1V72 A;  5FT8 A;  1VP4 A;  1LK9 A;  2HOZ A;  3E2F A;  4LNM A;  3NDN A;  1KL1 A;  4RKC A;  2Z9V A;  4WB0 A;  3PIU A;  3Q8N A;  2BYJ A;  3GBX A;  2ZUK A;  4A0G A;  4Y0D A;  3ISL A;  2GMS A;  3G7Q A;  1IVR A;  2CJD A;  2W7L A;  4ZAH A;  5AX8 A;  1AIB A;  3GZD A;  4RLG A;  4UHN A;  3W1I A;  4I8A A;  5HHY A;  1MLY A;  2W8J A;  1W3U A;  4XJL A;  1PMO A;  1BJO B;  5HDM A;  2AY3 A;  2VMR A;  1ASB A;  1B9I A;  2VI8 A;  1AHX A;  1ELU A;  1T3I A;  4F5K A;  4WYA A;  2JJG A;  3BWN A;  3LVM A;  3EI7 A;  4AOA A;  1BKG A;  3NU8 A;  3FVU A;  4ZM4 A;  4JF1 A;  3K40 A;  4Q31 A;  4F5I A;  1J04 A;  2VYC A;  2ZY3 A;  3N5M A;  3NNK A;  4OCA A;  1MGV A;  3LVJ A;  1C0N A;  3E9K A;  3LVK A;  3WX9 A;  1C7N A;  4CXR A;  2R2N A;  4A72 A;  4XQ2 A;  5G4I A;  1OHW A;  1RV4 A;  3FRK A;  5EIG B;  4AZK A;  1J32 A;  2VMU A;  2OQX A;  2Z9U A;  4O6Z A;  4MQR A;  3L44 A;  4W91 A;  4R8D A;  3CAI A;  3ELP A;  4Q6R A;  5G2P A;  3AAT A;  2BWP A;  2JG2 A;  2PB2 A;  3MEB A;  2JJF A;  1CQ7 A;  1SF2 A;  2QA3 A;  4DBC A;  1FG3 A;  3DXW A;  5D5S A;  4NOG A;  3A9Z A;  1QGN A;  2EO5 A;  3ZZJ A;  3VAX A;  3VK4 A;  4GE9 A;  1ASN A;  4K2I A;  1I29 A;  1DJU A;  1CZE A;  2VMQ A;  1V2F A;  5DJ1 A;  2OAT A;  3RBL A;  3GR9 A;  5BJ4 A;  5E4Z A;  5FT5 A;  1YIY A;  3CQ4 A;  2Z20 A;  4Y0H A;  5E5I A;  3EI5 A;  2BI2 A;  3AEO A;  3FTB A;  2AY9 A;  4ZLV A;  1WYU B;  1ARI A;  2EZ1 A;  4N0B A;  2CAN A;  4QGR A;  4E3R A;  4WP0 A;  3E2Z B;  4MGR A;  1AHY A;  4Y0I A;  1M6S A;  4RIT A;  4JE5 D;  2CIN A;  1E5E A;  3JWA A;  5EAA A;  1BJO A;  3R9A A;  1WKH A;  9AAT A;  4GE7 A;  3WKS A;  4ZDP A;  1CL2 A;  3LG0 A;  2TPL A;  3USF A;  2R5C B;  1DJ9 A;  1GCK A;  4WXG A;  2Z67 A;  1CL1 A;  4BA4 A;  5EQC A;  1C7O A;  3NUI A;  4LC3 A;  1LS3 A;  3FVX A;  3GJU A;  4TV7 A;  4IY7 A;  4OMA A;  1GDE A;  1C7G A;  2F8J A;  5I92 A;  1KKP A;  2X5F A;  2QLR A;  5EIG A;  3ATH A;  1ASM A;  4A0H A;  3FDD A;  1JS3 A;  2E54 A;  1ASF A;  3NX3 A;  3W1J A;  4ADB A;  2O0R A;  3R4T A;  7AAT A;  2BIE A;  4R5F A;  2CH2 A;  1S08 A;  4WLH A;  2AY2 A;  2D66 A;  3NYU A;  3TCM A;  2YOB A;  4K2M A;  4W5K A;  3WKR A;  2VGW A;  2GB3 A;  4CXQ A;  3NUB A;  1QZ9 A;  1M0P A;  2FNI A;  2VGT A;  4CVQ A;  2HOY A;  4DGT A;  2VLF A;  1LC8 A;  4IW7 A;  3KKI A;  2BI5 A;  1M0N A;  1G4V A;  3MAF B;  3QHX A;  4XAU A;  2VGV A;  4ZDL A;  1H0C A;  1RV3 A;  4AO4 A;  3RUY A;  3BB8 A;  1TAT A;  1AY8 A;  1TOK A;  1S09 A;  4WXF A;  3EZ1 A;  1AMR A;  1KMK A;  1WYU A;  2W7F A;  1MAP A;  1W7L A;  2EGY A;  1ASE A;  3E2Z A;  1CQ8 A;  2ZSM A;  3QN6 A;  3MKJ A;  1SZK A;  1JS6 A;  1SPA A;  1LW5 A;  2QBT A;  3BWO A;  3TAT A;  2VI9 A;  3A9Y A;  1ASG A;  1DKA A;  2AEU A;  4RM1 A;  2YCN A;  2CY8 A;  2HZP A;  3ASA A;  3BCA A;  2E7I A;  4XJO A;  2R5C A;  2DR1 A;  4OTL A;  2DGL A;  2ZSL A;  2FN6 A;  2VMX A;  2C81 A;  3DXV A;  1OXP A;  1AHF A;  1AKC A;  3GZC A;  1IX8 A;  3JZL A;  1YAA A;  1ZC9 A;  3IF2 A;  4AZJ A;  2OKJ A;  4R5Z A;  1GC0 A;  3UWC A;  2JJH A;  1IX7 A;  3HBX A;  4FFC A;  5K8B A;  1WKG A;  2EH6 A;  1PMM A;  2HUF A;  3DR7 A;  2W7G A;  4XEW A;  4ATQ A;  2YCP A;  3EUC A;  1JF9 A;  1W7N A;  1Y4I A;  4XJM A;  3TQX A;  3WLX A;  1N2T A;  3ELE A;  1AHE A;  4WLJ A;  5FT4 A;  3F6T A;  3B1D A;  3HQT A;  4A6T A;  4BMK A;  1MAQ A;  5JAY A;  5M4D A;  3FVS A;  4ZSW A;  3JWB A;  4M2K A;  2DGK A;  4K2B A;  2W8W A;  1IBJ A;  3EI8 A;  2VMS A;  1OAT A;  2VLH A;  3GWP A;  4B9B A;  3DU4 A;  1AJS B;  3WCO A;  3CBF A;  1VEF A;  1CZC A;  2CJG A;  3MAF A;  1TOE A;  4OC9 A;  4XK1 A;  4EB7 A;  3DC1 A;  1FG7 A;  3QI6 A;  1GC2 A;  2VMZ A;  3TFU A;  3AEM A;  2JGT A;  1H1C A;  2AY4 A;  3QBO A;  2ORD A;  4W1V A;  1GC3 A;  2BI9 A;  3IHJ A;  4RKD A;  2VMP A;  3BCX A;  4M2M A;  4MY5 A;  3W1H A;  5HXX A;  1I41 A;  2JJE A;  4J5U A;  4U2H A;  5LH9 A;  1BJW A;  2WK7 A;  1M4N A;  4A0F A;  1AMS A;  4RJ0 A;  3COG A;  3WZF A;  2ZY2 A;  3OKS A;  2D61 A;  1SVV A;  4Q75 A;  2C7T A;  1QIS A;  2BWO A;  2FNU A;  3K28 A;  3N0L A;  5C6U A;  1B8G A;  4AH3 A;  2E7U A;  1MDX A;  1YNU A;  1G7X A;  2C44 A;  1IUG A;  3NRA A;  4PFF A;  3AV7 A;  2FYF A;  2XH1 A;  4GE4 A;  3FD0 A;  3ZRP A;  3AOV A;  1QJ3 A;  4ZWV A;  4W8I A;  4MKJ A;  5EFS A;  5DB5 A;  3AEM C;  1YJS A;  4EMY A;  1N8P A;  4CBR A;  3MAU A;  1EG5 A;  1MLZ A;  3A2B A;  1AKB A;  3I5T A;  4PIW A;  1CQ6 A;  2QB2 A;  2DOU A;  1B9H A;  2CFB A;  2W7E A;  1I48 A;  4WYC A;  1BJN A;  2VMN A;  5LHA A;  1SZU A;  2Z9W A;  4JEZ A;  1OHY A;  3EIB A;  4L0O A;  1W23 A; 
#chains in the Genus database with same CATH topology
 1QJ5 A;  1X2A A;  2WK8 A;  2VMW A;  1ARH A;  4ADD A;  3JU7 A;  1D2F A;  2R0T A;  4B98 A;  1AJS A;  1YIZ A;  3JTX A;  2ZP7 A;  4JEW A;  4A6U A;  4RIZ A;  4IYO B;  3E2Y A;  2GSA A;  4KAM A;  4F5J A;  2AAT A;  4ITX A;  2ZY4 A;  2OGE A;  1ZOD A;  3BC8 A;  3FCR A;  5TF5 A;  2O1B A;  1PG8 A;  4ITG A;  2VMV A;  5M4B A;  1IJI A;  1UU2 A;  3FKD A;  1I43 A;  3H7F A;  3LY1 A;  1AAM A;  2VMO A;  1C9C A;  1ELQ A;  1QIT A;  2W8V A;  3MC6 C;  3NTJ A;  1DTY A;  2HP1 A;  5J8Q A;  3DRD A;  4W1W A;  3DZZ A;  4GEB A;  2NMP A;  1TAR A;  3DYD A;  4F5F A;  4F5G A;  2AY6 A;  4JEY A;  4AO9 A;  4HF8 A;  4E77 A;  2R5E A;  2Z1Z A;  1ASL A;  1V2E A;  4KYO A;  3PD6 B;  4TMR A;  4UHM A;  1WYT B;  4H51 A;  1D7U A;  2W7H A;  4JEX A;  3WCN A;  2VGU A;  4OBV A;  2AY5 A;  2RFV A;  2ZJG A;  1P3W A;  1AMA A;  3MBB A;  4XJP A;  2YKX A;  5BJ3 A;  1WST A;  1X28 A;  2BIA A;  4F4E A;  1XI9 A;  5EAV A;  2O7C A;  1OXO A;  1MDO A;  4KXK A;  1TOI A;  4E3Q A;  4A6R A;  1QIR A;  2G6W A;  3FZ6 A;  3K7Y A;  1AMQ A;  5M49 A;  3RBF A;  3KGW A;  2C0R A;  4FL0 A;  1ECX A;  4Q76 A;  1GC4 A;  3ACZ A;  2FQ6 A;  3CQ6 A;  4OT8 A;  8AAT A;  4BHD A;  4LNL A;  5M46 A;  2CTZ A;  3NYS A;  3KE3 A;  1LW4 A;  3F9T A;  3QGU A;  4WBT A;  4WYF A;  5EUE A;  1DJE A;  4ZSY A;  1ZOB A;  2JIS A;  2YRI A;  2D63 A;  3FQA A;  2CJH A;  3LV2 A;  4P7Y A;  4ADC A;  3EI9 A;  1AKA A;  3AEJ C;  4IYO A;  3MAD A;  4LW4 A;  1KKJ A;  3FQ7 A;  1TOJ A;  3PAA A;  4BQ0 A;  2VMY A;  1CJ0 A;  3B1E A;  1C4K A;  2WKA A;  3OP7 A;  4MQP A;  1W7M A;  3VK3 A;  4ADE A;  1S06 A;  2D7Z A;  2AEV A;  3EIA A;  1BJ4 A;  4WXB A;  1LC5 A;  2E7J A;  2X3L A;  3B8X A;  1OHV A;  3KGX A;  4ZWM A;  3HL2 A;  1EQB A;  3I4J A;  4WD2 A;  3A9X A;  1Z7D A;  5EUN A;  4MSO A;  5F8V A;  4HVK A;  3RQ1 A;  5EUD A;  2AY7 A;  2GQN A;  4GSA A;  3AEN B;  1UKJ A;  4IXO A;  2AY1 A;  4M2J A;  3PD6 A;  2Z9X A;  2CB1 A;  1WYT A;  2YHK A;  1FC4 A;  3GET A;  4EB5 A;  1GD9 A;  1DGE A;  1BS0 A;  1YOO A;  4U1T A;  1D7S A;  1XEY A;  2CST A;  4W1X A;  4JE5 A;  3N4R A;  5DJ9 A;  1SZS A;  3LWS A;  4N0W A;  4K05 A;  2YKY A;  1AY4 A;  1GEY A;  3FFH A;  1X29 A;  2WK9 A;  2Q7W A;  2D65 A;  2ZYJ A;  3N4X A;  4ZDO A;  3PGY A;  3EI6 A;  3B46 A;  3RCH B;  1S0A A;  2ZY5 A;  4WYE A;  4ATP A;  1O69 A;  3QM2 A;  1D7V A;  3UAK A;  1IX6 A;  1AIA A;  1GBN A;  3UE8 A;  2V1P A;  1BQD A;  4EU1 A;  2QMA A;  3A8U X;  2VIA A;  3DOD A;  3GSB A;  2VGZ A;  3JW9 A;  4LW2 A;  4EFF A;  4IX8 A;  2Z61 A;  2ZC0 A;  3N75 A;  1SFF A;  1IAX A;  3H14 A;  4A00 A;  1G7W A;  4WYG A;  3G0T A;  2DKB A;  3GZD C;  1WYV B;  1LKC A;  2YRR A;  1BT4 A;  1D7R A;  5IWQ A;  1BW0 A;  2BI1 A;  3M5U A;  1ASA A;  2FKI A;  3MC6 A;  1DFO A;  1M0O A;  3FFR A;  2DGM A;  3WGC A;  1KL2 A;  2AY8 A;  2XBN A;  1GEW A;  5G4J A;  3B1C A;  4MKK A;  4OBU A;  5G09 A;  5D95 A;  3BWN C;  1AHG A;  4A0R A;  2QB3 A;  3AEN A;  1BQA A;  2VGS A;  3PJ0 A;  1IAY A;  3ZRQ A;  1TOG A;  4GRX A;  1B5P A;  3PA9 A;  3PPL A;  4PFN A;  1S07 A;  3FQ8 A;  2BI3 A;  3II0 A;  2BHX A;  3TFT A;  1ASD A;  1DGD A;  3ASB A;  1RVU A;  3DR4 A;  3PDB B;  3EZS A;  1M0Q A;  4TN4 A;  3HT4 A;  1M32 A;  2HUI A;  2D5Y A;  4ZAS A;  1AIC A;  2YKU A;  3AOW A;  2FM1 A;  2PO3 A;  3D6K A;  2BKW A;  4GDY A;  1AJR A;  2QSR A;  2X5D A;  3RCH A;  1LC7 A;  1VJO A;  3QPG A;  2D7Y A;  2VIB A;  3G8M A;  1E5F A;  1MDZ A;  1AAW A;  1V2D A;  3PDX A;  2HOR A;  5E3K A;  1U08 A;  1EJI A;  4F5H A;  4WB0 B;  3HDO A;  3WGB A;  1B4X A;  3ECD A;  4JEV A;  5G2Q A;  3VOM A;  3AEJ A;  1G4X A;  1TAS A;  3BS8 A;  4JF0 A;  1AX4 A;  1O61 A;  1CS1 A;  1UU0 A;  1YJZ A;  3L8A A;  2X8U A;  2YKV A;  4P3M A;  1WYV A;  2Z1Y A;  4WYD A;  2D64 A;  3FZ8 A;  4BA5 A;  4LNJ A;  3ZZK A;  4DQ6 A;  3FDB A;  1ART A;  1JG8 A;  4OYT A;  3I16 A;  4RJY A;  1Z3Z A;  1M7Y A;  2W7K A;  3T32 A;  2BWN A;  3NYT A;  3FSL A;  3RI6 A;  2W8T A;  3P6K A;  2W7J A;  2HUU A;  2HOX A;  2CH1 A;  2WB6 A;  3BCB A;  5DX5 A;  2EPJ A;  2VMT A;  2GMU A;  2EZ2 A;  2DKJ A;  2W7D A;  3HLM A;  3FZ7 A;  4UHO A;  4CBS A;  1UU1 A;  5F9S A;  4F5M A;  3P1T A;  4E1O A;  3F0H A;  1ASC A;  2OGA A;  4IXZ A;  2BIG A;  2W7M A;  2BYL A;  1ARS A;  2V0Y A;  1N31 A;  4J8L A;  2HP2 A;  3AEL A;  1ARG A;  5G0A A;  3CQ5 A;  3ZRR A;  1AY5 A;  4R2N A;  3BN1 A;  3PDB A;  1KMJ A;  3AEP A;  3VK2 A;  2YCT A;  3VP6 A;  5FT6 A;  3WY7 A;  3BV0 A;  4UOY A;  1TPL A;  3LVL B;  1GEX A;  4ZM3 A;  4ISY A;  1YJY A;  4PVF A;  1PFF A;  1ORD A;  2W8U A;  3HMU A;  4RAE A;  2PB0 A;  4UQV A;  3NU7 A;  1B5O A;  1X0M A;  2OKK A;  3HVY A;  3E6G A;  4IXS A;  1O62 A;  2W7I A;  1RVY A;  1O4S A;  3E77 A;  4F5L A;  4MQQ A;  1V72 A;  5FT8 A;  1VP4 A;  1LK9 A;  2HOZ A;  3E2F A;  4LNM A;  3NDN A;  1KL1 A;  4RKC A;  3H9X A;  2Z9V A;  4WB0 A;  3PIU A;  3Q8N A;  2BYJ A;  3GBX A;  2ZUK A;  4A0G A;  4Y0D A;  3ISL A;  2GMS A;  3G7Q A;  1IVR A;  2CJD A;  2W7L A;  4ZAH A;  5AX8 A;  1AIB A;  3GZD A;  4RLG A;  4UHN A;  3W1I A;  4I8A A;  5HHY A;  1MLY A;  2W8J A;  1W3U A;  4XJL A;  1PMO A;  1BJO B;  5HDM A;  2AY3 A;  2VMR A;  1ASB A;  1B9I A;  2VI8 A;  1AHX A;  1ELU A;  1T3I A;  4F5K A;  4WYA A;  2JJG A;  3BWN A;  3LVM A;  3EI7 A;  4AOA A;  1BKG A;  3NU8 A;  3FVU A;  4ZM4 A;  4JF1 A;  3K40 A;  4Q31 A;  4F5I A;  1J04 A;  2VYC A;  2ZY3 A;  3N5M A;  3NNK A;  4OCA A;  1MGV A;  3LVJ A;  1C0N A;  3E9K A;  3LVK A;  3WX9 A;  1C7N A;  4CXR A;  2R2N A;  4A72 A;  4XQ2 A;  5G4I A;  1OHW A;  1RV4 A;  3FRK A;  5EIG B;  4AZK A;  1J32 A;  2VMU A;  2OQX A;  2Z9U A;  4O6Z A;  4MQR A;  3L44 A;  4W91 A;  4H63 Q;  4R8D A;  3CAI A;  3ELP A;  4Q6R A;  5G2P A;  3AAT A;  2BWP A;  2JG2 A;  2PB2 A;  3MEB A;  2JJF A;  1CQ7 A;  1SF2 A;  2QA3 A;  4DBC A;  1FG3 A;  3DXW A;  5D5S A;  4NOG A;  3A9Z A;  1QGN A;  2EO5 A;  3ZZJ A;  3VAX A;  3VK4 A;  4GE9 A;  1ASN A;  4K2I A;  1I29 A;  1DJU A;  1CZE A;  2VMQ A;  1V2F A;  5DJ1 A;  2OAT A;  3RBL A;  3GR9 A;  5BJ4 A;  5E4Z A;  5FT5 A;  1YIY A;  3CQ4 A;  2Z20 A;  4Y0H A;  5E5I A;  3EI5 A;  2BI2 A;  3AEO A;  3FTB A;  2AY9 A;  4ZLV A;  1WYU B;  1ARI A;  2EZ1 A;  4N0B A;  2CAN A;  4QGR A;  4E3R A;  4WP0 A;  3E2Z B;  4MGR A;  1AHY A;  4Y0I A;  1M6S A;  4RIT A;  4JE5 D;  2CIN A;  1E5E A;  3JWA A;  5EAA A;  1BJO A;  3R9A A;  1WKH A;  9AAT A;  4GE7 A;  3WKS A;  4ZDP A;  1CL2 A;  3N7N A;  3LG0 A;  2TPL A;  3USF A;  2R5C B;  1DJ9 A;  1GCK A;  4WXG A;  2Z67 A;  1CL1 A;  4BA4 A;  5EQC A;  1C7O A;  3NUI A;  4LC3 A;  1LS3 A;  3FVX A;  3GJU A;  4TV7 A;  4IY7 A;  4OMA A;  1GDE A;  1C7G A;  2F8J A;  5I92 A;  1KKP A;  2X5F A;  2QLR A;  5EIG A;  3ATH A;  1ASM A;  4A0H A;  3FDD A;  1JS3 A;  2E54 A;  1ASF A;  3NX3 A;  3W1J A;  4ADB A;  2O0R A;  3R4T A;  7AAT A;  2BIE A;  4R5F A;  2CH2 A;  1S08 A;  4WLH A;  2AY2 A;  2D66 A;  3NYU A;  3TCM A;  2YOB A;  4K2M A;  4W5K A;  3WKR A;  2VGW A;  2GB3 A;  4CXQ A;  3NUB A;  1QZ9 A;  1M0P A;  2FNI A;  2VGT A;  4CVQ A;  2HOY A;  4DGT A;  2VLF A;  1LC8 A;  4IW7 A;  3KKI A;  2BI5 A;  1M0N A;  1G4V A;  3MAF B;  3QHX A;  4XAU A;  2VGV A;  4ZDL A;  1H0C A;  1RV3 A;  4AO4 A;  3RUY A;  3BB8 A;  1TAT A;  2EYQ A;  1AY8 A;  1TOK A;  1S09 A;  4WXF A;  3EZ1 A;  1AMR A;  1KMK A;  2KFP A;  1WYU A;  2W7F A;  1MAP A;  1W7L A;  2EGY A;  1ASE A;  3E2Z A;  2G7J A;  1CQ8 A;  2ZSM A;  3QN6 A;  3MKJ A;  1SZK A;  1JS6 A;  1SPA A;  1LW5 A;  2QBT A;  3BWO A;  3TAT A;  2VI9 A;  3A9Y A;  1ASG A;  1DKA A;  2AEU A;  4RM1 A;  2YCN A;  2CY8 A;  2HZP A;  3ASA A;  3BCA A;  2E7I A;  4XJO A;  2R5C A;  2DR1 A;  4OTL A;  2DGL A;  2ZSL A;  2FN6 A;  2VMX A;  2C81 A;  3DXV A;  1OXP A;  1AHF A;  1AKC A;  3GZC A;  1IX8 A;  3JZL A;  1YAA A;  1ZC9 A;  3IF2 A;  4AZJ A;  2OKJ A;  4R5Z A;  1GC0 A;  3UWC A;  2JJH A;  1IX7 A;  3HBX A;  4FFC A;  5K8B A;  1WKG A;  2EH6 A;  1PMM A;  2HUF A;  3DR7 A;  2W7G A;  4XEW A;  4ATQ A;  2YCP A;  3EUC A;  1JF9 A;  1W7N A;  1Y4I A;  4XJM A;  3TQX A;  3WLX A;  1N2T A;  3ELE A;  1AHE A;  4WLJ A;  5FT4 A;  3F6T A;  3B1D A;  3HQT A;  4A6T A;  4BMK A;  1MAQ A;  5JAY A;  5M4D A;  3FVS A;  4ZSW A;  3JWB A;  4M2K A;  2DGK A;  4K2B A;  2W8W A;  1IBJ A;  3EI8 A;  2VMS A;  1OAT A;  2VLH A;  3GWP A;  4B9B A;  3DU4 A;  1AJS B;  3WCO A;  3CBF A;  2A1V A;  1VEF A;  1CZC A;  2CJG A;  3MAF A;  1TOE A;  4OC9 A;  4XK1 A;  4EB7 A;  3DC1 A;  1FG7 A;  3QI6 A;  1GC2 A;  2VMZ A;  3TFU A;  3AEM A;  2JGT A;  1H1C A;  2AY4 A;  3QBO A;  2ORD A;  4W1V A;  1GC3 A;  2BI9 A;  3IHJ A;  4RKD A;  2VMP A;  3BCX A;  5KTB A;  4M2M A;  4MY5 A;  3W1H A;  5HXX A;  1I41 A;  2JJE A;  4J5U A;  4U2H A;  5LH9 A;  1BJW A;  2WK7 A;  1M4N A;  4A0F A;  1AMS A;  4RJ0 A;  3COG A;  3WZF A;  2ZY2 A;  3OKS A;  2D61 A;  1SVV A;  4Q75 A;  2C7T A;  1KAF A;  1QIS A;  2BWO A;  2FNU A;  3K28 A;  3N0L A;  5C6U A;  1B8G A;  4AH3 A;  2E7U A;  1MDX A;  1YNU A;  1G7X A;  2C44 A;  1IUG A;  3NRA A;  4PFF A;  3AV7 A;  2FYF A;  2XH1 A;  4GE4 A;  3FD0 A;  3ZRP A;  3AOV A;  1QJ3 A;  4ZWV A;  3N4S A;  4W8I A;  4MKJ A;  5EFS A;  5DB5 A;  3AEM C;  1YJS A;  4EMY A;  1N8P A;  4CBR A;  3MAU A;  1EG5 A;  1MLZ A;  3A2B A;  1AKB A;  3I5T A;  4PIW A;  1CQ6 A;  2QB2 A;  2DOU A;  1B9H A;  2CFB A;  2W7E A;  1I48 A;  4WYC A;  1BJN A;  2VMN A;  5LHA A;  1SZU A;  2Z9W A;  4JEZ A;  1OHY A;  3EIB A;  4L0O A;  1W23 A; 
#chains in the Genus database with same CATH homology
 1QJ5 A;  1X2A A;  2WK8 A;  2VMW A;  1ARH A;  4ADD A;  3JU7 A;  1D2F A;  2R0T A;  4B98 A;  1AJS A;  1YIZ A;  3JTX A;  2ZP7 A;  4JEW A;  4A6U A;  4RIZ A;  4IYO B;  3E2Y A;  2GSA A;  4KAM A;  4F5J A;  2AAT A;  4ITX A;  2ZY4 A;  2OGE A;  1ZOD A;  3BC8 A;  3FCR A;  5TF5 A;  2O1B A;  1PG8 A;  4ITG A;  2VMV A;  5M4B A;  1IJI A;  1UU2 A;  3FKD A;  1I43 A;  3H7F A;  3LY1 A;  1AAM A;  2VMO A;  1C9C A;  1ELQ A;  1QIT A;  2W8V A;  3MC6 C;  3NTJ A;  1DTY A;  2HP1 A;  5J8Q A;  3DRD A;  4W1W A;  3DZZ A;  4GEB A;  2NMP A;  1TAR A;  3DYD A;  4F5F A;  4F5G A;  2AY6 A;  4JEY A;  4AO9 A;  4HF8 A;  4E77 A;  2R5E A;  2Z1Z A;  1ASL A;  1V2E A;  4KYO A;  3PD6 B;  4TMR A;  4UHM A;  1WYT B;  4H51 A;  1D7U A;  2W7H A;  4JEX A;  3WCN A;  2VGU A;  4OBV A;  2AY5 A;  2RFV A;  2ZJG A;  1P3W A;  1AMA A;  3MBB A;  4XJP A;  2YKX A;  5BJ3 A;  1WST A;  1X28 A;  2BIA A;  4F4E A;  1XI9 A;  5EAV A;  2O7C A;  1OXO A;  1MDO A;  4KXK A;  1TOI A;  4E3Q A;  4A6R A;  1QIR A;  2G6W A;  3FZ6 A;  3K7Y A;  1AMQ A;  5M49 A;  3RBF A;  3KGW A;  2C0R A;  4FL0 A;  1ECX A;  4Q76 A;  1GC4 A;  3ACZ A;  2FQ6 A;  3CQ6 A;  4OT8 A;  8AAT A;  4BHD A;  4LNL A;  5M46 A;  2CTZ A;  3NYS A;  3KE3 A;  1LW4 A;  3F9T A;  3QGU A;  4WBT A;  4WYF A;  5EUE A;  1DJE A;  4ZSY A;  1ZOB A;  2JIS A;  2YRI A;  2D63 A;  3FQA A;  2CJH A;  3LV2 A;  4P7Y A;  4ADC A;  3EI9 A;  1AKA A;  3AEJ C;  4IYO A;  3MAD A;  4LW4 A;  1KKJ A;  3FQ7 A;  1TOJ A;  3PAA A;  4BQ0 A;  2VMY A;  1CJ0 A;  3B1E A;  1C4K A;  2WKA A;  3OP7 A;  4MQP A;  1W7M A;  3VK3 A;  4ADE A;  1S06 A;  2D7Z A;  2AEV A;  3EIA A;  1BJ4 A;  4WXB A;  1LC5 A;  2E7J A;  2X3L A;  3B8X A;  1OHV A;  3KGX A;  4ZWM A;  3HL2 A;  1EQB A;  3I4J A;  4WD2 A;  3A9X A;  1Z7D A;  5EUN A;  4MSO A;  5F8V A;  4HVK A;  3RQ1 A;  5EUD A;  2AY7 A;  2GQN A;  4GSA A;  3AEN B;  1UKJ A;  4IXO A;  2AY1 A;  4M2J A;  3PD6 A;  2Z9X A;  2CB1 A;  1WYT A;  2YHK A;  1FC4 A;  3GET A;  4EB5 A;  1GD9 A;  1DGE A;  1BS0 A;  1YOO A;  4U1T A;  1D7S A;  1XEY A;  2CST A;  4W1X A;  4JE5 A;  3N4R A;  5DJ9 A;  1SZS A;  3LWS A;  4N0W A;  4K05 A;  2YKY A;  1AY4 A;  1GEY A;  3FFH A;  1X29 A;  2WK9 A;  2Q7W A;  2D65 A;  2ZYJ A;  3N4X A;  4ZDO A;  3PGY A;  3EI6 A;  3B46 A;  3RCH B;  1S0A A;  2ZY5 A;  4WYE A;  4ATP A;  1O69 A;  3QM2 A;  1D7V A;  3UAK A;  1IX6 A;  1AIA A;  1GBN A;  3UE8 A;  2V1P A;  1BQD A;  4EU1 A;  2QMA A;  3A8U X;  2VIA A;  3DOD A;  3GSB A;  2VGZ A;  3JW9 A;  4LW2 A;  4EFF A;  4IX8 A;  2Z61 A;  2ZC0 A;  3N75 A;  1SFF A;  1IAX A;  3H14 A;  4A00 A;  1G7W A;  4WYG A;  3G0T A;  2DKB A;  3GZD C;  1WYV B;  1LKC A;  2YRR A;  1BT4 A;  1D7R A;  5IWQ A;  1BW0 A;  2BI1 A;  3M5U A;  1ASA A;  2FKI A;  3MC6 A;  1DFO A;  1M0O A;  3FFR A;  2DGM A;  3WGC A;  1KL2 A;  2AY8 A;  2XBN A;  1GEW A;  5G4J A;  3B1C A;  4MKK A;  4OBU A;  5G09 A;  5D95 A;  3BWN C;  1AHG A;  4A0R A;  2QB3 A;  3AEN A;  1BQA A;  2VGS A;  3PJ0 A;  1IAY A;  3ZRQ A;  1TOG A;  4GRX A;  1B5P A;  3PA9 A;  3PPL A;  4PFN A;  1S07 A;  3FQ8 A;  2BI3 A;  3II0 A;  2BHX A;  3TFT A;  1ASD A;  1DGD A;  3ASB A;  1RVU A;  3DR4 A;  3PDB B;  3EZS A;  1M0Q A;  4TN4 A;  3HT4 A;  1M32 A;  2HUI A;  2D5Y A;  4ZAS A;  1AIC A;  2YKU A;  3AOW A;  2FM1 A;  2PO3 A;  3D6K A;  2BKW A;  4GDY A;  1AJR A;  2QSR A;  2X5D A;  3RCH A;  1LC7 A;  1VJO A;  3QPG A;  2D7Y A;  2VIB A;  3G8M A;  1E5F A;  1MDZ A;  1AAW A;  1V2D A;  3PDX A;  2HOR A;  5E3K A;  1U08 A;  1EJI A;  4F5H A;  4WB0 B;  3HDO A;  3WGB A;  1B4X A;  3ECD A;  4JEV A;  5G2Q A;  3VOM A;  3AEJ A;  1G4X A;  1TAS A;  3BS8 A;  4JF0 A;  1AX4 A;  1O61 A;  1CS1 A;  1UU0 A;  1YJZ A;  3L8A A;  2X8U A;  2YKV A;  4P3M A;  1WYV A;  2Z1Y A;  4WYD A;  2D64 A;  3FZ8 A;  4BA5 A;  4LNJ A;  3ZZK A;  4DQ6 A;  3FDB A;  1ART A;  1JG8 A;  4OYT A;  3I16 A;  4RJY A;  1Z3Z A;  1M7Y A;  2W7K A;  3T32 A;  2BWN A;  3NYT A;  3FSL A;  3RI6 A;  2W8T A;  3P6K A;  2W7J A;  2HUU A;  2HOX A;  2CH1 A;  2WB6 A;  3BCB A;  5DX5 A;  2EPJ A;  2VMT A;  2GMU A;  2EZ2 A;  2DKJ A;  2W7D A;  3HLM A;  3FZ7 A;  4UHO A;  4CBS A;  1UU1 A;  5F9S A;  4F5M A;  3P1T A;  4E1O A;  3F0H A;  1ASC A;  2OGA A;  4IXZ A;  2BIG A;  2W7M A;  2BYL A;  1ARS A;  2V0Y A;  1N31 A;  4J8L A;  2HP2 A;  3AEL A;  1ARG A;  5G0A A;  3CQ5 A;  3ZRR A;  1AY5 A;  4R2N A;  3BN1 A;  3PDB A;  1KMJ A;  3AEP A;  3VK2 A;  2YCT A;  3VP6 A;  5FT6 A;  3WY7 A;  3BV0 A;  4UOY A;  1TPL A;  3LVL B;  1GEX A;  4ZM3 A;  4ISY A;  1YJY A;  4PVF A;  1PFF A;  1ORD A;  2W8U A;  3HMU A;  4RAE A;  2PB0 A;  4UQV A;  3NU7 A;  1B5O A;  1X0M A;  2OKK A;  3HVY A;  3E6G A;  4IXS A;  1O62 A;  2W7I A;  1RVY A;  1O4S A;  3E77 A;  4F5L A;  4MQQ A;  1V72 A;  5FT8 A;  1VP4 A;  1LK9 A;  2HOZ A;  3E2F A;  4LNM A;  3NDN A;  1KL1 A;  4RKC A;  3H9X A;  2Z9V A;  4WB0 A;  3PIU A;  3Q8N A;  2BYJ A;  3GBX A;  2ZUK A;  4A0G A;  4Y0D A;  3ISL A;  2GMS A;  3G7Q A;  1IVR A;  2CJD A;  2W7L A;  4ZAH A;  5AX8 A;  1AIB A;  3GZD A;  4RLG A;  4UHN A;  3W1I A;  4I8A A;  5HHY A;  1MLY A;  2W8J A;  1W3U A;  4XJL A;  1PMO A;  1BJO B;  5HDM A;  2AY3 A;  2VMR A;  1ASB A;  1B9I A;  2VI8 A;  1AHX A;  1ELU A;  1T3I A;  4F5K A;  4WYA A;  2JJG A;  3BWN A;  3LVM A;  3EI7 A;  4AOA A;  1BKG A;  3NU8 A;  3FVU A;  4ZM4 A;  4JF1 A;  3K40 A;  4Q31 A;  4F5I A;  1J04 A;  2VYC A;  2ZY3 A;  3N5M A;  3NNK A;  4OCA A;  1MGV A;  3LVJ A;  1C0N A;  3E9K A;  3LVK A;  3WX9 A;  1C7N A;  4CXR A;  2R2N A;  4A72 A;  4XQ2 A;  5G4I A;  1OHW A;  1RV4 A;  3FRK A;  5EIG B;  4AZK A;  1J32 A;  2VMU A;  2OQX A;  2Z9U A;  4O6Z A;  4MQR A;  3L44 A;  4W91 A;  4H63 Q;  4R8D A;  3CAI A;  3ELP A;  4Q6R A;  5G2P A;  3AAT A;  2BWP A;  2JG2 A;  2PB2 A;  3MEB A;  2JJF A;  1CQ7 A;  1SF2 A;  2QA3 A;  4DBC A;  1FG3 A;  3DXW A;  5D5S A;  4NOG A;  3A9Z A;  1QGN A;  2EO5 A;  3ZZJ A;  3VAX A;  3VK4 A;  4GE9 A;  1ASN A;  4K2I A;  1I29 A;  1DJU A;  1CZE A;  2VMQ A;  1V2F A;  5DJ1 A;  2OAT A;  3RBL A;  3GR9 A;  5BJ4 A;  5E4Z A;  5FT5 A;  1YIY A;  3CQ4 A;  2Z20 A;  4Y0H A;  5E5I A;  3EI5 A;  2BI2 A;  3AEO A;  3FTB A;  2AY9 A;  4ZLV A;  1WYU B;  1ARI A;  2EZ1 A;  4N0B A;  2CAN A;  4QGR A;  4E3R A;  4WP0 A;  3E2Z B;  4MGR A;  1AHY A;  4Y0I A;  1M6S A;  4RIT A;  4JE5 D;  2CIN A;  1E5E A;  3JWA A;  5EAA A;  1BJO A;  3R9A A;  1WKH A;  9AAT A;  4GE7 A;  3WKS A;  4ZDP A;  1CL2 A;  3N7N A;  3LG0 A;  2TPL A;  3USF A;  2R5C B;  1DJ9 A;  1GCK A;  4WXG A;  2Z67 A;  1CL1 A;  4BA4 A;  5EQC A;  1C7O A;  3NUI A;  4LC3 A;  1LS3 A;  3FVX A;  3GJU A;  4TV7 A;  4IY7 A;  4OMA A;  1GDE A;  1C7G A;  2F8J A;  5I92 A;  1KKP A;  2X5F A;  2QLR A;  5EIG A;  3ATH A;  1ASM A;  4A0H A;  3FDD A;  1JS3 A;  2E54 A;  1ASF A;  3NX3 A;  3W1J A;  4ADB A;  2O0R A;  3R4T A;  7AAT A;  2BIE A;  4R5F A;  2CH2 A;  1S08 A;  4WLH A;  2AY2 A;  2D66 A;  3NYU A;  3TCM A;  2YOB A;  4K2M A;  4W5K A;  3WKR A;  2VGW A;  2GB3 A;  4CXQ A;  3NUB A;  1QZ9 A;  1M0P A;  2FNI A;  2VGT A;  4CVQ A;  2HOY A;  4DGT A;  2VLF A;  1LC8 A;  4IW7 A;  3KKI A;  2BI5 A;  1M0N A;  1G4V A;  3MAF B;  3QHX A;  4XAU A;  2VGV A;  4ZDL A;  1H0C A;  1RV3 A;  4AO4 A;  3RUY A;  3BB8 A;  1TAT A;  2EYQ A;  1AY8 A;  1TOK A;  1S09 A;  4WXF A;  3EZ1 A;  1AMR A;  1KMK A;  2KFP A;  1WYU A;  2W7F A;  1MAP A;  1W7L A;  2EGY A;  1ASE A;  3E2Z A;  2G7J A;  1CQ8 A;  2ZSM A;  3QN6 A;  3MKJ A;  1SZK A;  1JS6 A;  1SPA A;  1LW5 A;  2QBT A;  3BWO A;  3TAT A;  2VI9 A;  3A9Y A;  1ASG A;  1DKA A;  2AEU A;  4RM1 A;  2YCN A;  2CY8 A;  2HZP A;  3ASA A;  3BCA A;  2E7I A;  4XJO A;  2R5C A;  2DR1 A;  4OTL A;  2DGL A;  2ZSL A;  2FN6 A;  2VMX A;  2C81 A;  3DXV A;  1OXP A;  1AHF A;  1AKC A;  3GZC A;  1IX8 A;  3JZL A;  1YAA A;  1ZC9 A;  3IF2 A;  4AZJ A;  2OKJ A;  4R5Z A;  1GC0 A;  3UWC A;  2JJH A;  1IX7 A;  3HBX A;  4FFC A;  5K8B A;  1WKG A;  2EH6 A;  1PMM A;  2HUF A;  3DR7 A;  2W7G A;  4XEW A;  4ATQ A;  2YCP A;  3EUC A;  1JF9 A;  1W7N A;  1Y4I A;  4XJM A;  3TQX A;  3WLX A;  1N2T A;  3ELE A;  1AHE A;  4WLJ A;  5FT4 A;  3F6T A;  3B1D A;  3HQT A;  4A6T A;  4BMK A;  1MAQ A;  5JAY A;  5M4D A;  3FVS A;  4ZSW A;  3JWB A;  4M2K A;  2DGK A;  4K2B A;  2W8W A;  1IBJ A;  3EI8 A;  2VMS A;  1OAT A;  2VLH A;  3GWP A;  4B9B A;  3DU4 A;  1AJS B;  3WCO A;  3CBF A;  2A1V A;  1VEF A;  1CZC A;  2CJG A;  3MAF A;  1TOE A;  4OC9 A;  4XK1 A;  4EB7 A;  3DC1 A;  1FG7 A;  3QI6 A;  1GC2 A;  2VMZ A;  3TFU A;  3AEM A;  2JGT A;  1H1C A;  2AY4 A;  3QBO A;  2ORD A;  4W1V A;  1GC3 A;  2BI9 A;  3IHJ A;  4RKD A;  2VMP A;  3BCX A;  5KTB A;  4M2M A;  4MY5 A;  3W1H A;  5HXX A;  1I41 A;  2JJE A;  4J5U A;  4U2H A;  5LH9 A;  1BJW A;  2WK7 A;  1M4N A;  4A0F A;  1AMS A;  4RJ0 A;  3COG A;  3WZF A;  2ZY2 A;  3OKS A;  2D61 A;  1SVV A;  4Q75 A;  2C7T A;  1QIS A;  2BWO A;  2FNU A;  3K28 A;  3N0L A;  5C6U A;  1B8G A;  4AH3 A;  2E7U A;  1MDX A;  1YNU A;  1G7X A;  2C44 A;  1IUG A;  3NRA A;  4PFF A;  3AV7 A;  2FYF A;  2XH1 A;  4GE4 A;  3FD0 A;  3ZRP A;  3AOV A;  1QJ3 A;  4ZWV A;  3N4S A;  4W8I A;  4MKJ A;  5EFS A;  5DB5 A;  3AEM C;  1YJS A;  4EMY A;  1N8P A;  4CBR A;  3MAU A;  1EG5 A;  1MLZ A;  3A2B A;  1AKB A;  3I5T A;  4PIW A;  1CQ6 A;  2QB2 A;  2DOU A;  1B9H A;  2CFB A;  2W7E A;  1I48 A;  4WYC A;  1BJN A;  2VMN A;  5LHA A;  1SZU A;  2Z9W A;  4JEZ A;  1OHY A;  3EIB A;  4L0O A;  1W23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...