3T32A

Crystal structure of a putative c-s lyase from bacillus anthracis
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
360
structure length
359
Chain Sequence
b'EELIHAWIADMDFEVPQPIQTALKKRIEHPIFGYTLPPENIGDIICNWTKKQYNWDIQKEWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAARTITCMAPSTFNIAGLQASIIIIPNEKLRQAFTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDHIPTLSVMKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminotransferase, class I/II
publication title Crystal structure of a putative C-S lyase from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Lyase
total genus 128
structure length 359
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3t32A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3t32A01
1ASAA 5DJ9A 1PMOA 2VLFA 1X29A 1I48A 3PA9A 5D5SA 2AY8A 3TFTA 1SPAA 2W7DA 3B8XA 2EPJA 3G0TA 4ZAHA 3BB8A 3WGBA 4LW4A 4WB0A 2XH1A 4QGRA 5K8BA 1AKBA 1FG3A 1GEXA 1BJWA 3II0A 1C7GA 1D7RA 3JZLA 2W7GA 1DFOA 1ZC9A 3B1CA 4LW2A 1ARHA 1T3IA 2PO3A 5HXXA 3LVMA 4IXOA 1ASGA 3FQ8A 4WYDA 1WKGA 4ADEA 1TARA 4H51A 1VJOA 1B9HA 1AIAA 3WLXA 1GBNA 1SZKA 4RITA 5HHYA 2W7EA 4GE9A 2W7MA 3T32A 3I4JA 5M4BA 2OQXA 2VGVA 3H7FA 4K2IA 1AMQA 1E5EA 1ARTA 2C44A 4JE5D 2EZ2A 8AATA 3PDBA 1O61A 2X8UA 3TATA 4A6RA 2XBNA 1YJYA 2V0YA 4WB0B 3NU8A 1AMSA 2VMRA 2CJHA 2QLRA 3BCXA 3K40A 1M32A 4U1TA 5AX8A 2HUIA 1B8GA 4M2KA 1MDZA 5J8QA 2X3LA 3HLMA 3FQAA 1IAYA 1YIYA 3LV2A 3JWAA 3ATHA 2W7HA 1H0CA 3WZFA 2GMUA 4B9BA 3JTXA 4W1XA 4AO9A 2AY5A 3E2FA 2D7ZA 3FVSA 5FT6A 2D66A 3W1JA 3ISLA 1O62A 3A2BA 3EI6A 5DX5A 5G0AA 1CQ6A 1KL2A 2BYLA 4A0FA 4R2NA 1TOEA 5BJ4A 1WYUB 3CAIA 4MQRA 4MKJA 1ARGA 3NNKA 5IWQA 3WX9A 1ASLA 1H1CA 1ZODA 3AEPA 4W5KA 2VMUA 2BWNA 1OXPA 2VMSA 4MGRA 2QB2A 3E2ZA 3EZSA 2AATA 2FNUA 4EMYA 5M46A 4CXQA 2D63A 1V2EA 4Q6RA 1TASA 3PDXA 1G4XA 1MGVA 1TPLA 2YRIA 3EI5A 4FFCA 4TMRA 4WD2A 2JJHA 2VMTA 3E9KA 4GSAA 5G2QA 1O69A 1AAMA 2W8UA 3VP6A 3QN6A 1PFFA 2YCPA 4Q76A 4ZDPA 4AOAA 3P6KA 2JJEA 1KKJA 1KL1A 2VMZA 2VGSA 2W7KA 4RKCA 4WLJA 4ADBA 3WCOA 4F5MA 1AY8A 3WKSA 2BI9A 4F5IA 3RCHA 2AEUA 1CZCA 3AATA 4O6ZA 5EIGA 4WLHA 3PIUA 4XJLA 4F5LA 4J8LA 1IBJA 3MAUA 4XJMA 3H14A 1AHXA 1ZOBA 1CL1A 1ASEA 3BCAA 1QJ3A 3HT4A 4ADCA 4BHDA 1RVUA 1XI9A 1EQBA 1OXOA 2VGTA 3ECDA 3ZZKA 1M7YA 1QISA 2R2NA 3QGUA 3RBFA 4EB7A 1YIZA 3FDDA 1BW0A 3GBXA 1C7NA 3LWSA 3ASAA 4BMKA 4JE5A 1CQ8A 3AEJA 1AICA 3DXWA 1OHYA 1JG8A 1LC5A 2HUUA 4Y0DA 1SVVA 2RFVA 2TPLA 4ADDA 4JEVA 1M0OA 4ZDOA 4BA5A 1KKPA 2HORA 1DTYA 4F4EA 3PPLA 1ASNA 3GZCA 1LC8A 1Y4IA 3FFHA 3ZRQA 3AEOA 4U2HA 2ZYJA 3RCHB 3QI6A 2AY7A 2R5CA 3MAFA 1C4KA 3MC6C 5EIGB 2O1BA 4BQ0A 1MDOA 3LY1A 3IHJA 4RLGA 1BJNA 2AY6A 3BC8A 1B5OA 4JEYA 2WK7A 3ELEA 3MKJA 4ZSYA 2DKBA 9AATA 3ZRPA 1GDEA 3UAKA 2BWPA 2W8WA 2YKUA 1YJZA 2AY3A 4Q31A 3LVLB 1UU2A 1AHEA 2Z9UA 3K28A 2C0RA 1AKAA 1ARSA 4KYOA 5M49A 4R8DA 5HDMA 4JF1A 4MSOA 1D2FA 2BI2A 2BKWA 2FQ6A 1ASBA 3LVKA 3N5MA 4K2BA 4AZJA 1CS1A 2C7TA 1J04A 3F6TA 3HVYA 4DQ6A 1ECXA 5EAAA 4ITGA 4OYTA 4OCAA 1SZUA 2W7JA 4XJPA 1BQDA 5TF5A 4E3QA 3W1IA 4J5UA 3PGYA 3BCBA 2W7LA 2D64A 1QITA 2VMXA 5G09A 5DJ1A 1TATA 2CJGA 3AEJC 4LNLA 1X0MA 1LS3A 2VGWA 5EFSA 3MAFB 2R5CB 1W7NA 2GB3A 3KGXA 3N75A 3L44A 4XQ2A 3E6GA 1KMKA 3DC1A 4UHOA 2AEVA 2HZPA 2OGAA 2D65A 3LG0A 1SFFA 2VMWA 4PFNA 1W7MA 4A72A 5DB5A 1BKGA 1OHWA 2WK8A 2BYJA 1S07A 2DGMA 4WP0A 3COGA 3GETA 3NDNA 2VIBA 3FSLA 3OKSA 4ITXA 4AH3A 5JAYA 1WYUA 3AEMA 4AO4A 3MEBA 4K2MA 3VOMA 4L0OA 2E7JA 4W1VA 1B9IA 1DGEA 1N31A 1I43A 1I41A 4OBUA 4ZASA 2CANA 5D95A 4HF8A 2GSAA 3DR7A 2HUFA 4OTLA 4OC9A 1AY5A 3JW9A 1B5PA 1LW5A 1AY4A 4WXGA 1LKCA 3HQTA 3BN1A 4ATPA 1YJSA 4JEXA 1ELUA 2WKAA 1AJRA 1DJUA 2ZY5A 2VMNA 2PB0A 2VGUA 4LNJA 2O7CA 2Q7WA 3EIBA 3VAXA 4DGTA 2W8VA 3EI7A 4W91A 3TCMA 4GRXA 3RUYA 1QIRA 1S0AA 3NYUA 4A0HA 4DBCA 3OP7A 2AY2A 2Z1YA 3E2YA 2EGYA 5E3KA 3HL2A 1W7LA 1GD9A 3GJUA 4HVKA 4WYGA 5I92A 1AMAA 3W1HA 1JS3A 2QB3A 1M0NA 1BJ4A 1CZEA 1MLYA 3BWNA 3AEMC 3AV7A 4JEWA 3G7QA 1OATA 1UKJA 3EI9A 4IY7A 5E5IA 3A9XA 4EFFA 4OMAA 1TOIA 3FDBA 3FD0A 3FKDA 4R5ZA 1LK9A 2FYFA 2YHKA 4KAMA 1UU0A 4JF0A 2BI3A 3NRAA 2VYCA 3QHXA 2F8JA 2ZY3A 1M0QA 3D6KA 3QPGA 5G4IA 3AELA 4R5FA 4FL0A 3A9YA 2FM1A 4I8AA 1N8PA 1BJOA 4XAUA 3JU7A 1E5FA 2JISA 3RQ1A 1PG8A 1CQ7A 3ZZJA 1QJ5A 2YKYA 1BQAA 4A0GA 2W8TA 4F5GA 3NUBA 1WYVA 1JS6A 2DOUA 4A0RA 3WKRA 2VMOA 4RIZA 2WK9A 2HOYA 3NYSA 4ZLVA 2OGEA 3RI6A 4F5HA 3GWPA 5F9SA 2Z67A 2ZP7A 4WYFA 3N0LA 4UOYA 1GC0A 1RV4A 2G6WA 2BHXA 2VI8A 3BWNC 1Z7DA 1LW4A 1IX7A 3FFRA 4ATQA 2DKJA 4JEZA 1C7OA 4KXKA 4RJ0A 2HOZA 4TN4A 3A9ZA 3TQXA 4N0WA 2VMYA 4ZSWA 4NOGA 1SF2A 3UE8A 1BJOB 4Q75A 2VI9A 1OHVA 4M2JA 2EZ1A 5EAVA 1GC3A 2ZUKA 3ELPA 3TFUA 2OATA 3ACZA 1AJSA 1V2DA 5E4ZA 1C9CA 3JWBA 1O4SA 3P1TA 4WYEA 2AY1A 1EJIA 3FRKA 4GE4A 2EH6A 3G8MA 1WYVB 4IX8A 4N0BA 1AMRA 2W8JA 2HP1A 2JJGA 3AOWA 7AATA 2VGZA 4E1OA 2W7FA 2V1PA 3HDOA 4TV7A 3NUIA 4RAEA 1AIBA 1MLZA 3F0HA 1M0PA 3IF2A 1ELQA 3LVJA 4XEWA 3AOVA 1S09A 3I5TA 1GC4A 1IUGA 3BWOA 1G4VA 1I29A 4A6UA 1D7UA 1W3UA 4M2MA 2Z9WA 3FVUA 2AY4A 1AHGA 3HBXA 2ZY4A 3EIAA 3QM2A 1ARIA 3DYDA 1CL2A 2DGLA 3NTJA 2ZY2A 3DR4A 1WSTA 4IXZA 1GEYA 1YAAA 1ASMA 3MADA 2W7IA 1AJSB 2VLHA 1DKAA 3GZDA 3PAAA 3FVXA 3PJ0A 1WKHA 2HOXA 3ASBA 2R0TA 3CQ5A 2D61A 1DJEA 1G7WA 2CB1A 3EUCA 1WYTB 2CH2A 3Q8NA 3R9AA 3RBLA 1TOGA 1VEFA 2O0RA 2R5EA 3QBOA 4LNMA 3FZ7A 4LC3A 3VK2A 4RJYA 2ORDA 2Z9VA 4ZWMA 1QGNA 1AX4A 1C0NA 3L8AA 2BI1A 1IVRA 2QMAA 4CVQA 4CXRA 5BJ3A 1TOKA 1QZ9A 4RM1A 1LC7A 2CTZA 4AZKA 1UU1A 3WCNA 3FTBA 4IW7A 4OBVA 3VK4A 1MAQA 2QA3A 4ZDLA 5M4DA 5G4JA 4F5FA 3DRDA 4PFFA 2EO5A 4UHNA 5LH9A 2BWOA 2PB2A 2FNIA 2X5DA 4GE7A 1ASDA 4GDYA 2D7YA 3B1EA 1IAXA 2YKVA 3F9TA 4CBSA 2JG2A 5LHAA 3DODA 2DGKA 4E77A 3I16A 2ZSMA 4EU1A 2NMPA 2Z20A 3FCRA 3MBBA 1X2AA 3M5UA 3KGWA 1GEWA 1XEYA 2ZSLA 3ZRRA 1DGDA 2E54A 2GQNA 1MDXA 1MAPA 4XK1A 1GCKA 3NYTA 4BA4A 4Y0IA 1IX6A 3GZDC 5EUNA 1V72A 2JGTA 4W8IA 1RV3A 4CBRA 2DR1A 3USFA 4F5KA 1BT4A 3FZ8A 3R4TA 2BIEA 1AHYA 3BS8A 2FN6A 4UQVA 5FT4A 2ZJGA 4ZWVA 1KMJA 3PD6A 3KE3A 2CSTA 1CJ0A 1BS0A 4MY5A 3EZ1A 4PIWA 1ORDA 3PDBB 1AHFA 1FG7A 4OT8A 4MQQA 4WBTA 3UWCA 1U08A 3GR9A 1SZSA 1DJ9A 5G2PA 2C81A 3AENA 2Z1ZA 3NU7A 3VK3A 3BV0A 1S08A 2AY9A 4EB5A 2YCNA 4IYOA 2BIAA 4F5JA 4ZM3A 2JJFA 2VMVA 1X28A 3MC6A 5EUEA 1GC2A 3DXVA 1W23A 2ZC0A 2CJDA 1AKCA 2QBTA 1EG5A 2YOBA 3K7YA 2D5YA 2E7IA 4WYCA 1VP4A 3B1DA 5EUDA 1RVYA 1D7SA 3CQ4A 1ASCA 1M4NA 1N2TA 1YOOA 4PVFA 4E3RA 1S06A 3NX3A 4B98A 3DU4A 3EI8A 2CFBA 2E7UA 4ISYA 3PD6B 2GMSA 1Z3ZA 2Z61A 5C6UA 2Z9XA 4XJOA 3KKIA 3E2ZB 4UHMA 3AENB 3A8UX 4IXSA 3WGCA 2YCTA 1V2FA 2OKKA 1TOJA 2OKJA 1G7XA 2YKXA 4P3MA 5FT8A 1M6SA 1P3WA 2VIAA 4P7YA 4Y0HA 4IYOB 3FZ6A 3WY7A 4A00A 2CINA 3DZZA 3GSBA 2YRRA 4WYAA 5F8VA 1PMMA 2CY8A 2BIGA 1FC4A 1D7VA 3FQ7A 1ASFA 5EQCA 4A6TA 4GEBA 3HMUA 1IX8A 2HP2A 1WYTA 1J32A 4RKDA 1JF9A 1AAWA 1YNUA 4MKKA 3CBFA 2VMQA 2X5FA 3B46A 3CQ6A 2CH1A 2VMPA 5FT5A 1B4XA 3E77A 4MQPA 2BI5A 1IJIA 4W1WA 4WXBA 4ZM4A 4WXFA
chains in the Genus database with same CATH superfamily
1ASAA 5DJ9A 1PMOA 2VLFA 1X29A 1I48A 3PA9A 5D5SA 2AY8A 3TFTA 1SPAA 2W7DA 3B8XA 2EPJA 3G0TA 4ZAHA 3BB8A 3WGBA 4LW4A 4WB0A 2XH1A 4QGRA 5K8BA 1AKBA 1FG3A 1GEXA 1BJWA 3II0A 1C7GA 1D7RA 3JZLA 2W7GA 1DFOA 1ZC9A 3B1CA 4LW2A 1ARHA 1T3IA 2PO3A 5HXXA 3LVMA 4IXOA 1ASGA 3FQ8A 4WYDA 1WKGA 4ADEA 1TARA 4H51A 1VJOA 1B9HA 1AIAA 3WLXA 1GBNA 1SZKA 4RITA 5HHYA 2W7EA 4GE9A 2W7MA 3T32A 3I4JA 5M4BA 2OQXA 2VGVA 3H7FA 4K2IA 1AMQA 1E5EA 1ARTA 2C44A 4JE5D 2EZ2A 8AATA 2KFPA 3PDBA 1O61A 2X8UA 3TATA 4A6RA 2XBNA 1YJYA 2V0YA 4WB0B 3NU8A 1AMSA 2VMRA 2CJHA 2QLRA 3BCXA 3K40A 1M32A 4U1TA 5AX8A 2HUIA 1B8GA 4M2KA 3H9XA 1MDZA 5J8QA 2X3LA 3HLMA 3FQAA 1IAYA 1YIYA 3LV2A 3JWAA 3ATHA 2W7HA 1H0CA 3WZFA 2GMUA 4B9BA 3JTXA 4W1XA 4AO9A 2AY5A 3E2FA 2D7ZA 3FVSA 5FT6A 2D66A 3W1JA 3ISLA 1O62A 3A2BA 3EI6A 5DX5A 5G0AA 1CQ6A 1KL2A 2BYLA 4A0FA 4R2NA 1TOEA 5BJ4A 1WYUB 3CAIA 4MQRA 4MKJA 1ARGA 3NNKA 5IWQA 3WX9A 1ASLA 1H1CA 1ZODA 3AEPA 4W5KA 2VMUA 2BWNA 1OXPA 2VMSA 4MGRA 2QB2A 3E2ZA 3EZSA 2AATA 2FNUA 4EMYA 5M46A 4CXQA 2D63A 1V2EA 4Q6RA 1TASA 3PDXA 1G4XA 1MGVA 1TPLA 2YRIA 3EI5A 4FFCA 4TMRA 4WD2A 2JJHA 2VMTA 3E9KA 4GSAA 5G2QA 1O69A 1AAMA 2W8UA 3VP6A 3QN6A 1PFFA 2YCPA 4Q76A 4ZDPA 4AOAA 3P6KA 2JJEA 1KKJA 1KL1A 2VMZA 2VGSA 2W7KA 4RKCA 4WLJA 4ADBA 3WCOA 4F5MA 1AY8A 3WKSA 2BI9A 4F5IA 3RCHA 2AEUA 1CZCA 3AATA 2EYQA 4O6ZA 5EIGA 4WLHA 3PIUA 4XJLA 4F5LA 4J8LA 1IBJA 3MAUA 4XJMA 3H14A 1AHXA 1ZOBA 1CL1A 1ASEA 3BCAA 1QJ3A 3HT4A 4ADCA 4BHDA 1RVUA 1XI9A 1EQBA 1OXOA 2VGTA 3ECDA 3ZZKA 1M7YA 1QISA 2R2NA 3QGUA 3RBFA 4EB7A 1YIZA 3FDDA 1BW0A 3GBXA 1C7NA 3LWSA 3ASAA 4BMKA 4JE5A 1CQ8A 3AEJA 1AICA 3DXWA 1OHYA 1JG8A 1LC5A 2HUUA 4Y0DA 1SVVA 2RFVA 2TPLA 4ADDA 4JEVA 1M0OA 4ZDOA 4BA5A 1KKPA 2HORA 1DTYA 4F4EA 3PPLA 1ASNA 3GZCA 1LC8A 1Y4IA 3FFHA 3ZRQA 3AEOA 4U2HA 2ZYJA 3RCHB 3QI6A 2AY7A 2R5CA 3MAFA 1C4KA 3MC6C 5EIGB 2O1BA 4BQ0A 1MDOA 3LY1A 3IHJA 4RLGA 1BJNA 2AY6A 3BC8A 1B5OA 4JEYA 2WK7A 3ELEA 3MKJA 4ZSYA 2DKBA 9AATA 3ZRPA 1GDEA 3UAKA 2BWPA 2W8WA 2YKUA 1YJZA 2AY3A 4Q31A 2G7JA 3LVLB 1UU2A 1AHEA 2Z9UA 3K28A 2C0RA 1AKAA 1ARSA 4KYOA 5M49A 4R8DA 5HDMA 4JF1A 4MSOA 1D2FA 2BI2A 2BKWA 2FQ6A 1ASBA 3LVKA 3N5MA 4K2BA 4AZJA 1CS1A 2C7TA 1J04A 3F6TA 3HVYA 4DQ6A 1ECXA 5EAAA 4ITGA 4OYTA 4OCAA 1SZUA 2W7JA 4XJPA 1BQDA 5TF5A 4E3QA 3W1IA 4J5UA 3PGYA 3BCBA 2W7LA 2D64A 1QITA 2VMXA 5G09A 5DJ1A 1TATA 2CJGA 3AEJC 2WB6A 4LNLA 1X0MA 1LS3A 2VGWA 5EFSA 3MAFB 2R5CB 1W7NA 2GB3A 3KGXA 3N75A 3L44A 4XQ2A 3E6GA 1KMKA 3DC1A 4UHOA 2AEVA 2HZPA 2OGAA 2D65A 3LG0A 1SFFA 2VMWA 4PFNA 1W7MA 4A72A 5DB5A 1BKGA 1OHWA 2WK8A 2BYJA 3N4XA 1S07A 2DGMA 4WP0A 3COGA 3GETA 3NDNA 2VIBA 3FSLA 3OKSA 4ITXA 4AH3A 5JAYA 1WYUA 3AEMA 4AO4A 3MEBA 4K2MA 3VOMA 4L0OA 2E7JA 4W1VA 1B9IA 1DGEA 1N31A 1I43A 4K05A 1I41A 4OBUA 4ZASA 2CANA 5D95A 4HF8A 2GSAA 3DR7A 2HUFA 4OTLA 3N4RA 4OC9A 1AY5A 3JW9A 1B5PA 1LW5A 1AY4A 4WXGA 1LKCA 3HQTA 3BN1A 4ATPA 1YJSA 4JEXA 1ELUA 2WKAA 1AJRA 1DJUA 2ZY5A 2VMNA 2PB0A 2VGUA 4LNJA 2O7CA 2Q7WA 3EIBA 3VAXA 4DGTA 2W8VA 3EI7A 4W91A 3TCMA 4GRXA 3RUYA 1QIRA 1S0AA 3NYUA 4A0HA 4DBCA 3OP7A 2AY2A 2Z1YA 3E2YA 5KTBA 2EGYA 5E3KA 3HL2A 4H63Q 1W7LA 1GD9A 3GJUA 4HVKA 4WYGA 5I92A 1AMAA 3W1HA 1JS3A 2QB3A 1M0NA 1BJ4A 1CZEA 1MLYA 3BWNA 3AEMC 3AV7A 3N4SA 4JEWA 3G7QA 1OATA 1UKJA 3EI9A 4IY7A 5E5IA 3A9XA 4EFFA 4OMAA 1TOIA 3FDBA 3FD0A 3FKDA 4R5ZA 1LK9A 2FYFA 2YHKA 4KAMA 1UU0A 4JF0A 2BI3A 3NRAA 2VYCA 3QHXA 2F8JA 2ZY3A 1M0QA 3D6KA 3QPGA 5G4IA 3AELA 4R5FA 4FL0A 3A9YA 2FM1A 4I8AA 1N8PA 1BJOA 4XAUA 3JU7A 1E5FA 2JISA 3RQ1A 1PG8A 1CQ7A 3ZZJA 1QJ5A 2YKYA 1BQAA 4A0GA 2W8TA 4F5GA 3NUBA 1WYVA 1JS6A 2DOUA 4A0RA 3WKRA 2VMOA 4RIZA 2WK9A 2HOYA 3NYSA 4ZLVA 2OGEA 3RI6A 4F5HA 3GWPA 5F9SA 2Z67A 2ZP7A 4WYFA 3N0LA 4UOYA 1GC0A 1RV4A 2G6WA 2BHXA 2VI8A 3BWNC 1Z7DA 1LW4A 1IX7A 3FFRA 4ATQA 2DKJA 4JEZA 1C7OA 4KXKA 4RJ0A 2HOZA 4TN4A 3A9ZA 3TQXA 4N0WA 2VMYA 4ZSWA 4NOGA 1SF2A 3UE8A 1BJOB 4Q75A 2VI9A 1OHVA 4M2JA 2EZ1A 5EAVA 1GC3A 2ZUKA 3ELPA 3TFUA 2OATA 3ACZA 1AJSA 1V2DA 5E4ZA 1C9CA 3JWBA 1O4SA 3P1TA 4WYEA 2AY1A 1EJIA 3FRKA 4GE4A 2EH6A 3G8MA 1WYVB 4IX8A 4N0BA 1AMRA 2W8JA 2HP1A 2JJGA 3AOWA 7AATA 2VGZA 4E1OA 2W7FA 2V1PA 3HDOA 4TV7A 3NUIA 4RAEA 1AIBA 1MLZA 3F0HA 1M0PA 3IF2A 1ELQA 3LVJA 4XEWA 3AOVA 1S09A 3I5TA 1GC4A 1IUGA 3BWOA 1G4VA 1I29A 4A6UA 1D7UA 1W3UA 4M2MA 2Z9WA 3FVUA 2AY4A 1AHGA 3HBXA 2ZY4A 3EIAA 3QM2A 1ARIA 3DYDA 1CL2A 2DGLA 3NTJA 2ZY2A 3DR4A 1WSTA 4IXZA 1GEYA 1YAAA 1ASMA 3MADA 2W7IA 1AJSB 2VLHA 1DKAA 3GZDA 3PAAA 3FVXA 3PJ0A 1WKHA 2HOXA 3ASBA 2R0TA 3CQ5A 2D61A 1DJEA 1G7WA 2CB1A 3EUCA 1WYTB 2CH2A 3Q8NA 3R9AA 3RBLA 1TOGA 1VEFA 2O0RA 2R5EA 3QBOA 4LNMA 3FZ7A 4LC3A 3VK2A 4RJYA 2ORDA 2Z9VA 4ZWMA 1QGNA 1AX4A 1C0NA 3L8AA 2BI1A 1IVRA 2QMAA 4CVQA 4CXRA 5BJ3A 1TOKA 1QZ9A 4RM1A 1LC7A 2CTZA 4AZKA 1UU1A 3WCNA 3FTBA 4IW7A 4OBVA 3VK4A 1MAQA 2QA3A 4ZDLA 5M4DA 5G4JA 4F5FA 3DRDA 4PFFA 2EO5A 4UHNA 5LH9A 2BWOA 2PB2A 2FNIA 2X5DA 4GE7A 1ASDA 4GDYA 2D7YA 3B1EA 1IAXA 2YKVA 3F9TA 4CBSA 2JG2A 5LHAA 3DODA 2DGKA 4E77A 3I16A 2ZSMA 4EU1A 2NMPA 2Z20A 2QSRA 3FCRA 3MBBA 1X2AA 3M5UA 3KGWA 1GEWA 1XEYA 2ZSLA 3ZRRA 1DGDA 2E54A 2GQNA 1MDXA 1MAPA 4XK1A 1GCKA 3NYTA 4BA4A 4Y0IA 1IX6A 3GZDC 5EUNA 1V72A 2JGTA 4W8IA 1RV3A 4CBRA 2DR1A 3USFA 4F5KA 1BT4A 3FZ8A 3R4TA 2BIEA 1AHYA 3BS8A 2FN6A 4UQVA 5FT4A 2ZJGA 4ZWVA 1KMJA 3PD6A 3KE3A 2CSTA 1CJ0A 1BS0A 4MY5A 3EZ1A 4PIWA 1ORDA 3PDBB 1AHFA 1FG7A 4OT8A 4MQQA 4WBTA 3UWCA 1U08A 3GR9A 1SZSA 1DJ9A 5G2PA 2C81A 3AENA 2Z1ZA 3NU7A 3VK3A 3BV0A 1S08A 3N7NA 2AY9A 4EB5A 2YCNA 4IYOA 2BIAA 4F5JA 4ZM3A 2JJFA 2VMVA 1X28A 3MC6A 5EUEA 1GC2A 3DXVA 1W23A 2ZC0A 2CJDA 1AKCA 2QBTA 1EG5A 2YOBA 3K7YA 2D5YA 2E7IA 4WYCA 1VP4A 3B1DA 5EUDA 1RVYA 1D7SA 3CQ4A 1ASCA 1M4NA 1N2TA 1YOOA 4PVFA 4E3RA 1S06A 3NX3A 4B98A 2FKIA 3DU4A 3EI8A 2CFBA 2E7UA 4ISYA 3PD6B 2GMSA 1Z3ZA 2Z61A 5C6UA 2Z9XA 4XJOA 3KKIA 3E2ZB 4UHMA 3AENB 3A8UX 4IXSA 3WGCA 2YCTA 1V2FA 2OKKA 1TOJA 2OKJA 1G7XA 2YKXA 4P3MA 5FT8A 2A1VA 1M6SA 1P3WA 2VIAA 4P7YA 4Y0HA 4IYOB 3FZ6A 3WY7A 4A00A 2CINA 3DZZA 3GSBA 2YRRA 4WYAA 5F8VA 1PMMA 2CY8A 2BIGA 1FC4A 1D7VA 3FQ7A 1ASFA 5EQCA 4A6TA 4GEBA 3HMUA 1IX8A 2HP2A 1WYTA 1J32A 1KAFA 4RKDA 1JF9A 1AAWA 1YNUA 4MKKA 3CBFA 2VMQA 2X5FA 3B46A 3CQ6A 2CH1A 2VMPA 5FT5A 1B4XA 3E77A 4MQPA 2BI5A 1IJIA 4W1WA 4WXBA 4ZM4A 4WXFA
chains in the Genus database with same CATH topology
1ASAA 5DJ9A 1PMOA 2VLFA 1X29A 1I48A 3PA9A 5D5SA 2AY8A 3TFTA 1SPAA 2W7DA 3B8XA 2EPJA 3G0TA 4ZAHA 3BB8A 3WGBA 4LW4A 4WB0A 2XH1A 4QGRA 5K8BA 1AKBA 1FG3A 1GEXA 1BJWA 3II0A 1C7GA 1D7RA 3JZLA 2W7GA 1DFOA 1ZC9A 3B1CA 4LW2A 1ARHA 1T3IA 2PO3A 5HXXA 3LVMA 4IXOA 1ASGA 3FQ8A 4WYDA 1WKGA 4ADEA 1TARA 4H51A 1VJOA 1B9HA 1AIAA 3WLXA 1GBNA 1SZKA 4RITA 5HHYA 2W7EA 4GE9A 2W7MA 3T32A 3I4JA 5M4BA 2OQXA 2VGVA 3H7FA 4K2IA 1AMQA 1E5EA 1ARTA 2C44A 4JE5D 2EZ2A 8AATA 2KFPA 3PDBA 1O61A 2X8UA 3TATA 4A6RA 2XBNA 1YJYA 2V0YA 4WB0B 3NU8A 1AMSA 2VMRA 2CJHA 2QLRA 3BCXA 3K40A 1M32A 4U1TA 5AX8A 2HUIA 1B8GA 4M2KA 3H9XA 1MDZA 5J8QA 2X3LA 3HLMA 3FQAA 1IAYA 1YIYA 3LV2A 3JWAA 3ATHA 2W7HA 1H0CA 3WZFA 2GMUA 4B9BA 3JTXA 4W1XA 4AO9A 2AY5A 3E2FA 2D7ZA 3FVSA 5FT6A 2D66A 3W1JA 3ISLA 1O62A 3A2BA 3EI6A 5DX5A 5G0AA 1CQ6A 1KL2A 2BYLA 4A0FA 4R2NA 1TOEA 5BJ4A 1WYUB 3CAIA 4MQRA 4MKJA 1ARGA 3NNKA 5IWQA 3WX9A 1ASLA 1H1CA 1ZODA 3AEPA 4W5KA 2VMUA 2BWNA 1OXPA 2VMSA 4MGRA 2QB2A 3E2ZA 3EZSA 2AATA 2FNUA 4EMYA 5M46A 4CXQA 2D63A 1V2EA 4Q6RA 1TASA 3PDXA 1G4XA 1MGVA 1TPLA 2YRIA 3EI5A 4FFCA 4TMRA 4WD2A 2JJHA 2VMTA 3E9KA 4GSAA 5G2QA 1O69A 1AAMA 2W8UA 3VP6A 3QN6A 1PFFA 2YCPA 4Q76A 4ZDPA 4AOAA 3P6KA 2JJEA 1KKJA 1KL1A 2VMZA 2VGSA 2W7KA 4RKCA 4WLJA 4ADBA 3WCOA 4F5MA 1AY8A 3WKSA 2BI9A 4F5IA 3RCHA 2AEUA 1CZCA 3AATA 2EYQA 4O6ZA 5EIGA 4WLHA 3PIUA 4XJLA 4F5LA 4J8LA 1IBJA 3MAUA 4XJMA 3H14A 1AHXA 1ZOBA 1CL1A 1ASEA 3BCAA 1QJ3A 3HT4A 4ADCA 4BHDA 1RVUA 1XI9A 1EQBA 1OXOA 2VGTA 3ECDA 3ZZKA 1M7YA 1QISA 2R2NA 3QGUA 3RBFA 4EB7A 1YIZA 3FDDA 1BW0A 3GBXA 1C7NA 3LWSA 3ASAA 4BMKA 4JE5A 1CQ8A 3AEJA 1AICA 3DXWA 1OHYA 1JG8A 1LC5A 2HUUA 4Y0DA 1SVVA 2RFVA 2TPLA 4ADDA 4JEVA 1M0OA 4ZDOA 4BA5A 1KKPA 2HORA 1DTYA 4F4EA 3PPLA 1ASNA 3GZCA 1LC8A 1Y4IA 3FFHA 3ZRQA 3AEOA 4U2HA 2ZYJA 3RCHB 3QI6A 2AY7A 2R5CA 3MAFA 1C4KA 3MC6C 5EIGB 2O1BA 4BQ0A 1MDOA 3LY1A 3IHJA 4RLGA 1BJNA 2AY6A 3BC8A 1B5OA 4JEYA 2WK7A 3ELEA 3MKJA 4ZSYA 2DKBA 9AATA 3ZRPA 1GDEA 3UAKA 2BWPA 2W8WA 2YKUA 1YJZA 2AY3A 4Q31A 2G7JA 3LVLB 1UU2A 1AHEA 2Z9UA 3K28A 2C0RA 1AKAA 1ARSA 4KYOA 5M49A 4R8DA 5HDMA 4JF1A 4MSOA 1D2FA 2BI2A 2BKWA 2FQ6A 1ASBA 3LVKA 3N5MA 4K2BA 4AZJA 1CS1A 2C7TA 1J04A 3F6TA 3HVYA 4DQ6A 1ECXA 5EAAA 4ITGA 4OYTA 4OCAA 1SZUA 2W7JA 4XJPA 1BQDA 5TF5A 4E3QA 3W1IA 4J5UA 3PGYA 3BCBA 2W7LA 2D64A 1QITA 2VMXA 5G09A 5DJ1A 1TATA 2CJGA 3AEJC 2WB6A 4LNLA 1X0MA 1LS3A 2VGWA 5EFSA 3MAFB 2R5CB 1W7NA 2GB3A 3KGXA 3N75A 3L44A 4XQ2A 3E6GA 1KMKA 3DC1A 4UHOA 2AEVA 2HZPA 2OGAA 2D65A 3LG0A 1SFFA 2VMWA 4PFNA 1W7MA 4A72A 5DB5A 1BKGA 1OHWA 2WK8A 2BYJA 3N4XA 1S07A 2DGMA 4WP0A 3COGA 3GETA 3NDNA 2VIBA 3FSLA 3OKSA 4ITXA 4AH3A 5JAYA 1WYUA 3AEMA 4AO4A 3MEBA 4K2MA 3VOMA 4L0OA 2E7JA 4W1VA 1B9IA 1DGEA 1N31A 1I43A 4K05A 1I41A 4OBUA 4ZASA 2CANA 5D95A 4HF8A 2GSAA 3DR7A 2HUFA 4OTLA 3N4RA 4OC9A 1AY5A 3JW9A 1B5PA 1LW5A 1AY4A 4WXGA 1LKCA 3HQTA 3BN1A 4ATPA 1YJSA 4JEXA 1ELUA 2WKAA 1AJRA 1DJUA 2ZY5A 2VMNA 2PB0A 2VGUA 4LNJA 2O7CA 2Q7WA 3EIBA 3VAXA 4DGTA 2W8VA 3EI7A 4W91A 3TCMA 4GRXA 3RUYA 1QIRA 1S0AA 3NYUA 4A0HA 4DBCA 3OP7A 2AY2A 2Z1YA 3E2YA 5KTBA 2EGYA 5E3KA 3HL2A 4H63Q 1W7LA 1GD9A 3GJUA 4HVKA 4WYGA 5I92A 1AMAA 3W1HA 1JS3A 2QB3A 1M0NA 1BJ4A 1CZEA 1MLYA 3BWNA 3AEMC 3AV7A 3N4SA 4JEWA 3G7QA 1OATA 1UKJA 3EI9A 4IY7A 5E5IA 3A9XA 4EFFA 4OMAA 1TOIA 3FDBA 3FD0A 3FKDA 4R5ZA 1LK9A 2FYFA 2YHKA 4KAMA 1UU0A 4JF0A 2BI3A 3NRAA 2VYCA 3QHXA 2F8JA 2ZY3A 1M0QA 3D6KA 3QPGA 5G4IA 3AELA 4R5FA 4FL0A 3A9YA 2FM1A 4I8AA 1N8PA 1BJOA 4XAUA 3JU7A 1E5FA 2JISA 3RQ1A 1PG8A 1CQ7A 3ZZJA 1QJ5A 2YKYA 1BQAA 4A0GA 2W8TA 4F5GA 3NUBA 1WYVA 1JS6A 2DOUA 4A0RA 3WKRA 2VMOA 4RIZA 2WK9A 2HOYA 3NYSA 4ZLVA 2OGEA 3RI6A 4F5HA 3GWPA 5F9SA 2Z67A 2ZP7A 4WYFA 3N0LA 4UOYA 1GC0A 1RV4A 2G6WA 2BHXA 2VI8A 3BWNC 1Z7DA 1LW4A 1IX7A 3FFRA 4ATQA 2DKJA 4JEZA 1C7OA 4KXKA 4RJ0A 2HOZA 4TN4A 3A9ZA 3TQXA 4N0WA 2VMYA 4ZSWA 4NOGA 1SF2A 3UE8A 1BJOB 4Q75A 2VI9A 1OHVA 4M2JA 2EZ1A 5EAVA 1GC3A 2ZUKA 3ELPA 3TFUA 2OATA 3ACZA 1AJSA 1V2DA 5E4ZA 1C9CA 3JWBA 1O4SA 3P1TA 4WYEA 2AY1A 1EJIA 3FRKA 4GE4A 2EH6A 3G8MA 1WYVB 4IX8A 4N0BA 1AMRA 2W8JA 2HP1A 2JJGA 3AOWA 7AATA 2VGZA 4E1OA 2W7FA 2V1PA 3HDOA 4TV7A 3NUIA 4RAEA 1AIBA 1MLZA 3F0HA 1M0PA 3IF2A 1ELQA 3LVJA 4XEWA 3AOVA 1S09A 3I5TA 1GC4A 1IUGA 3BWOA 1G4VA 1I29A 4A6UA 1D7UA 1W3UA 4M2MA 2Z9WA 3FVUA 2AY4A 1AHGA 3HBXA 2ZY4A 3EIAA 3QM2A 1ARIA 3DYDA 1CL2A 2DGLA 3NTJA 2ZY2A 3DR4A 1WSTA 4IXZA 1GEYA 1YAAA 1ASMA 3MADA 2W7IA 1AJSB 2VLHA 1DKAA 3GZDA 3PAAA 3FVXA 3PJ0A 1WKHA 2HOXA 3ASBA 2R0TA 3CQ5A 2D61A 1DJEA 1G7WA 2CB1A 3EUCA 1WYTB 2CH2A 3Q8NA 3R9AA 3RBLA 1TOGA 1VEFA 2O0RA 2R5EA 3QBOA 4LNMA 3FZ7A 4LC3A 3VK2A 4RJYA 2ORDA 2Z9VA 4ZWMA 1QGNA 1AX4A 1C0NA 3L8AA 2BI1A 1IVRA 2QMAA 4CVQA 4CXRA 5BJ3A 1TOKA 1QZ9A 4RM1A 1LC7A 2CTZA 4AZKA 1UU1A 3WCNA 3FTBA 4IW7A 4OBVA 3VK4A 1MAQA 2QA3A 4ZDLA 5M4DA 5G4JA 4F5FA 3DRDA 4PFFA 2EO5A 4UHNA 5LH9A 2BWOA 2PB2A 2FNIA 2X5DA 4GE7A 1ASDA 4GDYA 2D7YA 3B1EA 1IAXA 2YKVA 3F9TA 4CBSA 2JG2A 5LHAA 3DODA 2DGKA 4E77A 3I16A 2ZSMA 4EU1A 2NMPA 2Z20A 2QSRA 3FCRA 3MBBA 1X2AA 3M5UA 3KGWA 1GEWA 1XEYA 2ZSLA 3ZRRA 1DGDA 2E54A 2GQNA 1MDXA 1MAPA 4XK1A 1GCKA 3NYTA 4BA4A 4Y0IA 1IX6A 3GZDC 5EUNA 1V72A 2JGTA 4W8IA 1RV3A 4CBRA 2DR1A 3USFA 4F5KA 1BT4A 3FZ8A 3R4TA 2BIEA 1AHYA 3BS8A 2FN6A 4UQVA 5FT4A 2ZJGA 4ZWVA 1KMJA 3PD6A 3KE3A 2CSTA 1CJ0A 1BS0A 4MY5A 3EZ1A 4PIWA 1ORDA 3PDBB 1AHFA 1FG7A 4OT8A 4MQQA 4WBTA 3UWCA 1U08A 3GR9A 1SZSA 1DJ9A 5G2PA 2C81A 3AENA 2Z1ZA 3NU7A 3VK3A 3BV0A 1S08A 3N7NA 2AY9A 4EB5A 2YCNA 4IYOA 2BIAA 4F5JA 4ZM3A 2JJFA 2VMVA 1X28A 3MC6A 5EUEA 1GC2A 3DXVA 1W23A 2ZC0A 2CJDA 1AKCA 2QBTA 1EG5A 2YOBA 3K7YA 2D5YA 2E7IA 4WYCA 1VP4A 3B1DA 5EUDA 1RVYA 1D7SA 3CQ4A 1ASCA 1M4NA 1N2TA 1YOOA 4PVFA 4E3RA 1S06A 3NX3A 4B98A 2FKIA 3DU4A 3EI8A 2CFBA 2E7UA 4ISYA 3PD6B 2GMSA 1Z3ZA 2Z61A 5C6UA 2Z9XA 4XJOA 3KKIA 3E2ZB 4UHMA 3AENB 3A8UX 4IXSA 3WGCA 2YCTA 1V2FA 2OKKA 1TOJA 2OKJA 1G7XA 2YKXA 4P3MA 5FT8A 2A1VA 1M6SA 1P3WA 2VIAA 4P7YA 4Y0HA 4IYOB 3FZ6A 3WY7A 4A00A 2CINA 3DZZA 3GSBA 2YRRA 4WYAA 5F8VA 1PMMA 2CY8A 2BIGA 1FC4A 1D7VA 3FQ7A 1ASFA 5EQCA 4A6TA 4GEBA 3HMUA 1IX8A 2HP2A 1WYTA 1J32A 4RKDA 1JF9A 1AAWA 1YNUA 4MKKA 3CBFA 2VMQA 2X5FA 3B46A 3CQ6A 2CH1A 2VMPA 5FT5A 1B4XA 3E77A 4MQPA 2BI5A 1IJIA 4W1WA 4WXBA 4ZM4A 4WXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASA A;  5DJ9 A;  1PMO A;  2VLF A;  1X29 A;  1I48 A;  3PA9 A;  5D5S A;  2AY8 A;  3TFT A;  1SPA A;  2W7D A;  3B8X A;  2EPJ A;  3G0T A;  4ZAH A;  3BB8 A;  3WGB A;  4LW4 A;  4WB0 A;  2XH1 A;  4QGR A;  5K8B A;  1AKB A;  1FG3 A;  1GEX A;  1BJW A;  3II0 A;  1C7G A;  1D7R A;  3JZL A;  2W7G A;  1DFO A;  1ZC9 A;  3B1C A;  4LW2 A;  1ARH A;  1T3I A;  2PO3 A;  5HXX A;  3LVM A;  4IXO A;  1ASG A;  3FQ8 A;  4WYD A;  1WKG A;  4ADE A;  1TAR A;  4H51 A;  1VJO A;  1B9H A;  1AIA A;  3WLX A;  1GBN A;  1SZK A;  4RIT A;  5HHY A;  2W7E A;  4GE9 A;  2W7M A;  3T32 A;  3I4J A;  5M4B A;  2OQX A;  2VGV A;  3H7F A;  4K2I A;  1AMQ A;  1E5E A;  1ART A;  2C44 A;  4JE5 D;  2EZ2 A;  8AAT A;  3PDB A;  1O61 A;  2X8U A;  3TAT A;  4A6R A;  2XBN A;  1YJY A;  2V0Y A;  4WB0 B;  3NU8 A;  1AMS A;  2VMR A;  2CJH A;  2QLR A;  3BCX A;  3K40 A;  1M32 A;  4U1T A;  5AX8 A;  2HUI A;  1B8G A;  4M2K A;  1MDZ A;  5J8Q A;  2X3L A;  3HLM A;  3FQA A;  1IAY A;  1YIY A;  3LV2 A;  3JWA A;  3ATH A;  2W7H A;  1H0C A;  3WZF A;  2GMU A;  4B9B A;  3JTX A;  4W1X A;  4AO9 A;  2AY5 A;  3E2F A;  2D7Z A;  3FVS A;  5FT6 A;  2D66 A;  3W1J A;  3ISL A;  1O62 A;  3A2B A;  3EI6 A;  5DX5 A;  5G0A A;  1CQ6 A;  1KL2 A;  2BYL A;  4A0F A;  4R2N A;  1TOE A;  5BJ4 A;  1WYU B;  3CAI A;  4MQR A;  4MKJ A;  1ARG A;  3NNK A;  5IWQ A;  3WX9 A;  1ASL A;  1H1C A;  1ZOD A;  3AEP A;  4W5K A;  2VMU A;  2BWN A;  1OXP A;  2VMS A;  4MGR A;  2QB2 A;  3E2Z A;  3EZS A;  2AAT A;  2FNU A;  4EMY A;  5M46 A;  4CXQ A;  2D63 A;  1V2E A;  4Q6R A;  1TAS A;  3PDX A;  1G4X A;  1MGV A;  1TPL A;  2YRI A;  3EI5 A;  4FFC A;  4TMR A;  4WD2 A;  2JJH A;  2VMT A;  3E9K A;  4GSA A;  5G2Q A;  1O69 A;  1AAM A;  2W8U A;  3VP6 A;  3QN6 A;  1PFF A;  2YCP A;  4Q76 A;  4ZDP A;  4AOA A;  3P6K A;  2JJE A;  1KKJ A;  1KL1 A;  2VMZ A;  2VGS A;  2W7K A;  4RKC A;  4WLJ A;  4ADB A;  3WCO A;  4F5M A;  1AY8 A;  3WKS A;  2BI9 A;  4F5I A;  3RCH A;  2AEU A;  1CZC A;  3AAT A;  4O6Z A;  5EIG A;  4WLH A;  3PIU A;  4XJL A;  4F5L A;  4J8L A;  1IBJ A;  3MAU A;  4XJM A;  3H14 A;  1AHX A;  1ZOB A;  1CL1 A;  1ASE A;  3BCA A;  1QJ3 A;  3HT4 A;  4ADC A;  4BHD A;  1RVU A;  1XI9 A;  1EQB A;  1OXO A;  2VGT A;  3ECD A;  3ZZK A;  1M7Y A;  1QIS A;  2R2N A;  3QGU A;  3RBF A;  4EB7 A;  1YIZ A;  3FDD A;  1BW0 A;  3GBX A;  1C7N A;  3LWS A;  3ASA A;  4BMK A;  4JE5 A;  1CQ8 A;  3AEJ A;  1AIC A;  3DXW A;  1OHY A;  1JG8 A;  1LC5 A;  2HUU A;  4Y0D A;  1SVV A;  2RFV A;  2TPL A;  4ADD A;  4JEV A;  1M0O A;  4ZDO A;  4BA5 A;  1KKP A;  2HOR A;  1DTY A;  4F4E A;  3PPL A;  1ASN A;  3GZC A;  1LC8 A;  1Y4I A;  3FFH A;  3ZRQ A;  3AEO A;  4U2H A;  2ZYJ A;  3RCH B;  3QI6 A;  2AY7 A;  2R5C A;  3MAF A;  1C4K A;  3MC6 C;  5EIG B;  2O1B A;  4BQ0 A;  1MDO A;  3LY1 A;  3IHJ A;  4RLG A;  1BJN A;  2AY6 A;  3BC8 A;  1B5O A;  4JEY A;  2WK7 A;  3ELE A;  3MKJ A;  4ZSY A;  2DKB A;  9AAT A;  3ZRP A;  1GDE A;  3UAK A;  2BWP A;  2W8W A;  2YKU A;  1YJZ A;  2AY3 A;  4Q31 A;  3LVL B;  1UU2 A;  1AHE A;  2Z9U A;  3K28 A;  2C0R A;  1AKA A;  1ARS A;  4KYO A;  5M49 A;  4R8D A;  5HDM A;  4JF1 A;  4MSO A;  1D2F A;  2BI2 A;  2BKW A;  2FQ6 A;  1ASB A;  3LVK A;  3N5M A;  4K2B A;  4AZJ A;  1CS1 A;  2C7T A;  1J04 A;  3F6T A;  3HVY A;  4DQ6 A;  1ECX A;  5EAA A;  4ITG A;  4OYT A;  4OCA A;  1SZU A;  2W7J A;  4XJP A;  1BQD A;  5TF5 A;  4E3Q A;  3W1I A;  4J5U A;  3PGY A;  3BCB A;  2W7L A;  2D64 A;  1QIT A;  2VMX A;  5G09 A;  5DJ1 A;  1TAT A;  2CJG A;  3AEJ C;  4LNL A;  1X0M A;  1LS3 A;  2VGW A;  5EFS A;  3MAF B;  2R5C B;  1W7N A;  2GB3 A;  3KGX A;  3N75 A;  3L44 A;  4XQ2 A;  3E6G A;  1KMK A;  3DC1 A;  4UHO A;  2AEV A;  2HZP A;  2OGA A;  2D65 A;  3LG0 A;  1SFF A;  2VMW A;  4PFN A;  1W7M A;  4A72 A;  5DB5 A;  1BKG A;  1OHW A;  2WK8 A;  2BYJ A;  1S07 A;  2DGM A;  4WP0 A;  3COG A;  3GET A;  3NDN A;  2VIB A;  3FSL A;  3OKS A;  4ITX A;  4AH3 A;  5JAY A;  1WYU A;  3AEM A;  4AO4 A;  3MEB A;  4K2M A;  3VOM A;  4L0O A;  2E7J A;  4W1V A;  1B9I A;  1DGE A;  1N31 A;  1I43 A;  1I41 A;  4OBU A;  4ZAS A;  2CAN A;  5D95 A;  4HF8 A;  2GSA A;  3DR7 A;  2HUF A;  4OTL A;  4OC9 A;  1AY5 A;  3JW9 A;  1B5P A;  1LW5 A;  1AY4 A;  4WXG A;  1LKC A;  3HQT A;  3BN1 A;  4ATP A;  1YJS A;  4JEX A;  1ELU A;  2WKA A;  1AJR A;  1DJU A;  2ZY5 A;  2VMN A;  2PB0 A;  2VGU A;  4LNJ A;  2O7C A;  2Q7W A;  3EIB A;  3VAX A;  4DGT A;  2W8V A;  3EI7 A;  4W91 A;  3TCM A;  4GRX A;  3RUY A;  1QIR A;  1S0A A;  3NYU A;  4A0H A;  4DBC A;  3OP7 A;  2AY2 A;  2Z1Y A;  3E2Y A;  2EGY A;  5E3K A;  3HL2 A;  1W7L A;  1GD9 A;  3GJU A;  4HVK A;  4WYG A;  5I92 A;  1AMA A;  3W1H A;  1JS3 A;  2QB3 A;  1M0N A;  1BJ4 A;  1CZE A;  1MLY A;  3BWN A;  3AEM C;  3AV7 A;  4JEW A;  3G7Q A;  1OAT A;  1UKJ A;  3EI9 A;  4IY7 A;  5E5I A;  3A9X A;  4EFF A;  4OMA A;  1TOI A;  3FDB A;  3FD0 A;  3FKD A;  4R5Z A;  1LK9 A;  2FYF A;  2YHK A;  4KAM A;  1UU0 A;  4JF0 A;  2BI3 A;  3NRA A;  2VYC A;  3QHX A;  2F8J A;  2ZY3 A;  1M0Q A;  3D6K A;  3QPG A;  5G4I A;  3AEL A;  4R5F A;  4FL0 A;  3A9Y A;  2FM1 A;  4I8A A;  1N8P A;  1BJO A;  4XAU A;  3JU7 A;  1E5F A;  2JIS A;  3RQ1 A;  1PG8 A;  1CQ7 A;  3ZZJ A;  1QJ5 A;  2YKY A;  1BQA A;  4A0G A;  2W8T A;  4F5G A;  3NUB A;  1WYV A;  1JS6 A;  2DOU A;  4A0R A;  3WKR A;  2VMO A;  4RIZ A;  2WK9 A;  2HOY A;  3NYS A;  4ZLV A;  2OGE A;  3RI6 A;  4F5H A;  3GWP A;  5F9S A;  2Z67 A;  2ZP7 A;  4WYF A;  3N0L A;  4UOY A;  1GC0 A;  1RV4 A;  2G6W A;  2BHX A;  2VI8 A;  3BWN C;  1Z7D A;  1LW4 A;  1IX7 A;  3FFR A;  4ATQ A;  2DKJ A;  4JEZ A;  1C7O A;  4KXK A;  4RJ0 A;  2HOZ A;  4TN4 A;  3A9Z A;  3TQX A;  4N0W A;  2VMY A;  4ZSW A;  4NOG A;  1SF2 A;  3UE8 A;  1BJO B;  4Q75 A;  2VI9 A;  1OHV A;  4M2J A;  2EZ1 A;  5EAV A;  1GC3 A;  2ZUK A;  3ELP A;  3TFU A;  2OAT A;  3ACZ A;  1AJS A;  1V2D A;  5E4Z A;  1C9C A;  3JWB A;  1O4S A;  3P1T A;  4WYE A;  2AY1 A;  1EJI A;  3FRK A;  4GE4 A;  2EH6 A;  3G8M A;  1WYV B;  4IX8 A;  4N0B A;  1AMR A;  2W8J A;  2HP1 A;  2JJG A;  3AOW A;  7AAT A;  2VGZ A;  4E1O A;  2W7F A;  2V1P A;  3HDO A;  4TV7 A;  3NUI A;  4RAE A;  1AIB A;  1MLZ A;  3F0H A;  1M0P A;  3IF2 A;  1ELQ A;  3LVJ A;  4XEW A;  3AOV A;  1S09 A;  3I5T A;  1GC4 A;  1IUG A;  3BWO A;  1G4V A;  1I29 A;  4A6U A;  1D7U A;  1W3U A;  4M2M A;  2Z9W A;  3FVU A;  2AY4 A;  1AHG A;  3HBX A;  2ZY4 A;  3EIA A;  3QM2 A;  1ARI A;  3DYD A;  1CL2 A;  2DGL A;  3NTJ A;  2ZY2 A;  3DR4 A;  1WST A;  4IXZ A;  1GEY A;  1YAA A;  1ASM A;  3MAD A;  2W7I A;  1AJS B;  2VLH A;  1DKA A;  3GZD A;  3PAA A;  3FVX A;  3PJ0 A;  1WKH A;  2HOX A;  3ASB A;  2R0T A;  3CQ5 A;  2D61 A;  1DJE A;  1G7W A;  2CB1 A;  3EUC A;  1WYT B;  2CH2 A;  3Q8N A;  3R9A A;  3RBL A;  1TOG A;  1VEF A;  2O0R A;  2R5E A;  3QBO A;  4LNM A;  3FZ7 A;  4LC3 A;  3VK2 A;  4RJY A;  2ORD A;  2Z9V A;  4ZWM A;  1QGN A;  1AX4 A;  1C0N A;  3L8A A;  2BI1 A;  1IVR A;  2QMA A;  4CVQ A;  4CXR A;  5BJ3 A;  1TOK A;  1QZ9 A;  4RM1 A;  1LC7 A;  2CTZ A;  4AZK A;  1UU1 A;  3WCN A;  3FTB A;  4IW7 A;  4OBV A;  3VK4 A;  1MAQ A;  2QA3 A;  4ZDL A;  5M4D A;  5G4J A;  4F5F A;  3DRD A;  4PFF A;  2EO5 A;  4UHN A;  5LH9 A;  2BWO A;  2PB2 A;  2FNI A;  2X5D A;  4GE7 A;  1ASD A;  4GDY A;  2D7Y A;  3B1E A;  1IAX A;  2YKV A;  3F9T A;  4CBS A;  2JG2 A;  5LHA A;  3DOD A;  2DGK A;  4E77 A;  3I16 A;  2ZSM A;  4EU1 A;  2NMP A;  2Z20 A;  3FCR A;  3MBB A;  1X2A A;  3M5U A;  3KGW A;  1GEW A;  1XEY A;  2ZSL A;  3ZRR A;  1DGD A;  2E54 A;  2GQN A;  1MDX A;  1MAP A;  4XK1 A;  1GCK A;  3NYT A;  4BA4 A;  4Y0I A;  1IX6 A;  3GZD C;  5EUN A;  1V72 A;  2JGT A;  4W8I A;  1RV3 A;  4CBR A;  2DR1 A;  3USF A;  4F5K A;  1BT4 A;  3FZ8 A;  3R4T A;  2BIE A;  1AHY A;  3BS8 A;  2FN6 A;  4UQV A;  5FT4 A;  2ZJG A;  4ZWV A;  1KMJ A;  3PD6 A;  3KE3 A;  2CST A;  1CJ0 A;  1BS0 A;  4MY5 A;  3EZ1 A;  4PIW A;  1ORD A;  3PDB B;  1AHF A;  1FG7 A;  4OT8 A;  4MQQ A;  4WBT A;  3UWC A;  1U08 A;  3GR9 A;  1SZS A;  1DJ9 A;  5G2P A;  2C81 A;  3AEN A;  2Z1Z A;  3NU7 A;  3VK3 A;  3BV0 A;  1S08 A;  2AY9 A;  4EB5 A;  2YCN A;  4IYO A;  2BIA A;  4F5J A;  4ZM3 A;  2JJF A;  2VMV A;  1X28 A;  3MC6 A;  5EUE A;  1GC2 A;  3DXV A;  1W23 A;  2ZC0 A;  2CJD A;  1AKC A;  2QBT A;  1EG5 A;  2YOB A;  3K7Y A;  2D5Y A;  2E7I A;  4WYC A;  1VP4 A;  3B1D A;  5EUD A;  1RVY A;  1D7S A;  3CQ4 A;  1ASC A;  1M4N A;  1N2T A;  1YOO A;  4PVF A;  4E3R A;  1S06 A;  3NX3 A;  4B98 A;  3DU4 A;  3EI8 A;  2CFB A;  2E7U A;  4ISY A;  3PD6 B;  2GMS A;  1Z3Z A;  2Z61 A;  5C6U A;  2Z9X A;  4XJO A;  3KKI A;  3E2Z B;  4UHM A;  3AEN B;  3A8U X;  4IXS A;  3WGC A;  2YCT A;  1V2F A;  2OKK A;  1TOJ A;  2OKJ A;  1G7X A;  2YKX A;  4P3M A;  5FT8 A;  1M6S A;  1P3W A;  2VIA A;  4P7Y A;  4Y0H A;  4IYO B;  3FZ6 A;  3WY7 A;  4A00 A;  2CIN A;  3DZZ A;  3GSB A;  2YRR A;  4WYA A;  5F8V A;  1PMM A;  2CY8 A;  2BIG A;  1FC4 A;  1D7V A;  3FQ7 A;  1ASF A;  5EQC A;  4A6T A;  4GEB A;  3HMU A;  1IX8 A;  2HP2 A;  1WYT A;  1J32 A;  4RKD A;  1JF9 A;  1AAW A;  1YNU A;  4MKK A;  3CBF A;  2VMQ A;  2X5F A;  3B46 A;  3CQ6 A;  2CH1 A;  2VMP A;  5FT5 A;  1B4X A;  3E77 A;  4MQP A;  2BI5 A;  1IJI A;  4W1W A;  4WXB A;  4ZM4 A;  4WXF A; 
#chains in the Genus database with same CATH topology
 1ASA A;  5DJ9 A;  1PMO A;  2VLF A;  1X29 A;  1I48 A;  3PA9 A;  5D5S A;  2AY8 A;  3TFT A;  1SPA A;  2W7D A;  3B8X A;  2EPJ A;  3G0T A;  4ZAH A;  3BB8 A;  3WGB A;  4LW4 A;  4WB0 A;  2XH1 A;  4QGR A;  5K8B A;  1AKB A;  1FG3 A;  1GEX A;  1BJW A;  3II0 A;  1C7G A;  1D7R A;  3JZL A;  2W7G A;  1DFO A;  1ZC9 A;  3B1C A;  4LW2 A;  1ARH A;  1T3I A;  2PO3 A;  5HXX A;  3LVM A;  4IXO A;  1ASG A;  3FQ8 A;  4WYD A;  1WKG A;  4ADE A;  1TAR A;  4H51 A;  1VJO A;  1B9H A;  1AIA A;  3WLX A;  1GBN A;  1SZK A;  4RIT A;  5HHY A;  2W7E A;  4GE9 A;  2W7M A;  3T32 A;  3I4J A;  5M4B A;  2OQX A;  2VGV A;  3H7F A;  4K2I A;  1AMQ A;  1E5E A;  1ART A;  2C44 A;  4JE5 D;  2EZ2 A;  8AAT A;  2KFP A;  3PDB A;  1O61 A;  2X8U A;  3TAT A;  4A6R A;  2XBN A;  1YJY A;  2V0Y A;  4WB0 B;  3NU8 A;  1AMS A;  2VMR A;  2CJH A;  2QLR A;  3BCX A;  3K40 A;  1M32 A;  4U1T A;  5AX8 A;  2HUI A;  1B8G A;  4M2K A;  3H9X A;  1MDZ A;  5J8Q A;  2X3L A;  3HLM A;  3FQA A;  1IAY A;  1YIY A;  3LV2 A;  3JWA A;  3ATH A;  2W7H A;  1H0C A;  3WZF A;  2GMU A;  4B9B A;  3JTX A;  4W1X A;  4AO9 A;  2AY5 A;  3E2F A;  2D7Z A;  3FVS A;  5FT6 A;  2D66 A;  3W1J A;  3ISL A;  1O62 A;  3A2B A;  3EI6 A;  5DX5 A;  5G0A A;  1CQ6 A;  1KL2 A;  2BYL A;  4A0F A;  4R2N A;  1TOE A;  5BJ4 A;  1WYU B;  3CAI A;  4MQR A;  4MKJ A;  1ARG A;  3NNK A;  5IWQ A;  3WX9 A;  1ASL A;  1H1C A;  1ZOD A;  3AEP A;  4W5K A;  2VMU A;  2BWN A;  1OXP A;  2VMS A;  4MGR A;  2QB2 A;  3E2Z A;  3EZS A;  2AAT A;  2FNU A;  4EMY A;  5M46 A;  4CXQ A;  2D63 A;  1V2E A;  4Q6R A;  1TAS A;  3PDX A;  1G4X A;  1MGV A;  1TPL A;  2YRI A;  3EI5 A;  4FFC A;  4TMR A;  4WD2 A;  2JJH A;  2VMT A;  3E9K A;  4GSA A;  5G2Q A;  1O69 A;  1AAM A;  2W8U A;  3VP6 A;  3QN6 A;  1PFF A;  2YCP A;  4Q76 A;  4ZDP A;  4AOA A;  3P6K A;  2JJE A;  1KKJ A;  1KL1 A;  2VMZ A;  2VGS A;  2W7K A;  4RKC A;  4WLJ A;  4ADB A;  3WCO A;  4F5M A;  1AY8 A;  3WKS A;  2BI9 A;  4F5I A;  3RCH A;  2AEU A;  1CZC A;  3AAT A;  2EYQ A;  4O6Z A;  5EIG A;  4WLH A;  3PIU A;  4XJL A;  4F5L A;  4J8L A;  1IBJ A;  3MAU A;  4XJM A;  3H14 A;  1AHX A;  1ZOB A;  1CL1 A;  1ASE A;  3BCA A;  1QJ3 A;  3HT4 A;  4ADC A;  4BHD A;  1RVU A;  1XI9 A;  1EQB A;  1OXO A;  2VGT A;  3ECD A;  3ZZK A;  1M7Y A;  1QIS A;  2R2N A;  3QGU A;  3RBF A;  4EB7 A;  1YIZ A;  3FDD A;  1BW0 A;  3GBX A;  1C7N A;  3LWS A;  3ASA A;  4BMK A;  4JE5 A;  1CQ8 A;  3AEJ A;  1AIC A;  3DXW A;  1OHY A;  1JG8 A;  1LC5 A;  2HUU A;  4Y0D A;  1SVV A;  2RFV A;  2TPL A;  4ADD A;  4JEV A;  1M0O A;  4ZDO A;  4BA5 A;  1KKP A;  2HOR A;  1DTY A;  4F4E A;  3PPL A;  1ASN A;  3GZC A;  1LC8 A;  1Y4I A;  3FFH A;  3ZRQ A;  3AEO A;  4U2H A;  2ZYJ A;  3RCH B;  3QI6 A;  2AY7 A;  2R5C A;  3MAF A;  1C4K A;  3MC6 C;  5EIG B;  2O1B A;  4BQ0 A;  1MDO A;  3LY1 A;  3IHJ A;  4RLG A;  1BJN A;  2AY6 A;  3BC8 A;  1B5O A;  4JEY A;  2WK7 A;  3ELE A;  3MKJ A;  4ZSY A;  2DKB A;  9AAT A;  3ZRP A;  1GDE A;  3UAK A;  2BWP A;  2W8W A;  2YKU A;  1YJZ A;  2AY3 A;  4Q31 A;  2G7J A;  3LVL B;  1UU2 A;  1AHE A;  2Z9U A;  3K28 A;  2C0R A;  1AKA A;  1ARS A;  4KYO A;  5M49 A;  4R8D A;  5HDM A;  4JF1 A;  4MSO A;  1D2F A;  2BI2 A;  2BKW A;  2FQ6 A;  1ASB A;  3LVK A;  3N5M A;  4K2B A;  4AZJ A;  1CS1 A;  2C7T A;  1J04 A;  3F6T A;  3HVY A;  4DQ6 A;  1ECX A;  5EAA A;  4ITG A;  4OYT A;  4OCA A;  1SZU A;  2W7J A;  4XJP A;  1BQD A;  5TF5 A;  4E3Q A;  3W1I A;  4J5U A;  3PGY A;  3BCB A;  2W7L A;  2D64 A;  1QIT A;  2VMX A;  5G09 A;  5DJ1 A;  1TAT A;  2CJG A;  3AEJ C;  2WB6 A;  4LNL A;  1X0M A;  1LS3 A;  2VGW A;  5EFS A;  3MAF B;  2R5C B;  1W7N A;  2GB3 A;  3KGX A;  3N75 A;  3L44 A;  4XQ2 A;  3E6G A;  1KMK A;  3DC1 A;  4UHO A;  2AEV A;  2HZP A;  2OGA A;  2D65 A;  3LG0 A;  1SFF A;  2VMW A;  4PFN A;  1W7M A;  4A72 A;  5DB5 A;  1BKG A;  1OHW A;  2WK8 A;  2BYJ A;  3N4X A;  1S07 A;  2DGM A;  4WP0 A;  3COG A;  3GET A;  3NDN A;  2VIB A;  3FSL A;  3OKS A;  4ITX A;  4AH3 A;  5JAY A;  1WYU A;  3AEM A;  4AO4 A;  3MEB A;  4K2M A;  3VOM A;  4L0O A;  2E7J A;  4W1V A;  1B9I A;  1DGE A;  1N31 A;  1I43 A;  4K05 A;  1I41 A;  4OBU A;  4ZAS A;  2CAN A;  5D95 A;  4HF8 A;  2GSA A;  3DR7 A;  2HUF A;  4OTL A;  3N4R A;  4OC9 A;  1AY5 A;  3JW9 A;  1B5P A;  1LW5 A;  1AY4 A;  4WXG A;  1LKC A;  3HQT A;  3BN1 A;  4ATP A;  1YJS A;  4JEX A;  1ELU A;  2WKA A;  1AJR A;  1DJU A;  2ZY5 A;  2VMN A;  2PB0 A;  2VGU A;  4LNJ A;  2O7C A;  2Q7W A;  3EIB A;  3VAX A;  4DGT A;  2W8V A;  3EI7 A;  4W91 A;  3TCM A;  4GRX A;  3RUY A;  1QIR A;  1S0A A;  3NYU A;  4A0H A;  4DBC A;  3OP7 A;  2AY2 A;  2Z1Y A;  3E2Y A;  5KTB A;  2EGY A;  5E3K A;  3HL2 A;  4H63 Q;  1W7L A;  1GD9 A;  3GJU A;  4HVK A;  4WYG A;  5I92 A;  1AMA A;  3W1H A;  1JS3 A;  2QB3 A;  1M0N A;  1BJ4 A;  1CZE A;  1MLY A;  3BWN A;  3AEM C;  3AV7 A;  3N4S A;  4JEW A;  3G7Q A;  1OAT A;  1UKJ A;  3EI9 A;  4IY7 A;  5E5I A;  3A9X A;  4EFF A;  4OMA A;  1TOI A;  3FDB A;  3FD0 A;  3FKD A;  4R5Z A;  1LK9 A;  2FYF A;  2YHK A;  4KAM A;  1UU0 A;  4JF0 A;  2BI3 A;  3NRA A;  2VYC A;  3QHX A;  2F8J A;  2ZY3 A;  1M0Q A;  3D6K A;  3QPG A;  5G4I A;  3AEL A;  4R5F A;  4FL0 A;  3A9Y A;  2FM1 A;  4I8A A;  1N8P A;  1BJO A;  4XAU A;  3JU7 A;  1E5F A;  2JIS A;  3RQ1 A;  1PG8 A;  1CQ7 A;  3ZZJ A;  1QJ5 A;  2YKY A;  1BQA A;  4A0G A;  2W8T A;  4F5G A;  3NUB A;  1WYV A;  1JS6 A;  2DOU A;  4A0R A;  3WKR A;  2VMO A;  4RIZ A;  2WK9 A;  2HOY A;  3NYS A;  4ZLV A;  2OGE A;  3RI6 A;  4F5H A;  3GWP A;  5F9S A;  2Z67 A;  2ZP7 A;  4WYF A;  3N0L A;  4UOY A;  1GC0 A;  1RV4 A;  2G6W A;  2BHX A;  2VI8 A;  3BWN C;  1Z7D A;  1LW4 A;  1IX7 A;  3FFR A;  4ATQ A;  2DKJ A;  4JEZ A;  1C7O A;  4KXK A;  4RJ0 A;  2HOZ A;  4TN4 A;  3A9Z A;  3TQX A;  4N0W A;  2VMY A;  4ZSW A;  4NOG A;  1SF2 A;  3UE8 A;  1BJO B;  4Q75 A;  2VI9 A;  1OHV A;  4M2J A;  2EZ1 A;  5EAV A;  1GC3 A;  2ZUK A;  3ELP A;  3TFU A;  2OAT A;  3ACZ A;  1AJS A;  1V2D A;  5E4Z A;  1C9C A;  3JWB A;  1O4S A;  3P1T A;  4WYE A;  2AY1 A;  1EJI A;  3FRK A;  4GE4 A;  2EH6 A;  3G8M A;  1WYV B;  4IX8 A;  4N0B A;  1AMR A;  2W8J A;  2HP1 A;  2JJG A;  3AOW A;  7AAT A;  2VGZ A;  4E1O A;  2W7F A;  2V1P A;  3HDO A;  4TV7 A;  3NUI A;  4RAE A;  1AIB A;  1MLZ A;  3F0H A;  1M0P A;  3IF2 A;  1ELQ A;  3LVJ A;  4XEW A;  3AOV A;  1S09 A;  3I5T A;  1GC4 A;  1IUG A;  3BWO A;  1G4V A;  1I29 A;  4A6U A;  1D7U A;  1W3U A;  4M2M A;  2Z9W A;  3FVU A;  2AY4 A;  1AHG A;  3HBX A;  2ZY4 A;  3EIA A;  3QM2 A;  1ARI A;  3DYD A;  1CL2 A;  2DGL A;  3NTJ A;  2ZY2 A;  3DR4 A;  1WST A;  4IXZ A;  1GEY A;  1YAA A;  1ASM A;  3MAD A;  2W7I A;  1AJS B;  2VLH A;  1DKA A;  3GZD A;  3PAA A;  3FVX A;  3PJ0 A;  1WKH A;  2HOX A;  3ASB A;  2R0T A;  3CQ5 A;  2D61 A;  1DJE A;  1G7W A;  2CB1 A;  3EUC A;  1WYT B;  2CH2 A;  3Q8N A;  3R9A A;  3RBL A;  1TOG A;  1VEF A;  2O0R A;  2R5E A;  3QBO A;  4LNM A;  3FZ7 A;  4LC3 A;  3VK2 A;  4RJY A;  2ORD A;  2Z9V A;  4ZWM A;  1QGN A;  1AX4 A;  1C0N A;  3L8A A;  2BI1 A;  1IVR A;  2QMA A;  4CVQ A;  4CXR A;  5BJ3 A;  1TOK A;  1QZ9 A;  4RM1 A;  1LC7 A;  2CTZ A;  4AZK A;  1UU1 A;  3WCN A;  3FTB A;  4IW7 A;  4OBV A;  3VK4 A;  1MAQ A;  2QA3 A;  4ZDL A;  5M4D A;  5G4J A;  4F5F A;  3DRD A;  4PFF A;  2EO5 A;  4UHN A;  5LH9 A;  2BWO A;  2PB2 A;  2FNI A;  2X5D A;  4GE7 A;  1ASD A;  4GDY A;  2D7Y A;  3B1E A;  1IAX A;  2YKV A;  3F9T A;  4CBS A;  2JG2 A;  5LHA A;  3DOD A;  2DGK A;  4E77 A;  3I16 A;  2ZSM A;  4EU1 A;  2NMP A;  2Z20 A;  2QSR A;  3FCR A;  3MBB A;  1X2A A;  3M5U A;  3KGW A;  1GEW A;  1XEY A;  2ZSL A;  3ZRR A;  1DGD A;  2E54 A;  2GQN A;  1MDX A;  1MAP A;  4XK1 A;  1GCK A;  3NYT A;  4BA4 A;  4Y0I A;  1IX6 A;  3GZD C;  5EUN A;  1V72 A;  2JGT A;  4W8I A;  1RV3 A;  4CBR A;  2DR1 A;  3USF A;  4F5K A;  1BT4 A;  3FZ8 A;  3R4T A;  2BIE A;  1AHY A;  3BS8 A;  2FN6 A;  4UQV A;  5FT4 A;  2ZJG A;  4ZWV A;  1KMJ A;  3PD6 A;  3KE3 A;  2CST A;  1CJ0 A;  1BS0 A;  4MY5 A;  3EZ1 A;  4PIW A;  1ORD A;  3PDB B;  1AHF A;  1FG7 A;  4OT8 A;  4MQQ A;  4WBT A;  3UWC A;  1U08 A;  3GR9 A;  1SZS A;  1DJ9 A;  5G2P A;  2C81 A;  3AEN A;  2Z1Z A;  3NU7 A;  3VK3 A;  3BV0 A;  1S08 A;  3N7N A;  2AY9 A;  4EB5 A;  2YCN A;  4IYO A;  2BIA A;  4F5J A;  4ZM3 A;  2JJF A;  2VMV A;  1X28 A;  3MC6 A;  5EUE A;  1GC2 A;  3DXV A;  1W23 A;  2ZC0 A;  2CJD A;  1AKC A;  2QBT A;  1EG5 A;  2YOB A;  3K7Y A;  2D5Y A;  2E7I A;  4WYC A;  1VP4 A;  3B1D A;  5EUD A;  1RVY A;  1D7S A;  3CQ4 A;  1ASC A;  1M4N A;  1N2T A;  1YOO A;  4PVF A;  4E3R A;  1S06 A;  3NX3 A;  4B98 A;  2FKI A;  3DU4 A;  3EI8 A;  2CFB A;  2E7U A;  4ISY A;  3PD6 B;  2GMS A;  1Z3Z A;  2Z61 A;  5C6U A;  2Z9X A;  4XJO A;  3KKI A;  3E2Z B;  4UHM A;  3AEN B;  3A8U X;  4IXS A;  3WGC A;  2YCT A;  1V2F A;  2OKK A;  1TOJ A;  2OKJ A;  1G7X A;  2YKX A;  4P3M A;  5FT8 A;  2A1V A;  1M6S A;  1P3W A;  2VIA A;  4P7Y A;  4Y0H A;  4IYO B;  3FZ6 A;  3WY7 A;  4A00 A;  2CIN A;  3DZZ A;  3GSB A;  2YRR A;  4WYA A;  5F8V A;  1PMM A;  2CY8 A;  2BIG A;  1FC4 A;  1D7V A;  3FQ7 A;  1ASF A;  5EQC A;  4A6T A;  4GEB A;  3HMU A;  1IX8 A;  2HP2 A;  1WYT A;  1J32 A;  1KAF A;  4RKD A;  1JF9 A;  1AAW A;  1YNU A;  4MKK A;  3CBF A;  2VMQ A;  2X5F A;  3B46 A;  3CQ6 A;  2CH1 A;  2VMP A;  5FT5 A;  1B4X A;  3E77 A;  4MQP A;  2BI5 A;  1IJI A;  4W1W A;  4WXB A;  4ZM4 A;  4WXF A; 
#chains in the Genus database with same CATH homology
 1ASA A;  5DJ9 A;  1PMO A;  2VLF A;  1X29 A;  1I48 A;  3PA9 A;  5D5S A;  2AY8 A;  3TFT A;  1SPA A;  2W7D A;  3B8X A;  2EPJ A;  3G0T A;  4ZAH A;  3BB8 A;  3WGB A;  4LW4 A;  4WB0 A;  2XH1 A;  4QGR A;  5K8B A;  1AKB A;  1FG3 A;  1GEX A;  1BJW A;  3II0 A;  1C7G A;  1D7R A;  3JZL A;  2W7G A;  1DFO A;  1ZC9 A;  3B1C A;  4LW2 A;  1ARH A;  1T3I A;  2PO3 A;  5HXX A;  3LVM A;  4IXO A;  1ASG A;  3FQ8 A;  4WYD A;  1WKG A;  4ADE A;  1TAR A;  4H51 A;  1VJO A;  1B9H A;  1AIA A;  3WLX A;  1GBN A;  1SZK A;  4RIT A;  5HHY A;  2W7E A;  4GE9 A;  2W7M A;  3T32 A;  3I4J A;  5M4B A;  2OQX A;  2VGV A;  3H7F A;  4K2I A;  1AMQ A;  1E5E A;  1ART A;  2C44 A;  4JE5 D;  2EZ2 A;  8AAT A;  2KFP A;  3PDB A;  1O61 A;  2X8U A;  3TAT A;  4A6R A;  2XBN A;  1YJY A;  2V0Y A;  4WB0 B;  3NU8 A;  1AMS A;  2VMR A;  2CJH A;  2QLR A;  3BCX A;  3K40 A;  1M32 A;  4U1T A;  5AX8 A;  2HUI A;  1B8G A;  4M2K A;  3H9X A;  1MDZ A;  5J8Q A;  2X3L A;  3HLM A;  3FQA A;  1IAY A;  1YIY A;  3LV2 A;  3JWA A;  3ATH A;  2W7H A;  1H0C A;  3WZF A;  2GMU A;  4B9B A;  3JTX A;  4W1X A;  4AO9 A;  2AY5 A;  3E2F A;  2D7Z A;  3FVS A;  5FT6 A;  2D66 A;  3W1J A;  3ISL A;  1O62 A;  3A2B A;  3EI6 A;  5DX5 A;  5G0A A;  1CQ6 A;  1KL2 A;  2BYL A;  4A0F A;  4R2N A;  1TOE A;  5BJ4 A;  1WYU B;  3CAI A;  4MQR A;  4MKJ A;  1ARG A;  3NNK A;  5IWQ A;  3WX9 A;  1ASL A;  1H1C A;  1ZOD A;  3AEP A;  4W5K A;  2VMU A;  2BWN A;  1OXP A;  2VMS A;  4MGR A;  2QB2 A;  3E2Z A;  3EZS A;  2AAT A;  2FNU A;  4EMY A;  5M46 A;  4CXQ A;  2D63 A;  1V2E A;  4Q6R A;  1TAS A;  3PDX A;  1G4X A;  1MGV A;  1TPL A;  2YRI A;  3EI5 A;  4FFC A;  4TMR A;  4WD2 A;  2JJH A;  2VMT A;  3E9K A;  4GSA A;  5G2Q A;  1O69 A;  1AAM A;  2W8U A;  3VP6 A;  3QN6 A;  1PFF A;  2YCP A;  4Q76 A;  4ZDP A;  4AOA A;  3P6K A;  2JJE A;  1KKJ A;  1KL1 A;  2VMZ A;  2VGS A;  2W7K A;  4RKC A;  4WLJ A;  4ADB A;  3WCO A;  4F5M A;  1AY8 A;  3WKS A;  2BI9 A;  4F5I A;  3RCH A;  2AEU A;  1CZC A;  3AAT A;  2EYQ A;  4O6Z A;  5EIG A;  4WLH A;  3PIU A;  4XJL A;  4F5L A;  4J8L A;  1IBJ A;  3MAU A;  4XJM A;  3H14 A;  1AHX A;  1ZOB A;  1CL1 A;  1ASE A;  3BCA A;  1QJ3 A;  3HT4 A;  4ADC A;  4BHD A;  1RVU A;  1XI9 A;  1EQB A;  1OXO A;  2VGT A;  3ECD A;  3ZZK A;  1M7Y A;  1QIS A;  2R2N A;  3QGU A;  3RBF A;  4EB7 A;  1YIZ A;  3FDD A;  1BW0 A;  3GBX A;  1C7N A;  3LWS A;  3ASA A;  4BMK A;  4JE5 A;  1CQ8 A;  3AEJ A;  1AIC A;  3DXW A;  1OHY A;  1JG8 A;  1LC5 A;  2HUU A;  4Y0D A;  1SVV A;  2RFV A;  2TPL A;  4ADD A;  4JEV A;  1M0O A;  4ZDO A;  4BA5 A;  1KKP A;  2HOR A;  1DTY A;  4F4E A;  3PPL A;  1ASN A;  3GZC A;  1LC8 A;  1Y4I A;  3FFH A;  3ZRQ A;  3AEO A;  4U2H A;  2ZYJ A;  3RCH B;  3QI6 A;  2AY7 A;  2R5C A;  3MAF A;  1C4K A;  3MC6 C;  5EIG B;  2O1B A;  4BQ0 A;  1MDO A;  3LY1 A;  3IHJ A;  4RLG A;  1BJN A;  2AY6 A;  3BC8 A;  1B5O A;  4JEY A;  2WK7 A;  3ELE A;  3MKJ A;  4ZSY A;  2DKB A;  9AAT A;  3ZRP A;  1GDE A;  3UAK A;  2BWP A;  2W8W A;  2YKU A;  1YJZ A;  2AY3 A;  4Q31 A;  2G7J A;  3LVL B;  1UU2 A;  1AHE A;  2Z9U A;  3K28 A;  2C0R A;  1AKA A;  1ARS A;  4KYO A;  5M49 A;  4R8D A;  5HDM A;  4JF1 A;  4MSO A;  1D2F A;  2BI2 A;  2BKW A;  2FQ6 A;  1ASB A;  3LVK A;  3N5M A;  4K2B A;  4AZJ A;  1CS1 A;  2C7T A;  1J04 A;  3F6T A;  3HVY A;  4DQ6 A;  1ECX A;  5EAA A;  4ITG A;  4OYT A;  4OCA A;  1SZU A;  2W7J A;  4XJP A;  1BQD A;  5TF5 A;  4E3Q A;  3W1I A;  4J5U A;  3PGY A;  3BCB A;  2W7L A;  2D64 A;  1QIT A;  2VMX A;  5G09 A;  5DJ1 A;  1TAT A;  2CJG A;  3AEJ C;  2WB6 A;  4LNL A;  1X0M A;  1LS3 A;  2VGW A;  5EFS A;  3MAF B;  2R5C B;  1W7N A;  2GB3 A;  3KGX A;  3N75 A;  3L44 A;  4XQ2 A;  3E6G A;  1KMK A;  3DC1 A;  4UHO A;  2AEV A;  2HZP A;  2OGA A;  2D65 A;  3LG0 A;  1SFF A;  2VMW A;  4PFN A;  1W7M A;  4A72 A;  5DB5 A;  1BKG A;  1OHW A;  2WK8 A;  2BYJ A;  3N4X A;  1S07 A;  2DGM A;  4WP0 A;  3COG A;  3GET A;  3NDN A;  2VIB A;  3FSL A;  3OKS A;  4ITX A;  4AH3 A;  5JAY A;  1WYU A;  3AEM A;  4AO4 A;  3MEB A;  4K2M A;  3VOM A;  4L0O A;  2E7J A;  4W1V A;  1B9I A;  1DGE A;  1N31 A;  1I43 A;  4K05 A;  1I41 A;  4OBU A;  4ZAS A;  2CAN A;  5D95 A;  4HF8 A;  2GSA A;  3DR7 A;  2HUF A;  4OTL A;  3N4R A;  4OC9 A;  1AY5 A;  3JW9 A;  1B5P A;  1LW5 A;  1AY4 A;  4WXG A;  1LKC A;  3HQT A;  3BN1 A;  4ATP A;  1YJS A;  4JEX A;  1ELU A;  2WKA A;  1AJR A;  1DJU A;  2ZY5 A;  2VMN A;  2PB0 A;  2VGU A;  4LNJ A;  2O7C A;  2Q7W A;  3EIB A;  3VAX A;  4DGT A;  2W8V A;  3EI7 A;  4W91 A;  3TCM A;  4GRX A;  3RUY A;  1QIR A;  1S0A A;  3NYU A;  4A0H A;  4DBC A;  3OP7 A;  2AY2 A;  2Z1Y A;  3E2Y A;  5KTB A;  2EGY A;  5E3K A;  3HL2 A;  4H63 Q;  1W7L A;  1GD9 A;  3GJU A;  4HVK A;  4WYG A;  5I92 A;  1AMA A;  3W1H A;  1JS3 A;  2QB3 A;  1M0N A;  1BJ4 A;  1CZE A;  1MLY A;  3BWN A;  3AEM C;  3AV7 A;  3N4S A;  4JEW A;  3G7Q A;  1OAT A;  1UKJ A;  3EI9 A;  4IY7 A;  5E5I A;  3A9X A;  4EFF A;  4OMA A;  1TOI A;  3FDB A;  3FD0 A;  3FKD A;  4R5Z A;  1LK9 A;  2FYF A;  2YHK A;  4KAM A;  1UU0 A;  4JF0 A;  2BI3 A;  3NRA A;  2VYC A;  3QHX A;  2F8J A;  2ZY3 A;  1M0Q A;  3D6K A;  3QPG A;  5G4I A;  3AEL A;  4R5F A;  4FL0 A;  3A9Y A;  2FM1 A;  4I8A A;  1N8P A;  1BJO A;  4XAU A;  3JU7 A;  1E5F A;  2JIS A;  3RQ1 A;  1PG8 A;  1CQ7 A;  3ZZJ A;  1QJ5 A;  2YKY A;  1BQA A;  4A0G A;  2W8T A;  4F5G A;  3NUB A;  1WYV A;  1JS6 A;  2DOU A;  4A0R A;  3WKR A;  2VMO A;  4RIZ A;  2WK9 A;  2HOY A;  3NYS A;  4ZLV A;  2OGE A;  3RI6 A;  4F5H A;  3GWP A;  5F9S A;  2Z67 A;  2ZP7 A;  4WYF A;  3N0L A;  4UOY A;  1GC0 A;  1RV4 A;  2G6W A;  2BHX A;  2VI8 A;  3BWN C;  1Z7D A;  1LW4 A;  1IX7 A;  3FFR A;  4ATQ A;  2DKJ A;  4JEZ A;  1C7O A;  4KXK A;  4RJ0 A;  2HOZ A;  4TN4 A;  3A9Z A;  3TQX A;  4N0W A;  2VMY A;  4ZSW A;  4NOG A;  1SF2 A;  3UE8 A;  1BJO B;  4Q75 A;  2VI9 A;  1OHV A;  4M2J A;  2EZ1 A;  5EAV A;  1GC3 A;  2ZUK A;  3ELP A;  3TFU A;  2OAT A;  3ACZ A;  1AJS A;  1V2D A;  5E4Z A;  1C9C A;  3JWB A;  1O4S A;  3P1T A;  4WYE A;  2AY1 A;  1EJI A;  3FRK A;  4GE4 A;  2EH6 A;  3G8M A;  1WYV B;  4IX8 A;  4N0B A;  1AMR A;  2W8J A;  2HP1 A;  2JJG A;  3AOW A;  7AAT A;  2VGZ A;  4E1O A;  2W7F A;  2V1P A;  3HDO A;  4TV7 A;  3NUI A;  4RAE A;  1AIB A;  1MLZ A;  3F0H A;  1M0P A;  3IF2 A;  1ELQ A;  3LVJ A;  4XEW A;  3AOV A;  1S09 A;  3I5T A;  1GC4 A;  1IUG A;  3BWO A;  1G4V A;  1I29 A;  4A6U A;  1D7U A;  1W3U A;  4M2M A;  2Z9W A;  3FVU A;  2AY4 A;  1AHG A;  3HBX A;  2ZY4 A;  3EIA A;  3QM2 A;  1ARI A;  3DYD A;  1CL2 A;  2DGL A;  3NTJ A;  2ZY2 A;  3DR4 A;  1WST A;  4IXZ A;  1GEY A;  1YAA A;  1ASM A;  3MAD A;  2W7I A;  1AJS B;  2VLH A;  1DKA A;  3GZD A;  3PAA A;  3FVX A;  3PJ0 A;  1WKH A;  2HOX A;  3ASB A;  2R0T A;  3CQ5 A;  2D61 A;  1DJE A;  1G7W A;  2CB1 A;  3EUC A;  1WYT B;  2CH2 A;  3Q8N A;  3R9A A;  3RBL A;  1TOG A;  1VEF A;  2O0R A;  2R5E A;  3QBO A;  4LNM A;  3FZ7 A;  4LC3 A;  3VK2 A;  4RJY A;  2ORD A;  2Z9V A;  4ZWM A;  1QGN A;  1AX4 A;  1C0N A;  3L8A A;  2BI1 A;  1IVR A;  2QMA A;  4CVQ A;  4CXR A;  5BJ3 A;  1TOK A;  1QZ9 A;  4RM1 A;  1LC7 A;  2CTZ A;  4AZK A;  1UU1 A;  3WCN A;  3FTB A;  4IW7 A;  4OBV A;  3VK4 A;  1MAQ A;  2QA3 A;  4ZDL A;  5M4D A;  5G4J A;  4F5F A;  3DRD A;  4PFF A;  2EO5 A;  4UHN A;  5LH9 A;  2BWO A;  2PB2 A;  2FNI A;  2X5D A;  4GE7 A;  1ASD A;  4GDY A;  2D7Y A;  3B1E A;  1IAX A;  2YKV A;  3F9T A;  4CBS A;  2JG2 A;  5LHA A;  3DOD A;  2DGK A;  4E77 A;  3I16 A;  2ZSM A;  4EU1 A;  2NMP A;  2Z20 A;  2QSR A;  3FCR A;  3MBB A;  1X2A A;  3M5U A;  3KGW A;  1GEW A;  1XEY A;  2ZSL A;  3ZRR A;  1DGD A;  2E54 A;  2GQN A;  1MDX A;  1MAP A;  4XK1 A;  1GCK A;  3NYT A;  4BA4 A;  4Y0I A;  1IX6 A;  3GZD C;  5EUN A;  1V72 A;  2JGT A;  4W8I A;  1RV3 A;  4CBR A;  2DR1 A;  3USF A;  4F5K A;  1BT4 A;  3FZ8 A;  3R4T A;  2BIE A;  1AHY A;  3BS8 A;  2FN6 A;  4UQV A;  5FT4 A;  2ZJG A;  4ZWV A;  1KMJ A;  3PD6 A;  3KE3 A;  2CST A;  1CJ0 A;  1BS0 A;  4MY5 A;  3EZ1 A;  4PIW A;  1ORD A;  3PDB B;  1AHF A;  1FG7 A;  4OT8 A;  4MQQ A;  4WBT A;  3UWC A;  1U08 A;  3GR9 A;  1SZS A;  1DJ9 A;  5G2P A;  2C81 A;  3AEN A;  2Z1Z A;  3NU7 A;  3VK3 A;  3BV0 A;  1S08 A;  3N7N A;  2AY9 A;  4EB5 A;  2YCN A;  4IYO A;  2BIA A;  4F5J A;  4ZM3 A;  2JJF A;  2VMV A;  1X28 A;  3MC6 A;  5EUE A;  1GC2 A;  3DXV A;  1W23 A;  2ZC0 A;  2CJD A;  1AKC A;  2QBT A;  1EG5 A;  2YOB A;  3K7Y A;  2D5Y A;  2E7I A;  4WYC A;  1VP4 A;  3B1D A;  5EUD A;  1RVY A;  1D7S A;  3CQ4 A;  1ASC A;  1M4N A;  1N2T A;  1YOO A;  4PVF A;  4E3R A;  1S06 A;  3NX3 A;  4B98 A;  2FKI A;  3DU4 A;  3EI8 A;  2CFB A;  2E7U A;  4ISY A;  3PD6 B;  2GMS A;  1Z3Z A;  2Z61 A;  5C6U A;  2Z9X A;  4XJO A;  3KKI A;  3E2Z B;  4UHM A;  3AEN B;  3A8U X;  4IXS A;  3WGC A;  2YCT A;  1V2F A;  2OKK A;  1TOJ A;  2OKJ A;  1G7X A;  2YKX A;  4P3M A;  5FT8 A;  2A1V A;  1M6S A;  1P3W A;  2VIA A;  4P7Y A;  4Y0H A;  4IYO B;  3FZ6 A;  3WY7 A;  4A00 A;  2CIN A;  3DZZ A;  3GSB A;  2YRR A;  4WYA A;  5F8V A;  1PMM A;  2CY8 A;  2BIG A;  1FC4 A;  1D7V A;  3FQ7 A;  1ASF A;  5EQC A;  4A6T A;  4GEB A;  3HMU A;  1IX8 A;  2HP2 A;  1WYT A;  1J32 A;  4RKD A;  1JF9 A;  1AAW A;  1YNU A;  4MKK A;  3CBF A;  2VMQ A;  2X5F A;  3B46 A;  3CQ6 A;  2CH1 A;  2VMP A;  5FT5 A;  1B4X A;  3E77 A;  4MQP A;  2BI5 A;  1IJI A;  4W1W A;  4WXB A;  4ZM4 A;  4WXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...