4F5FA

Structure of aspartate aminotransferase conversion to tyrosine aminotransferase: chimera p1.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
398
Chain Sequence
b'HVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVGADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Janus: prediction and ranking of mutations required for functional interconversion of enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 146
structure length 398
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f5fA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f5fA01
1S06A 4JEZA 3B1EA 2TPLA 3G7QA 4XJPA 1M0OA 4AOAA 4XAUA 1ASAA 2ZJGA 3I5TA 4BMKA 1BQAA 1FG3A 1V2EA 2QLRA 3FFHA 1XEYA 2W7KA 3E9KA 4WB0B 3QHXA 5HDMA 2HOZA 2AATA 4OYTA 1V2DA 4A0FA 3CBFA 3QGUA 3L44A 4P3MA 3E2ZA 4UQVA 2VMRA 2CH1A 3FVSA 4Q75A 7AATA 1ASDA 2D63A 3R9AA 1KMJA 1ARHA 3ZRPA 3L8AA 1SFFA 2W7EA 1TOIA 4Y0IA 2O7CA 3FTBA 3NU8A 5EAVA 4Y0HA 1WYTB 1JG8A 1QJ5A 1QIRA 1U08A 3WLXA 1H1CA 4A0HA 4UOYA 3B8XA 2BIEA 1KL1A 4Q6RA 1W7MA 2FNUA 3BWOA 4WLHA 1JS3A 4Q31A 1ASMA 3AOWA 4NOGA 1GC0A 1DGDA 3F0HA 3FD0A 4JE5D 2QB3A 3W1JA 1B9HA 3PIUA 4WYEA 1Z3ZA 4R5FA 3AEJC 1AKBA 5C6UA 3MAFA 1YIYA 4R5ZA 2CJDA 2D65A 2W8VA 3EI7A 3GZDA 2VMOA 1ZODA 3E77A 2DGMA 1AHXA 4ZAHA 2YKUA 2WKAA 4MY5A 2ZSLA 1H0CA 4BHDA 4TV7A 1IX7A 4CBSA 4F5MA 2ZY3A 1LW5A 1ASGA 1MDOA 1E5EA 1YIZA 2XBNA 2DGKA 3BCXA 4PVFA 2Z9VA 2YRRA 3CQ4A 4AO4A 5IWQA 3FFRA 1V2FA 2R5CB 2D61A 1I29A 1AMSA 3A2BA 2WK8A 3NUBA 4OBVA 8AATA 1KMKA 4XEWA 2PB0A 3LV2A 4LW4A 2YKXA 3BWNC 3F6TA 1CL1A 1D7RA 1O62A 2ZYJA 1M32A 1C7NA 2HP1A 2XH1A 1QZ9A 3DC1A 2FYFA 1OHVA 4AH3A 4UHNA 2EZ2A 3FKDA 4A00A 3H7FA 4K2BA 2W7JA 4WLJA 1CQ8A 2E7UA 5FT5A 1O61A 2OQXA 2VYCA 2AY6A 2CFBA 2Z67A 1IVRA 4Q76A 3I4JA 5F9SA 3NU7A 1JF9A 1WKGA 1Z7DA 3PJ0A 4JE5A 3PPLA 2GMSA 2W8TA 4EMYA 3RQ1A 4LNLA 4W5KA 4MKKA 1CZCA 4RKCA 2D66A 3I16A 2OATA 5F8VA 1EJIA 3VP6A 2HUUA 1CL2A 1J32A 5FT4A 2ORDA 4U1TA 1LC5A 2C0RA 3NYUA 5G4JA 3WGBA 3WX9A 4ADBA 4L0OA 1LC7A 1DGEA 3II0A 4ITXA 4WXBA 1BS0A 2OGAA 2VGVA 3HVYA 3HLMA 3EUCA 5E3KA 3HBXA 4WYDA 1X29A 3RBLA 1QGNA 3WCNA 5E4ZA 2FNIA 4RKDA 1S09A 1ORDA 3TFUA 1CS1A 2Z1YA 3VK2A 3K28A 3AENB 3ELEA 3HDOA 4LNMA 4I8AA 9AATA 4WYCA 4DQ6A 1ZOBA 1I43A 1AAWA 4GE7A 4J5UA 3GZCA 4OMAA 3KGWA 3FRKA 4IW7A 3EI9A 1ASNA 2OGEA 3AELA 4ADDA 1AJRA 4DGTA 4M2KA 4OBUA 1O4SA 4IYOA 4AZJA 1S0AA 1TOGA 2BIGA 3HT4A 1W3UA 3RUYA 3VOMA 5EFSA 1DJEA 2JJHA 2VMNA 1IBJA 1WYUA 2OKKA 3MBBA 2VMSA 4JEVA 3FQAA 1ASFA 4MSOA 1X0MA 5TF5A 2VMQA 4KYOA 1S07A 4K2IA 2AY8A 3A9YA 1D2FA 3COGA 3GWPA 4GE9A 4EB7A 3IHJA 4J8LA 1ARGA 2E7IA 3VK4A 5EUNA 2VI9A 3BB8A 4A6RA 5I92A 4GSAA 1B5PA 1DJ9A 4XK1A 4XJLA 3FSLA 4H51A 3FZ8A 1CQ7A 4N0BA 4GEBA 4R2NA 1AJSB 1DFOA 1BJOB 1GEWA 1RV4A 3DODA 2HOXA 2HUFA 3WKSA 2FQ6A 3WCOA 4F5IA 3LVJA 3WGCA 3LVMA 2QA3A 3USFA 5LHAA 2AY9A 4A0GA 2CANA 5EQCA 3E6GA 3FCRA 3T32A 1OHYA 3NDNA 1GBNA 1LKCA 3JU7A 1DTYA 1SZKA 2AY2A 4OC9A 1AAMA 2BYLA 2D7ZA 4WYFA 3W1HA 2QBTA 1ARIA 1LK9A 2FN6A 2ZP7A 1D7VA 2HORA 2VIBA 1OXPA 1TASA 2BIAA 3FQ8A 3CAIA 4IXOA 1UU1A 1BJNA 5FT6A 3MAUA 1UU2A 1SPAA 4WBTA 1T3IA 4F5KA 3OKSA 3IF2A 3DZZA 3FQ7A 4IX8A 1TATA 2D64A 3AEMA 5EAAA 5DB5A 4M2JA 3F9TA 1B8GA 1GDEA 4WYAA 3ZZKA 3EIAA 3E2FA 3ASBA 3LVKA 5M4BA 1I48A 1X28A 2W7DA 3PD6A 3AATA 3ZRRA 2D5YA 2HOYA 3LG0A 3NYTA 3NNKA 1IJIA 3LWSA 1W23A 4RJ0A 2JG2A 1BKGA 2E7JA 3QBOA 4HF8A 3VK3A 3QM2A 3FZ6A 1QISA 2ZUKA 2X8UA 1J04A 4W1XA 3E2YA 2EH6A 3QN6A 4UHMA 1W7NA 3RCHA 1KL2A 2VGZA 4ITGA 3OP7A 4F5HA 1M0PA 2YCNA 1AX4A 3GSBA 2O0RA 2VLHA 2BWNA 1YJYA 5HHYA 1S08A 1SZUA 3E2ZB 4WXGA 4LC3A 5EUEA 5G09A 2CINA 2VI8A 1C4KA 1RVUA 3AEPA 3K7YA 1GEYA 1MDXA 3BC8A 3GBXA 3VAXA 5EIGA 1RVYA 2DOUA 3ACZA 4W1WA 2W8UA 1TPLA 2BI9A 3JTXA 1V72A 1B9IA 2AY3A 2YKYA 3JWAA 1B5OA 1TOKA 2W7MA 4ZM4A 1D7SA 4ATQA 2W7LA 2GQNA 3PDBA 4A6TA 1SF2A 3NYSA 3TQXA 1SZSA 1AHYA 2QMAA 4JEWA 1G7WA 1AHEA 1AMRA 1ELUA 1MDZA 2CSTA 3B1DA 4ATPA 1EG5A 2YOBA 3KE3A 2GMUA 3ATHA 3NRAA 4CXQA 3H14A 1OATA 1AHGA 2JISA 2Z9UA 3FDDA 4TMRA 3BN1A 3MAFB 1BQDA 2CB1A 4WB0A 5BJ3A 1AKAA 2VLFA 1TARA 2RFVA 1YAAA 1M4NA 1AMAA 4WYGA 3PGYA 4IXSA 3EZ1A 4ZDLA 4ADCA 1CJ0A 2CH2A 3A9XA 2BKWA 4E3RA 4CBRA 1G7XA 2BI3A 1AMQA 2HZPA 4ZDOA 2V0YA 1AIBA 3EI6A 2BWOA 4IY7A 2CJHA 3WZFA 5AX8A 3B46A 2D7YA 1BJWA 1JS6A 2DR1A 2X5FA 1WYTA 1GD9A 4OCAA 1ZC9A 4ZDPA 2W7FA 1E5FA 3DU4A 2BI2A 5BJ4A 5E5IA 3AEMC 1DJUA 1G4VA 4AO9A 1B4XA 1AY8A 2VMWA 4E1OA 3BCAA 3FZ7A 1M0NA 2G6WA 2R0TA 1QJ3A 2FM1A 3DR4A 2VGSA 2AY4A 3EIBA 3FVUA 2Z1ZA 3HMUA 1N8PA 4XJOA 3QPGA 4PFNA 1RV3A 3BS8A 3WY7A 1CQ6A 3BCBA 4GE4A 4OTLA 2ZY4A 5DJ9A 4OT8A 3RBFA 4E3QA 5DX5A 5J8QA 2HP2A 1KKPA 4EB5A 3AEOA 1ASEA 1CZEA 2R5CA 4FFCA 4MQRA 4BA5A 4BA4A 1O69A 2YCPA 3BV0A 3N5MA 2W8JA 4ZWVA 1LS3A 1UKJA 4RITA 4UHOA 1GC4A 2DGLA 2YRIA 1Y4IA 4HVKA 3NTJA 3ELPA 2VIAA 2VMTA 4PIWA 1PG8A 1YNUA 1ECXA 1YJZA 2YCTA 2VMPA 1XI9A 3N0LA 1PMMA 4MGRA 2VMYA 3DXWA 3MEBA 2GSAA 3GETA 3P6KA 4EU1A 1ARTA 1AY5A 3MC6A 3HQTA 1AIAA 4O6ZA 3EI5A 1W7LA 4WD2A 3TCMA 4A6UA 4ZLVA 1GCKA 4ZSYA 2DKBA 3JW9A 3ECDA 1BT4A 5EUDA 2YHKA 2Z20A 2EO5A 3B1CA 1YOOA 4GRXA 4MQQA 3NX3A 1M7YA 2EGYA 2C44A 2VMVA 3N75A 2GB3A 3Q8NA 1N2TA 4E77A 3EI8A 1OXOA 1IAYA 2JJFA 2VMZA 4RM1A 4WXFA 1GC2A 4IYOB 4WP0A 1WYVB 2ZSMA 4ISYA 4LW2A 3FVXA 2PO3A 3WKRA 5D95A 3P1TA 2DKJA 5JAYA 1GEXA 1I41A 1WYUB 3LY1A 4ZWMA 1IAXA 2Q7WA 4W1VA 1PMOA 2VGUA 2YKVA 1EQBA 3AOVA 3KGXA 2VGWA 1LC8A 4F5LA 5D5SA 1N31A 2ZY2A 3MADA 4ADEA 1FC4A 1MLZA 2Z9WA 3ZRQA 1ARSA 2X5DA 1ASBA 3AENA 4KAMA 4TN4A 2W7HA 3M5UA 3KKIA 2JJGA 1YJSA 5M4DA 4F5FA 3UE8A 3QI6A 3HL2A 3JWBA 1C9CA 2W8WA 4JF0A 2X3LA 2JJEA 1MLYA 3D6KA 1MAQA 5FT8A 2VMXA 1BJ4A 2OKJA 1WSTA 1BW0A 2R2NA 3A8UX 3PAAA 4K2MA 4EFFA 4RIZA 3ZZJA 2BI1A 1AHFA 1IX8A 1KKJA 2W7GA 4JEYA 3RI6A 4CVQA 4XJMA 4AZKA 2VGTA 4RLGA 3CQ6A 2HUIA 2EPJA 2EZ1A 2V1PA 3DR7A 5G0AA 4KXKA 4LNJA 5K8BA 3DYDA 2VMUA 4FL0A 3FDBA 4W91A 1M6SA 4P7YA 1IUGA 2C7TA 2JGTA 2QB2A 3EZSA 4MKJA 4F5JA 3DRDA 4CXRA 4JF1A 3MKJA 3PDXA 5HXXA 3DXVA 5G2QA 1C0NA 1FG7A 4ZM3A 2NMPA 1VP4A 3PA9A 4IXZA 3ASAA 3MC6C 4M2MA 4RAEA 3G8MA 4N0WA 4W8IA 1OHWA 4ZASA 4R8DA 1AJSA 1WKHA 1BJOA 1TOEA 3PD6B 3LVLB 4A72A 3W1IA 4BQ0A 1ASLA 1VEFA 1D7UA 4ZSWA 1LW4A 4U2HA 2AY5A 3TFTA 2F8JA 3JZLA 2CJGA 1M0QA 3UAKA 3AEJA 1DKAA 1X2AA 2C81A 4F5GA 2E54A 3R4TA 1AKCA 4MQPA 1VJOA 2BWPA 2CTZA 1ASCA 2AY7A 3G0TA 4B98A 1MGVA 4GDYA 2BI5A 2O1BA 4Y0DA 5LH9A 3RCHB 1QITA 3UWCA 5G2PA 1SVVA 2BYJA 5M49A 3A9ZA 1P3WA 3CQ5A 5G4IA 2ZC0A 3K40A 4JEXA 2Z61A 2R5EA 2BHXA 3TATA 1C7GA 1G4XA 3GJUA 3GR9A 4B9BA 4XQ2A 1PFFA 3AV7A 5EIGB 1IX6A 4RJYA 3BWNA 3GZDC 1AICA 1AY4A 2W7IA 4PFFA 1MAPA 1UU0A 2ZY5A 1GC3A 4A0RA 2AEVA 5DJ1A 3ISLA 4F4EA 1C7OA 1TOJA 2PB2A 4DBCA 2AY1A 1WYVA 3PDBB 4QGRA 2CY8A 2AEUA 2Z9XA 3NUIA 2WK7A 1ELQA 2WK9A 5M46A
chains in the Genus database with same CATH superfamily
1S06A 4JEZA 3B1EA 2TPLA 3G7QA 4XJPA 1M0OA 4AOAA 4XAUA 1ASAA 2ZJGA 3I5TA 4BMKA 1BQAA 1FG3A 1V2EA 2QLRA 3FFHA 1XEYA 2W7KA 3E9KA 4WB0B 3QHXA 5HDMA 2HOZA 2AATA 4OYTA 1V2DA 4A0FA 3CBFA 3QGUA 3L44A 4P3MA 3E2ZA 4UQVA 2VMRA 2CH1A 3FVSA 4Q75A 7AATA 1ASDA 2D63A 3R9AA 1KMJA 1ARHA 3ZRPA 3L8AA 1SFFA 2W7EA 1TOIA 4Y0IA 2O7CA 3FTBA 3NU8A 5EAVA 4Y0HA 1WYTB 1JG8A 1QJ5A 1QIRA 1U08A 3WLXA 1H1CA 4A0HA 4UOYA 3B8XA 2BIEA 1KL1A 4Q6RA 1W7MA 2FNUA 2A1VA 3BWOA 4WLHA 1JS3A 4Q31A 1ASMA 3AOWA 4NOGA 1GC0A 1DGDA 3F0HA 3FD0A 4JE5D 2QB3A 3W1JA 1B9HA 3PIUA 4K05A 4WYEA 1Z3ZA 4R5FA 3AEJC 1AKBA 5C6UA 3MAFA 1YIYA 4R5ZA 2CJDA 2D65A 2W8VA 3EI7A 3GZDA 2VMOA 1ZODA 3E77A 2DGMA 1AHXA 4ZAHA 2YKUA 2WKAA 4MY5A 2ZSLA 1H0CA 4BHDA 4TV7A 1IX7A 4CBSA 4F5MA 2ZY3A 1LW5A 1ASGA 1MDOA 1E5EA 1YIZA 2XBNA 2DGKA 3BCXA 4PVFA 2Z9VA 2YRRA 3CQ4A 4AO4A 5IWQA 3FFRA 1V2FA 2R5CB 2D61A 1I29A 1AMSA 3A2BA 2WK8A 3NUBA 4OBVA 8AATA 1KMKA 4XEWA 2PB0A 3LV2A 4LW4A 2YKXA 3BWNC 3F6TA 1CL1A 1D7RA 1O62A 2ZYJA 1M32A 1C7NA 2HP1A 2XH1A 1QZ9A 3DC1A 2FYFA 1OHVA 4AH3A 4UHNA 2EZ2A 3FKDA 4A00A 3H7FA 4K2BA 2W7JA 4WLJA 1CQ8A 2E7UA 5FT5A 1O61A 2OQXA 2VYCA 2AY6A 2CFBA 2Z67A 1IVRA 4Q76A 3I4JA 5F9SA 3NU7A 1JF9A 1WKGA 1Z7DA 2WB6A 3PJ0A 4JE5A 3PPLA 2GMSA 2W8TA 4EMYA 3RQ1A 4LNLA 4W5KA 4MKKA 1CZCA 4RKCA 2D66A 3I16A 2OATA 5F8VA 1EJIA 3VP6A 2HUUA 1CL2A 1J32A 5FT4A 2ORDA 4U1TA 1LC5A 2C0RA 3NYUA 5G4JA 3WGBA 3WX9A 4ADBA 4L0OA 1LC7A 1DGEA 3II0A 4ITXA 4WXBA 1BS0A 2OGAA 2VGVA 3HVYA 3HLMA 3EUCA 5E3KA 3HBXA 4WYDA 1X29A 3RBLA 1QGNA 3WCNA 5E4ZA 3N4SA 2FNIA 4RKDA 1S09A 1ORDA 3TFUA 1CS1A 2Z1YA 3VK2A 3K28A 3AENB 3ELEA 3HDOA 4LNMA 4I8AA 9AATA 4WYCA 4DQ6A 1ZOBA 1I43A 1AAWA 4GE7A 4J5UA 3GZCA 4OMAA 3KGWA 3FRKA 4IW7A 3EI9A 1ASNA 2OGEA 3AELA 4ADDA 1AJRA 4DGTA 4M2KA 4OBUA 1O4SA 4IYOA 4AZJA 1S0AA 1TOGA 2BIGA 3HT4A 1W3UA 3RUYA 3VOMA 5EFSA 4H63Q 1DJEA 2JJHA 2VMNA 1IBJA 1WYUA 2OKKA 3MBBA 2VMSA 4JEVA 3FQAA 1ASFA 4MSOA 1X0MA 5TF5A 2FKIA 2VMQA 4KYOA 1S07A 4K2IA 2AY8A 3A9YA 1D2FA 3COGA 3GWPA 4GE9A 4EB7A 3IHJA 4J8LA 1ARGA 2E7IA 3VK4A 5EUNA 2VI9A 3BB8A 4A6RA 5I92A 4GSAA 3N4XA 1B5PA 1DJ9A 4XK1A 4XJLA 3FSLA 4H51A 5KTBA 3FZ8A 1CQ7A 4N0BA 2QSRA 4GEBA 4R2NA 1AJSB 1DFOA 1BJOB 1GEWA 1RV4A 3DODA 2HOXA 2HUFA 3WKSA 2FQ6A 3WCOA 4F5IA 3LVJA 3WGCA 3LVMA 2QA3A 3USFA 5LHAA 2AY9A 4A0GA 2CANA 5EQCA 3E6GA 3FCRA 3T32A 1OHYA 3NDNA 1GBNA 1LKCA 3JU7A 1DTYA 1SZKA 2AY2A 4OC9A 1AAMA 2BYLA 2D7ZA 4WYFA 3W1HA 2QBTA 1ARIA 1LK9A 2FN6A 2ZP7A 1D7VA 2HORA 2VIBA 1OXPA 1TASA 2BIAA 3FQ8A 3CAIA 4IXOA 1UU1A 1BJNA 5FT6A 3MAUA 1UU2A 1SPAA 4WBTA 1T3IA 4F5KA 3OKSA 3IF2A 3DZZA 3FQ7A 4IX8A 1TATA 2D64A 3AEMA 5EAAA 3H9XA 5DB5A 4M2JA 3F9TA 1B8GA 1GDEA 4WYAA 3ZZKA 3EIAA 3E2FA 3ASBA 3LVKA 5M4BA 1I48A 3N4RA 1X28A 2W7DA 3PD6A 3AATA 3ZRRA 2D5YA 2HOYA 3LG0A 3NYTA 3NNKA 1IJIA 3LWSA 1W23A 4RJ0A 2JG2A 1BKGA 2E7JA 3QBOA 4HF8A 3VK3A 3QM2A 3FZ6A 1QISA 2ZUKA 2X8UA 1J04A 4W1XA 3E2YA 2EH6A 3QN6A 4UHMA 1W7NA 3RCHA 1KL2A 2VGZA 4ITGA 3OP7A 4F5HA 1M0PA 2YCNA 1AX4A 3GSBA 2O0RA 2VLHA 2BWNA 1YJYA 5HHYA 1S08A 1SZUA 3E2ZB 4WXGA 4LC3A 5EUEA 5G09A 2CINA 2VI8A 1C4KA 1RVUA 3AEPA 3K7YA 1GEYA 1MDXA 3BC8A 3GBXA 3VAXA 5EIGA 1RVYA 2DOUA 3ACZA 4W1WA 2W8UA 3N7NA 1TPLA 2BI9A 3JTXA 1V72A 1B9IA 2AY3A 2YKYA 3JWAA 1B5OA 1TOKA 2W7MA 4ZM4A 1D7SA 4ATQA 2W7LA 2GQNA 3PDBA 4A6TA 1SF2A 3NYSA 3TQXA 1SZSA 1AHYA 2QMAA 4JEWA 1G7WA 2EYQA 1AHEA 1AMRA 1ELUA 1MDZA 2CSTA 3B1DA 4ATPA 1EG5A 2YOBA 3KE3A 2GMUA 3ATHA 3NRAA 4CXQA 3H14A 1OATA 1AHGA 2JISA 2Z9UA 3FDDA 4TMRA 3BN1A 3MAFB 1BQDA 2CB1A 4WB0A 5BJ3A 1AKAA 2VLFA 1TARA 2RFVA 1YAAA 1M4NA 1AMAA 4WYGA 3PGYA 4IXSA 3EZ1A 4ZDLA 4ADCA 1CJ0A 2CH2A 3A9XA 2BKWA 4E3RA 4CBRA 1G7XA 2BI3A 1AMQA 2HZPA 4ZDOA 2V0YA 1AIBA 3EI6A 2BWOA 4IY7A 2CJHA 3WZFA 5AX8A 3B46A 2D7YA 1BJWA 1JS6A 2DR1A 2X5FA 1WYTA 1GD9A 4OCAA 1ZC9A 4ZDPA 2W7FA 1E5FA 3DU4A 2BI2A 5BJ4A 5E5IA 3AEMC 1DJUA 1G4VA 4AO9A 1B4XA 1AY8A 2VMWA 4E1OA 3BCAA 3FZ7A 1M0NA 2G6WA 2R0TA 1QJ3A 2FM1A 3DR4A 2VGSA 2AY4A 3EIBA 3FVUA 2Z1ZA 3HMUA 1N8PA 4XJOA 3QPGA 4PFNA 1RV3A 3BS8A 2KFPA 3WY7A 1CQ6A 3BCBA 4GE4A 4OTLA 2ZY4A 5DJ9A 4OT8A 3RBFA 4E3QA 5DX5A 5J8QA 2HP2A 1KKPA 4EB5A 3AEOA 1ASEA 1CZEA 2R5CA 4FFCA 4MQRA 4BA5A 4BA4A 1O69A 2YCPA 3BV0A 3N5MA 2W8JA 4ZWVA 1LS3A 1UKJA 4RITA 4UHOA 1GC4A 2DGLA 2YRIA 1Y4IA 4HVKA 3NTJA 3ELPA 2VIAA 2VMTA 4PIWA 1PG8A 1YNUA 1ECXA 1YJZA 2YCTA 2VMPA 1XI9A 3N0LA 1PMMA 4MGRA 2VMYA 3DXWA 3MEBA 2GSAA 3GETA 3P6KA 4EU1A 1ARTA 1AY5A 3MC6A 3HQTA 1AIAA 4O6ZA 3EI5A 1W7LA 4WD2A 3TCMA 4A6UA 4ZLVA 1GCKA 4ZSYA 2DKBA 3JW9A 3ECDA 1BT4A 5EUDA 2YHKA 2Z20A 2EO5A 3B1CA 1YOOA 4GRXA 4MQQA 3NX3A 1M7YA 2EGYA 2C44A 2VMVA 3N75A 1KAFA 2GB3A 3Q8NA 1N2TA 4E77A 3EI8A 1OXOA 1IAYA 2JJFA 2VMZA 4RM1A 4WXFA 1GC2A 4IYOB 4WP0A 1WYVB 2ZSMA 4ISYA 4LW2A 3FVXA 2PO3A 3WKRA 5D95A 3P1TA 2DKJA 5JAYA 1GEXA 1I41A 1WYUB 3LY1A 4ZWMA 1IAXA 2Q7WA 4W1VA 1PMOA 2VGUA 2YKVA 1EQBA 3AOVA 3KGXA 2VGWA 1LC8A 4F5LA 5D5SA 1N31A 2ZY2A 3MADA 4ADEA 1FC4A 1MLZA 2Z9WA 3ZRQA 1ARSA 2X5DA 1ASBA 3AENA 4KAMA 4TN4A 2W7HA 3M5UA 3KKIA 2G7JA 2JJGA 1YJSA 5M4DA 4F5FA 3UE8A 3QI6A 3HL2A 3JWBA 1C9CA 2W8WA 4JF0A 2X3LA 2JJEA 1MLYA 3D6KA 1MAQA 5FT8A 2VMXA 1BJ4A 2OKJA 1WSTA 1BW0A 2R2NA 3A8UX 3PAAA 4K2MA 4EFFA 4RIZA 3ZZJA 2BI1A 1AHFA 1IX8A 1KKJA 2W7GA 4JEYA 3RI6A 4CVQA 4XJMA 4AZKA 2VGTA 4RLGA 3CQ6A 2HUIA 2EPJA 2EZ1A 2V1PA 3DR7A 5G0AA 4KXKA 4LNJA 5K8BA 3DYDA 2VMUA 4FL0A 3FDBA 4W91A 1M6SA 4P7YA 1IUGA 2C7TA 2JGTA 2QB2A 3EZSA 4MKJA 4F5JA 3DRDA 4CXRA 4JF1A 3MKJA 3PDXA 5HXXA 3DXVA 5G2QA 1C0NA 1FG7A 4ZM3A 2NMPA 1VP4A 3PA9A 4IXZA 3ASAA 3MC6C 4M2MA 4RAEA 3G8MA 4N0WA 4W8IA 1OHWA 4ZASA 4R8DA 1AJSA 1WKHA 1BJOA 1TOEA 3PD6B 3LVLB 4A72A 3W1IA 4BQ0A 1ASLA 1VEFA 1D7UA 4ZSWA 1LW4A 4U2HA 2AY5A 3TFTA 2F8JA 3JZLA 2CJGA 1M0QA 3UAKA 3AEJA 1DKAA 1X2AA 2C81A 4F5GA 2E54A 3R4TA 1AKCA 4MQPA 1VJOA 2BWPA 2CTZA 1ASCA 2AY7A 3G0TA 4B98A 1MGVA 4GDYA 2BI5A 2O1BA 4Y0DA 5LH9A 3RCHB 1QITA 3UWCA 5G2PA 1SVVA 2BYJA 5M49A 3A9ZA 1P3WA 3CQ5A 5G4IA 2ZC0A 3K40A 4JEXA 2Z61A 2R5EA 2BHXA 3TATA 1C7GA 1G4XA 3GJUA 3GR9A 4B9BA 4XQ2A 1PFFA 3AV7A 5EIGB 1IX6A 4RJYA 3BWNA 3GZDC 1AICA 1AY4A 2W7IA 4PFFA 1MAPA 1UU0A 2ZY5A 1GC3A 4A0RA 2AEVA 5DJ1A 3ISLA 4F4EA 1C7OA 1TOJA 2PB2A 4DBCA 2AY1A 1WYVA 3PDBB 4QGRA 2CY8A 2AEUA 2Z9XA 3NUIA 2WK7A 1ELQA 2WK9A 5M46A
chains in the Genus database with same CATH topology
1S06A 4JEZA 3B1EA 2TPLA 3G7QA 4XJPA 1M0OA 4AOAA 4XAUA 1ASAA 2ZJGA 3I5TA 4BMKA 1BQAA 1FG3A 1V2EA 2QLRA 3FFHA 1XEYA 2W7KA 3E9KA 4WB0B 3QHXA 5HDMA 2HOZA 2AATA 4OYTA 1V2DA 4A0FA 3CBFA 3QGUA 3L44A 4P3MA 3E2ZA 4UQVA 2VMRA 2CH1A 3FVSA 4Q75A 7AATA 1ASDA 2D63A 3R9AA 1KMJA 1ARHA 3ZRPA 3L8AA 1SFFA 2W7EA 1TOIA 4Y0IA 2O7CA 3FTBA 3NU8A 5EAVA 4Y0HA 1WYTB 1JG8A 1QJ5A 1QIRA 1U08A 3WLXA 1H1CA 4A0HA 4UOYA 3B8XA 2BIEA 1KL1A 4Q6RA 1W7MA 2FNUA 2A1VA 3BWOA 4WLHA 1JS3A 4Q31A 1ASMA 3AOWA 4NOGA 1GC0A 1DGDA 3F0HA 3FD0A 4JE5D 2QB3A 3W1JA 1B9HA 3PIUA 4K05A 4WYEA 1Z3ZA 4R5FA 3AEJC 1AKBA 5C6UA 3MAFA 1YIYA 4R5ZA 2CJDA 2D65A 2W8VA 3EI7A 3GZDA 2VMOA 1ZODA 3E77A 2DGMA 1AHXA 4ZAHA 2YKUA 2WKAA 4MY5A 2ZSLA 1H0CA 4BHDA 4TV7A 1IX7A 4CBSA 4F5MA 2ZY3A 1LW5A 1ASGA 1MDOA 1E5EA 1YIZA 2XBNA 2DGKA 3BCXA 4PVFA 2Z9VA 2YRRA 3CQ4A 4AO4A 5IWQA 3FFRA 1V2FA 2R5CB 2D61A 1I29A 1AMSA 3A2BA 2WK8A 3NUBA 4OBVA 8AATA 1KMKA 4XEWA 2PB0A 3LV2A 4LW4A 2YKXA 3BWNC 3F6TA 1CL1A 1D7RA 1O62A 2ZYJA 1M32A 1C7NA 2HP1A 2XH1A 1QZ9A 3DC1A 2FYFA 1OHVA 4AH3A 4UHNA 2EZ2A 3FKDA 4A00A 3H7FA 4K2BA 2W7JA 4WLJA 1CQ8A 2E7UA 5FT5A 1O61A 2OQXA 2VYCA 2AY6A 2CFBA 2Z67A 1IVRA 4Q76A 3I4JA 5F9SA 3NU7A 1JF9A 1WKGA 1Z7DA 2WB6A 3PJ0A 4JE5A 3PPLA 2GMSA 2W8TA 4EMYA 3RQ1A 4LNLA 4W5KA 4MKKA 1CZCA 4RKCA 2D66A 3I16A 2OATA 5F8VA 1EJIA 3VP6A 2HUUA 1CL2A 1J32A 5FT4A 2ORDA 4U1TA 1LC5A 2C0RA 3NYUA 5G4JA 3WGBA 3WX9A 4ADBA 4L0OA 1LC7A 1DGEA 3II0A 4ITXA 4WXBA 1BS0A 2OGAA 2VGVA 3HVYA 3HLMA 3EUCA 5E3KA 3HBXA 4WYDA 1X29A 3RBLA 1QGNA 3WCNA 5E4ZA 3N4SA 2FNIA 4RKDA 1S09A 1ORDA 3TFUA 1CS1A 2Z1YA 3VK2A 3K28A 3AENB 3ELEA 3HDOA 4LNMA 4I8AA 9AATA 4WYCA 4DQ6A 1ZOBA 1I43A 1AAWA 4GE7A 4J5UA 3GZCA 4OMAA 3KGWA 3FRKA 4IW7A 3EI9A 1ASNA 2OGEA 3AELA 4ADDA 1AJRA 4DGTA 4M2KA 4OBUA 1O4SA 4IYOA 4AZJA 1S0AA 1TOGA 2BIGA 3HT4A 1W3UA 3RUYA 3VOMA 5EFSA 4H63Q 1DJEA 2JJHA 2VMNA 1IBJA 1WYUA 2OKKA 3MBBA 2VMSA 4JEVA 3FQAA 1ASFA 4MSOA 1X0MA 5TF5A 2FKIA 2VMQA 4KYOA 1S07A 4K2IA 2AY8A 3A9YA 1D2FA 3COGA 3GWPA 4GE9A 4EB7A 3IHJA 4J8LA 1ARGA 2E7IA 3VK4A 5EUNA 2VI9A 3BB8A 4A6RA 5I92A 4GSAA 3N4XA 1B5PA 1DJ9A 4XK1A 4XJLA 3FSLA 4H51A 5KTBA 3FZ8A 1CQ7A 4N0BA 2QSRA 4GEBA 4R2NA 1AJSB 1DFOA 1BJOB 1GEWA 1RV4A 3DODA 2HOXA 2HUFA 3WKSA 2FQ6A 3WCOA 4F5IA 3LVJA 3WGCA 3LVMA 2QA3A 3USFA 5LHAA 2AY9A 4A0GA 2CANA 5EQCA 3E6GA 3FCRA 3T32A 1OHYA 3NDNA 1GBNA 1LKCA 3JU7A 1DTYA 1SZKA 2AY2A 4OC9A 1AAMA 2BYLA 2D7ZA 4WYFA 3W1HA 2QBTA 1ARIA 1LK9A 2FN6A 2ZP7A 1D7VA 2HORA 2VIBA 1OXPA 1TASA 2BIAA 3FQ8A 3CAIA 4IXOA 1UU1A 1BJNA 5FT6A 3MAUA 1UU2A 1SPAA 4WBTA 1T3IA 4F5KA 3OKSA 3IF2A 3DZZA 3FQ7A 4IX8A 1TATA 2D64A 3AEMA 5EAAA 3H9XA 5DB5A 4M2JA 3F9TA 1B8GA 1GDEA 4WYAA 3ZZKA 3EIAA 3E2FA 3ASBA 3LVKA 5M4BA 1I48A 3N4RA 1X28A 2W7DA 3PD6A 3AATA 3ZRRA 2D5YA 2HOYA 3LG0A 3NYTA 3NNKA 1IJIA 3LWSA 1W23A 4RJ0A 2JG2A 1BKGA 2E7JA 3QBOA 4HF8A 3VK3A 3QM2A 3FZ6A 1QISA 2ZUKA 2X8UA 1J04A 4W1XA 3E2YA 2EH6A 3QN6A 4UHMA 1W7NA 3RCHA 1KL2A 2VGZA 4ITGA 3OP7A 4F5HA 1M0PA 2YCNA 1AX4A 3GSBA 2O0RA 2VLHA 2BWNA 1YJYA 5HHYA 1S08A 1SZUA 3E2ZB 4WXGA 4LC3A 5EUEA 5G09A 2CINA 2VI8A 1C4KA 1RVUA 3AEPA 3K7YA 1GEYA 1MDXA 3BC8A 3GBXA 3VAXA 5EIGA 1RVYA 2DOUA 3ACZA 4W1WA 2W8UA 3N7NA 1TPLA 2BI9A 3JTXA 1V72A 1B9IA 2AY3A 2YKYA 3JWAA 1B5OA 1TOKA 2W7MA 4ZM4A 1D7SA 4ATQA 2W7LA 2GQNA 3PDBA 4A6TA 1SF2A 3NYSA 3TQXA 1SZSA 1AHYA 2QMAA 4JEWA 1G7WA 2EYQA 1AHEA 1AMRA 1ELUA 1MDZA 2CSTA 3B1DA 4ATPA 1EG5A 2YOBA 3KE3A 2GMUA 3ATHA 3NRAA 4CXQA 3H14A 1OATA 1AHGA 2JISA 2Z9UA 3FDDA 4TMRA 3BN1A 3MAFB 1BQDA 2CB1A 4WB0A 5BJ3A 1AKAA 2VLFA 1TARA 2RFVA 1YAAA 1M4NA 1AMAA 4WYGA 3PGYA 4IXSA 3EZ1A 4ZDLA 4ADCA 1CJ0A 2CH2A 3A9XA 2BKWA 4E3RA 4CBRA 1G7XA 2BI3A 1AMQA 2HZPA 4ZDOA 2V0YA 1AIBA 3EI6A 2BWOA 4IY7A 2CJHA 3WZFA 5AX8A 3B46A 2D7YA 1BJWA 1JS6A 2DR1A 2X5FA 1WYTA 1GD9A 4OCAA 1ZC9A 4ZDPA 2W7FA 1E5FA 3DU4A 2BI2A 5BJ4A 5E5IA 3AEMC 1DJUA 1G4VA 4AO9A 1B4XA 1AY8A 2VMWA 4E1OA 3BCAA 3FZ7A 1M0NA 2G6WA 2R0TA 1QJ3A 2FM1A 3DR4A 2VGSA 2AY4A 3EIBA 3FVUA 2Z1ZA 3HMUA 1N8PA 4XJOA 3QPGA 4PFNA 1RV3A 3BS8A 2KFPA 3WY7A 1CQ6A 3BCBA 4GE4A 4OTLA 2ZY4A 5DJ9A 4OT8A 3RBFA 4E3QA 5DX5A 5J8QA 2HP2A 1KKPA 4EB5A 3AEOA 1ASEA 1CZEA 2R5CA 4FFCA 4MQRA 4BA5A 4BA4A 1O69A 2YCPA 3BV0A 3N5MA 2W8JA 4ZWVA 1LS3A 1UKJA 4RITA 4UHOA 1GC4A 2DGLA 2YRIA 1Y4IA 4HVKA 3NTJA 3ELPA 2VIAA 2VMTA 4PIWA 1PG8A 1YNUA 1ECXA 1YJZA 2YCTA 2VMPA 1XI9A 3N0LA 1PMMA 4MGRA 2VMYA 3DXWA 3MEBA 2GSAA 3GETA 3P6KA 4EU1A 1ARTA 1AY5A 3MC6A 3HQTA 1AIAA 4O6ZA 3EI5A 1W7LA 4WD2A 3TCMA 4A6UA 4ZLVA 1GCKA 4ZSYA 2DKBA 3JW9A 3ECDA 1BT4A 5EUDA 2YHKA 2Z20A 2EO5A 3B1CA 1YOOA 4GRXA 4MQQA 3NX3A 1M7YA 2EGYA 2C44A 2VMVA 3N75A 2GB3A 3Q8NA 1N2TA 4E77A 3EI8A 1OXOA 1IAYA 2JJFA 2VMZA 4RM1A 4WXFA 1GC2A 4IYOB 4WP0A 1WYVB 2ZSMA 4ISYA 4LW2A 3FVXA 2PO3A 3WKRA 5D95A 3P1TA 2DKJA 5JAYA 1GEXA 1I41A 1WYUB 3LY1A 4ZWMA 1IAXA 2Q7WA 4W1VA 1PMOA 2VGUA 2YKVA 1EQBA 3AOVA 3KGXA 2VGWA 1LC8A 4F5LA 5D5SA 1N31A 2ZY2A 3MADA 4ADEA 1FC4A 1MLZA 2Z9WA 3ZRQA 1ARSA 2X5DA 1ASBA 3AENA 4KAMA 4TN4A 2W7HA 3M5UA 3KKIA 2G7JA 2JJGA 1YJSA 5M4DA 4F5FA 3UE8A 3QI6A 3HL2A 3JWBA 1C9CA 2W8WA 4JF0A 2X3LA 2JJEA 1MLYA 3D6KA 1MAQA 5FT8A 2VMXA 1BJ4A 2OKJA 1WSTA 1BW0A 2R2NA 3A8UX 3PAAA 4K2MA 4EFFA 4RIZA 3ZZJA 2BI1A 1AHFA 1IX8A 1KKJA 2W7GA 4JEYA 3RI6A 4CVQA 4XJMA 4AZKA 2VGTA 4RLGA 3CQ6A 2HUIA 2EPJA 2EZ1A 2V1PA 3DR7A 5G0AA 4KXKA 4LNJA 5K8BA 3DYDA 2VMUA 4FL0A 3FDBA 4W91A 1M6SA 4P7YA 1IUGA 2C7TA 2JGTA 2QB2A 3EZSA 4MKJA 4F5JA 3DRDA 4CXRA 4JF1A 3MKJA 3PDXA 5HXXA 3DXVA 5G2QA 1C0NA 1FG7A 4ZM3A 2NMPA 1VP4A 3PA9A 4IXZA 3ASAA 3MC6C 4M2MA 4RAEA 3G8MA 4N0WA 4W8IA 1OHWA 4ZASA 4R8DA 1AJSA 1WKHA 1BJOA 1TOEA 3PD6B 3LVLB 4A72A 3W1IA 4BQ0A 1ASLA 1VEFA 1D7UA 4ZSWA 1LW4A 4U2HA 2AY5A 3TFTA 2F8JA 3JZLA 2CJGA 1M0QA 3UAKA 3AEJA 1DKAA 1X2AA 2C81A 4F5GA 2E54A 3R4TA 1AKCA 4MQPA 1VJOA 2BWPA 2CTZA 1ASCA 2AY7A 3G0TA 4B98A 1MGVA 4GDYA 2BI5A 2O1BA 4Y0DA 5LH9A 3RCHB 1QITA 3UWCA 5G2PA 1SVVA 2BYJA 5M49A 3A9ZA 1P3WA 3CQ5A 5G4IA 2ZC0A 3K40A 4JEXA 2Z61A 2R5EA 2BHXA 3TATA 1C7GA 1G4XA 3GJUA 3GR9A 4B9BA 4XQ2A 1PFFA 3AV7A 5EIGB 1IX6A 4RJYA 3BWNA 3GZDC 1AICA 1AY4A 2W7IA 4PFFA 1MAPA 1UU0A 2ZY5A 1GC3A 4A0RA 2AEVA 5DJ1A 3ISLA 4F4EA 1C7OA 1TOJA 2PB2A 4DBCA 2AY1A 1WYVA 3PDBB 4QGRA 2CY8A 2AEUA 2Z9XA 3NUIA 2WK7A 1ELQA 2WK9A 5M46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S06 A;  4JEZ A;  3B1E A;  2TPL A;  3G7Q A;  4XJP A;  1M0O A;  4AOA A;  4XAU A;  1ASA A;  2ZJG A;  3I5T A;  4BMK A;  1BQA A;  1FG3 A;  1V2E A;  2QLR A;  3FFH A;  1XEY A;  2W7K A;  3E9K A;  4WB0 B;  3QHX A;  5HDM A;  2HOZ A;  2AAT A;  4OYT A;  1V2D A;  4A0F A;  3CBF A;  3QGU A;  3L44 A;  4P3M A;  3E2Z A;  4UQV A;  2VMR A;  2CH1 A;  3FVS A;  4Q75 A;  7AAT A;  1ASD A;  2D63 A;  3R9A A;  1KMJ A;  1ARH A;  3ZRP A;  3L8A A;  1SFF A;  2W7E A;  1TOI A;  4Y0I A;  2O7C A;  3FTB A;  3NU8 A;  5EAV A;  4Y0H A;  1WYT B;  1JG8 A;  1QJ5 A;  1QIR A;  1U08 A;  3WLX A;  1H1C A;  4A0H A;  4UOY A;  3B8X A;  2BIE A;  1KL1 A;  4Q6R A;  1W7M A;  2FNU A;  3BWO A;  4WLH A;  1JS3 A;  4Q31 A;  1ASM A;  3AOW A;  4NOG A;  1GC0 A;  1DGD A;  3F0H A;  3FD0 A;  4JE5 D;  2QB3 A;  3W1J A;  1B9H A;  3PIU A;  4WYE A;  1Z3Z A;  4R5F A;  3AEJ C;  1AKB A;  5C6U A;  3MAF A;  1YIY A;  4R5Z A;  2CJD A;  2D65 A;  2W8V A;  3EI7 A;  3GZD A;  2VMO A;  1ZOD A;  3E77 A;  2DGM A;  1AHX A;  4ZAH A;  2YKU A;  2WKA A;  4MY5 A;  2ZSL A;  1H0C A;  4BHD A;  4TV7 A;  1IX7 A;  4CBS A;  4F5M A;  2ZY3 A;  1LW5 A;  1ASG A;  1MDO A;  1E5E A;  1YIZ A;  2XBN A;  2DGK A;  3BCX A;  4PVF A;  2Z9V A;  2YRR A;  3CQ4 A;  4AO4 A;  5IWQ A;  3FFR A;  1V2F A;  2R5C B;  2D61 A;  1I29 A;  1AMS A;  3A2B A;  2WK8 A;  3NUB A;  4OBV A;  8AAT A;  1KMK A;  4XEW A;  2PB0 A;  3LV2 A;  4LW4 A;  2YKX A;  3BWN C;  3F6T A;  1CL1 A;  1D7R A;  1O62 A;  2ZYJ A;  1M32 A;  1C7N A;  2HP1 A;  2XH1 A;  1QZ9 A;  3DC1 A;  2FYF A;  1OHV A;  4AH3 A;  4UHN A;  2EZ2 A;  3FKD A;  4A00 A;  3H7F A;  4K2B A;  2W7J A;  4WLJ A;  1CQ8 A;  2E7U A;  5FT5 A;  1O61 A;  2OQX A;  2VYC A;  2AY6 A;  2CFB A;  2Z67 A;  1IVR A;  4Q76 A;  3I4J A;  5F9S A;  3NU7 A;  1JF9 A;  1WKG A;  1Z7D A;  3PJ0 A;  4JE5 A;  3PPL A;  2GMS A;  2W8T A;  4EMY A;  3RQ1 A;  4LNL A;  4W5K A;  4MKK A;  1CZC A;  4RKC A;  2D66 A;  3I16 A;  2OAT A;  5F8V A;  1EJI A;  3VP6 A;  2HUU A;  1CL2 A;  1J32 A;  5FT4 A;  2ORD A;  4U1T A;  1LC5 A;  2C0R A;  3NYU A;  5G4J A;  3WGB A;  3WX9 A;  4ADB A;  4L0O A;  1LC7 A;  1DGE A;  3II0 A;  4ITX A;  4WXB A;  1BS0 A;  2OGA A;  2VGV A;  3HVY A;  3HLM A;  3EUC A;  5E3K A;  3HBX A;  4WYD A;  1X29 A;  3RBL A;  1QGN A;  3WCN A;  5E4Z A;  2FNI A;  4RKD A;  1S09 A;  1ORD A;  3TFU A;  1CS1 A;  2Z1Y A;  3VK2 A;  3K28 A;  3AEN B;  3ELE A;  3HDO A;  4LNM A;  4I8A A;  9AAT A;  4WYC A;  4DQ6 A;  1ZOB A;  1I43 A;  1AAW A;  4GE7 A;  4J5U A;  3GZC A;  4OMA A;  3KGW A;  3FRK A;  4IW7 A;  3EI9 A;  1ASN A;  2OGE A;  3AEL A;  4ADD A;  1AJR A;  4DGT A;  4M2K A;  4OBU A;  1O4S A;  4IYO A;  4AZJ A;  1S0A A;  1TOG A;  2BIG A;  3HT4 A;  1W3U A;  3RUY A;  3VOM A;  5EFS A;  1DJE A;  2JJH A;  2VMN A;  1IBJ A;  1WYU A;  2OKK A;  3MBB A;  2VMS A;  4JEV A;  3FQA A;  1ASF A;  4MSO A;  1X0M A;  5TF5 A;  2VMQ A;  4KYO A;  1S07 A;  4K2I A;  2AY8 A;  3A9Y A;  1D2F A;  3COG A;  3GWP A;  4GE9 A;  4EB7 A;  3IHJ A;  4J8L A;  1ARG A;  2E7I A;  3VK4 A;  5EUN A;  2VI9 A;  3BB8 A;  4A6R A;  5I92 A;  4GSA A;  1B5P A;  1DJ9 A;  4XK1 A;  4XJL A;  3FSL A;  4H51 A;  3FZ8 A;  1CQ7 A;  4N0B A;  4GEB A;  4R2N A;  1AJS B;  1DFO A;  1BJO B;  1GEW A;  1RV4 A;  3DOD A;  2HOX A;  2HUF A;  3WKS A;  2FQ6 A;  3WCO A;  4F5I A;  3LVJ A;  3WGC A;  3LVM A;  2QA3 A;  3USF A;  5LHA A;  2AY9 A;  4A0G A;  2CAN A;  5EQC A;  3E6G A;  3FCR A;  3T32 A;  1OHY A;  3NDN A;  1GBN A;  1LKC A;  3JU7 A;  1DTY A;  1SZK A;  2AY2 A;  4OC9 A;  1AAM A;  2BYL A;  2D7Z A;  4WYF A;  3W1H A;  2QBT A;  1ARI A;  1LK9 A;  2FN6 A;  2ZP7 A;  1D7V A;  2HOR A;  2VIB A;  1OXP A;  1TAS A;  2BIA A;  3FQ8 A;  3CAI A;  4IXO A;  1UU1 A;  1BJN A;  5FT6 A;  3MAU A;  1UU2 A;  1SPA A;  4WBT A;  1T3I A;  4F5K A;  3OKS A;  3IF2 A;  3DZZ A;  3FQ7 A;  4IX8 A;  1TAT A;  2D64 A;  3AEM A;  5EAA A;  5DB5 A;  4M2J A;  3F9T A;  1B8G A;  1GDE A;  4WYA A;  3ZZK A;  3EIA A;  3E2F A;  3ASB A;  3LVK A;  5M4B A;  1I48 A;  1X28 A;  2W7D A;  3PD6 A;  3AAT A;  3ZRR A;  2D5Y A;  2HOY A;  3LG0 A;  3NYT A;  3NNK A;  1IJI A;  3LWS A;  1W23 A;  4RJ0 A;  2JG2 A;  1BKG A;  2E7J A;  3QBO A;  4HF8 A;  3VK3 A;  3QM2 A;  3FZ6 A;  1QIS A;  2ZUK A;  2X8U A;  1J04 A;  4W1X A;  3E2Y A;  2EH6 A;  3QN6 A;  4UHM A;  1W7N A;  3RCH A;  1KL2 A;  2VGZ A;  4ITG A;  3OP7 A;  4F5H A;  1M0P A;  2YCN A;  1AX4 A;  3GSB A;  2O0R A;  2VLH A;  2BWN A;  1YJY A;  5HHY A;  1S08 A;  1SZU A;  3E2Z B;  4WXG A;  4LC3 A;  5EUE A;  5G09 A;  2CIN A;  2VI8 A;  1C4K A;  1RVU A;  3AEP A;  3K7Y A;  1GEY A;  1MDX A;  3BC8 A;  3GBX A;  3VAX A;  5EIG A;  1RVY A;  2DOU A;  3ACZ A;  4W1W A;  2W8U A;  1TPL A;  2BI9 A;  3JTX A;  1V72 A;  1B9I A;  2AY3 A;  2YKY A;  3JWA A;  1B5O A;  1TOK A;  2W7M A;  4ZM4 A;  1D7S A;  4ATQ A;  2W7L A;  2GQN A;  3PDB A;  4A6T A;  1SF2 A;  3NYS A;  3TQX A;  1SZS A;  1AHY A;  2QMA A;  4JEW A;  1G7W A;  1AHE A;  1AMR A;  1ELU A;  1MDZ A;  2CST A;  3B1D A;  4ATP A;  1EG5 A;  2YOB A;  3KE3 A;  2GMU A;  3ATH A;  3NRA A;  4CXQ A;  3H14 A;  1OAT A;  1AHG A;  2JIS A;  2Z9U A;  3FDD A;  4TMR A;  3BN1 A;  3MAF B;  1BQD A;  2CB1 A;  4WB0 A;  5BJ3 A;  1AKA A;  2VLF A;  1TAR A;  2RFV A;  1YAA A;  1M4N A;  1AMA A;  4WYG A;  3PGY A;  4IXS A;  3EZ1 A;  4ZDL A;  4ADC A;  1CJ0 A;  2CH2 A;  3A9X A;  2BKW A;  4E3R A;  4CBR A;  1G7X A;  2BI3 A;  1AMQ A;  2HZP A;  4ZDO A;  2V0Y A;  1AIB A;  3EI6 A;  2BWO A;  4IY7 A;  2CJH A;  3WZF A;  5AX8 A;  3B46 A;  2D7Y A;  1BJW A;  1JS6 A;  2DR1 A;  2X5F A;  1WYT A;  1GD9 A;  4OCA A;  1ZC9 A;  4ZDP A;  2W7F A;  1E5F A;  3DU4 A;  2BI2 A;  5BJ4 A;  5E5I A;  3AEM C;  1DJU A;  1G4V A;  4AO9 A;  1B4X A;  1AY8 A;  2VMW A;  4E1O A;  3BCA A;  3FZ7 A;  1M0N A;  2G6W A;  2R0T A;  1QJ3 A;  2FM1 A;  3DR4 A;  2VGS A;  2AY4 A;  3EIB A;  3FVU A;  2Z1Z A;  3HMU A;  1N8P A;  4XJO A;  3QPG A;  4PFN A;  1RV3 A;  3BS8 A;  3WY7 A;  1CQ6 A;  3BCB A;  4GE4 A;  4OTL A;  2ZY4 A;  5DJ9 A;  4OT8 A;  3RBF A;  4E3Q A;  5DX5 A;  5J8Q A;  2HP2 A;  1KKP A;  4EB5 A;  3AEO A;  1ASE A;  1CZE A;  2R5C A;  4FFC A;  4MQR A;  4BA5 A;  4BA4 A;  1O69 A;  2YCP A;  3BV0 A;  3N5M A;  2W8J A;  4ZWV A;  1LS3 A;  1UKJ A;  4RIT A;  4UHO A;  1GC4 A;  2DGL A;  2YRI A;  1Y4I A;  4HVK A;  3NTJ A;  3ELP A;  2VIA A;  2VMT A;  4PIW A;  1PG8 A;  1YNU A;  1ECX A;  1YJZ A;  2YCT A;  2VMP A;  1XI9 A;  3N0L A;  1PMM A;  4MGR A;  2VMY A;  3DXW A;  3MEB A;  2GSA A;  3GET A;  3P6K A;  4EU1 A;  1ART A;  1AY5 A;  3MC6 A;  3HQT A;  1AIA A;  4O6Z A;  3EI5 A;  1W7L A;  4WD2 A;  3TCM A;  4A6U A;  4ZLV A;  1GCK A;  4ZSY A;  2DKB A;  3JW9 A;  3ECD A;  1BT4 A;  5EUD A;  2YHK A;  2Z20 A;  2EO5 A;  3B1C A;  1YOO A;  4GRX A;  4MQQ A;  3NX3 A;  1M7Y A;  2EGY A;  2C44 A;  2VMV A;  3N75 A;  2GB3 A;  3Q8N A;  1N2T A;  4E77 A;  3EI8 A;  1OXO A;  1IAY A;  2JJF A;  2VMZ A;  4RM1 A;  4WXF A;  1GC2 A;  4IYO B;  4WP0 A;  1WYV B;  2ZSM A;  4ISY A;  4LW2 A;  3FVX A;  2PO3 A;  3WKR A;  5D95 A;  3P1T A;  2DKJ A;  5JAY A;  1GEX A;  1I41 A;  1WYU B;  3LY1 A;  4ZWM A;  1IAX A;  2Q7W A;  4W1V A;  1PMO A;  2VGU A;  2YKV A;  1EQB A;  3AOV A;  3KGX A;  2VGW A;  1LC8 A;  4F5L A;  5D5S A;  1N31 A;  2ZY2 A;  3MAD A;  4ADE A;  1FC4 A;  1MLZ A;  2Z9W A;  3ZRQ A;  1ARS A;  2X5D A;  1ASB A;  3AEN A;  4KAM A;  4TN4 A;  2W7H A;  3M5U A;  3KKI A;  2JJG A;  1YJS A;  5M4D A;  4F5F A;  3UE8 A;  3QI6 A;  3HL2 A;  3JWB A;  1C9C A;  2W8W A;  4JF0 A;  2X3L A;  2JJE A;  1MLY A;  3D6K A;  1MAQ A;  5FT8 A;  2VMX A;  1BJ4 A;  2OKJ A;  1WST A;  1BW0 A;  2R2N A;  3A8U X;  3PAA A;  4K2M A;  4EFF A;  4RIZ A;  3ZZJ A;  2BI1 A;  1AHF A;  1IX8 A;  1KKJ A;  2W7G A;  4JEY A;  3RI6 A;  4CVQ A;  4XJM A;  4AZK A;  2VGT A;  4RLG A;  3CQ6 A;  2HUI A;  2EPJ A;  2EZ1 A;  2V1P A;  3DR7 A;  5G0A A;  4KXK A;  4LNJ A;  5K8B A;  3DYD A;  2VMU A;  4FL0 A;  3FDB A;  4W91 A;  1M6S A;  4P7Y A;  1IUG A;  2C7T A;  2JGT A;  2QB2 A;  3EZS A;  4MKJ A;  4F5J A;  3DRD A;  4CXR A;  4JF1 A;  3MKJ A;  3PDX A;  5HXX A;  3DXV A;  5G2Q A;  1C0N A;  1FG7 A;  4ZM3 A;  2NMP A;  1VP4 A;  3PA9 A;  4IXZ A;  3ASA A;  3MC6 C;  4M2M A;  4RAE A;  3G8M A;  4N0W A;  4W8I A;  1OHW A;  4ZAS A;  4R8D A;  1AJS A;  1WKH A;  1BJO A;  1TOE A;  3PD6 B;  3LVL B;  4A72 A;  3W1I A;  4BQ0 A;  1ASL A;  1VEF A;  1D7U A;  4ZSW A;  1LW4 A;  4U2H A;  2AY5 A;  3TFT A;  2F8J A;  3JZL A;  2CJG A;  1M0Q A;  3UAK A;  3AEJ A;  1DKA A;  1X2A A;  2C81 A;  4F5G A;  2E54 A;  3R4T A;  1AKC A;  4MQP A;  1VJO A;  2BWP A;  2CTZ A;  1ASC A;  2AY7 A;  3G0T A;  4B98 A;  1MGV A;  4GDY A;  2BI5 A;  2O1B A;  4Y0D A;  5LH9 A;  3RCH B;  1QIT A;  3UWC A;  5G2P A;  1SVV A;  2BYJ A;  5M49 A;  3A9Z A;  1P3W A;  3CQ5 A;  5G4I A;  2ZC0 A;  3K40 A;  4JEX A;  2Z61 A;  2R5E A;  2BHX A;  3TAT A;  1C7G A;  1G4X A;  3GJU A;  3GR9 A;  4B9B A;  4XQ2 A;  1PFF A;  3AV7 A;  5EIG B;  1IX6 A;  4RJY A;  3BWN A;  3GZD C;  1AIC A;  1AY4 A;  2W7I A;  4PFF A;  1MAP A;  1UU0 A;  2ZY5 A;  1GC3 A;  4A0R A;  2AEV A;  5DJ1 A;  3ISL A;  4F4E A;  1C7O A;  1TOJ A;  2PB2 A;  4DBC A;  2AY1 A;  1WYV A;  3PDB B;  4QGR A;  2CY8 A;  2AEU A;  2Z9X A;  3NUI A;  2WK7 A;  1ELQ A;  2WK9 A;  5M46 A; 
#chains in the Genus database with same CATH topology
 1S06 A;  4JEZ A;  3B1E A;  2TPL A;  3G7Q A;  4XJP A;  1M0O A;  4AOA A;  4XAU A;  1ASA A;  2ZJG A;  3I5T A;  4BMK A;  1BQA A;  1FG3 A;  1V2E A;  2QLR A;  3FFH A;  1XEY A;  2W7K A;  3E9K A;  4WB0 B;  3QHX A;  5HDM A;  2HOZ A;  2AAT A;  4OYT A;  1V2D A;  4A0F A;  3CBF A;  3QGU A;  3L44 A;  4P3M A;  3E2Z A;  4UQV A;  2VMR A;  2CH1 A;  3FVS A;  4Q75 A;  7AAT A;  1ASD A;  2D63 A;  3R9A A;  1KMJ A;  1ARH A;  3ZRP A;  3L8A A;  1SFF A;  2W7E A;  1TOI A;  4Y0I A;  2O7C A;  3FTB A;  3NU8 A;  5EAV A;  4Y0H A;  1WYT B;  1JG8 A;  1QJ5 A;  1QIR A;  1U08 A;  3WLX A;  1H1C A;  4A0H A;  4UOY A;  3B8X A;  2BIE A;  1KL1 A;  4Q6R A;  1W7M A;  2FNU A;  2A1V A;  3BWO A;  4WLH A;  1JS3 A;  4Q31 A;  1ASM A;  3AOW A;  4NOG A;  1GC0 A;  1DGD A;  3F0H A;  3FD0 A;  4JE5 D;  2QB3 A;  3W1J A;  1B9H A;  3PIU A;  4K05 A;  4WYE A;  1Z3Z A;  4R5F A;  3AEJ C;  1AKB A;  5C6U A;  3MAF A;  1YIY A;  4R5Z A;  2CJD A;  2D65 A;  2W8V A;  3EI7 A;  3GZD A;  2VMO A;  1ZOD A;  3E77 A;  2DGM A;  1AHX A;  4ZAH A;  2YKU A;  2WKA A;  4MY5 A;  2ZSL A;  1H0C A;  4BHD A;  4TV7 A;  1IX7 A;  4CBS A;  4F5M A;  2ZY3 A;  1LW5 A;  1ASG A;  1MDO A;  1E5E A;  1YIZ A;  2XBN A;  2DGK A;  3BCX A;  4PVF A;  2Z9V A;  2YRR A;  3CQ4 A;  4AO4 A;  5IWQ A;  3FFR A;  1V2F A;  2R5C B;  2D61 A;  1I29 A;  1AMS A;  3A2B A;  2WK8 A;  3NUB A;  4OBV A;  8AAT A;  1KMK A;  4XEW A;  2PB0 A;  3LV2 A;  4LW4 A;  2YKX A;  3BWN C;  3F6T A;  1CL1 A;  1D7R A;  1O62 A;  2ZYJ A;  1M32 A;  1C7N A;  2HP1 A;  2XH1 A;  1QZ9 A;  3DC1 A;  2FYF A;  1OHV A;  4AH3 A;  4UHN A;  2EZ2 A;  3FKD A;  4A00 A;  3H7F A;  4K2B A;  2W7J A;  4WLJ A;  1CQ8 A;  2E7U A;  5FT5 A;  1O61 A;  2OQX A;  2VYC A;  2AY6 A;  2CFB A;  2Z67 A;  1IVR A;  4Q76 A;  3I4J A;  5F9S A;  3NU7 A;  1JF9 A;  1WKG A;  1Z7D A;  2WB6 A;  3PJ0 A;  4JE5 A;  3PPL A;  2GMS A;  2W8T A;  4EMY A;  3RQ1 A;  4LNL A;  4W5K A;  4MKK A;  1CZC A;  4RKC A;  2D66 A;  3I16 A;  2OAT A;  5F8V A;  1EJI A;  3VP6 A;  2HUU A;  1CL2 A;  1J32 A;  5FT4 A;  2ORD A;  4U1T A;  1LC5 A;  2C0R A;  3NYU A;  5G4J A;  3WGB A;  3WX9 A;  4ADB A;  4L0O A;  1LC7 A;  1DGE A;  3II0 A;  4ITX A;  4WXB A;  1BS0 A;  2OGA A;  2VGV A;  3HVY A;  3HLM A;  3EUC A;  5E3K A;  3HBX A;  4WYD A;  1X29 A;  3RBL A;  1QGN A;  3WCN A;  5E4Z A;  3N4S A;  2FNI A;  4RKD A;  1S09 A;  1ORD A;  3TFU A;  1CS1 A;  2Z1Y A;  3VK2 A;  3K28 A;  3AEN B;  3ELE A;  3HDO A;  4LNM A;  4I8A A;  9AAT A;  4WYC A;  4DQ6 A;  1ZOB A;  1I43 A;  1AAW A;  4GE7 A;  4J5U A;  3GZC A;  4OMA A;  3KGW A;  3FRK A;  4IW7 A;  3EI9 A;  1ASN A;  2OGE A;  3AEL A;  4ADD A;  1AJR A;  4DGT A;  4M2K A;  4OBU A;  1O4S A;  4IYO A;  4AZJ A;  1S0A A;  1TOG A;  2BIG A;  3HT4 A;  1W3U A;  3RUY A;  3VOM A;  5EFS A;  4H63 Q;  1DJE A;  2JJH A;  2VMN A;  1IBJ A;  1WYU A;  2OKK A;  3MBB A;  2VMS A;  4JEV A;  3FQA A;  1ASF A;  4MSO A;  1X0M A;  5TF5 A;  2FKI A;  2VMQ A;  4KYO A;  1S07 A;  4K2I A;  2AY8 A;  3A9Y A;  1D2F A;  3COG A;  3GWP A;  4GE9 A;  4EB7 A;  3IHJ A;  4J8L A;  1ARG A;  2E7I A;  3VK4 A;  5EUN A;  2VI9 A;  3BB8 A;  4A6R A;  5I92 A;  4GSA A;  3N4X A;  1B5P A;  1DJ9 A;  4XK1 A;  4XJL A;  3FSL A;  4H51 A;  5KTB A;  3FZ8 A;  1CQ7 A;  4N0B A;  2QSR A;  4GEB A;  4R2N A;  1AJS B;  1DFO A;  1BJO B;  1GEW A;  1RV4 A;  3DOD A;  2HOX A;  2HUF A;  3WKS A;  2FQ6 A;  3WCO A;  4F5I A;  3LVJ A;  3WGC A;  3LVM A;  2QA3 A;  3USF A;  5LHA A;  2AY9 A;  4A0G A;  2CAN A;  5EQC A;  3E6G A;  3FCR A;  3T32 A;  1OHY A;  3NDN A;  1GBN A;  1LKC A;  3JU7 A;  1DTY A;  1SZK A;  2AY2 A;  4OC9 A;  1AAM A;  2BYL A;  2D7Z A;  4WYF A;  3W1H A;  2QBT A;  1ARI A;  1LK9 A;  2FN6 A;  2ZP7 A;  1D7V A;  2HOR A;  2VIB A;  1OXP A;  1TAS A;  2BIA A;  3FQ8 A;  3CAI A;  4IXO A;  1UU1 A;  1BJN A;  5FT6 A;  3MAU A;  1UU2 A;  1SPA A;  4WBT A;  1T3I A;  4F5K A;  3OKS A;  3IF2 A;  3DZZ A;  3FQ7 A;  4IX8 A;  1TAT A;  2D64 A;  3AEM A;  5EAA A;  3H9X A;  5DB5 A;  4M2J A;  3F9T A;  1B8G A;  1GDE A;  4WYA A;  3ZZK A;  3EIA A;  3E2F A;  3ASB A;  3LVK A;  5M4B A;  1I48 A;  3N4R A;  1X28 A;  2W7D A;  3PD6 A;  3AAT A;  3ZRR A;  2D5Y A;  2HOY A;  3LG0 A;  3NYT A;  3NNK A;  1IJI A;  3LWS A;  1W23 A;  4RJ0 A;  2JG2 A;  1BKG A;  2E7J A;  3QBO A;  4HF8 A;  3VK3 A;  3QM2 A;  3FZ6 A;  1QIS A;  2ZUK A;  2X8U A;  1J04 A;  4W1X A;  3E2Y A;  2EH6 A;  3QN6 A;  4UHM A;  1W7N A;  3RCH A;  1KL2 A;  2VGZ A;  4ITG A;  3OP7 A;  4F5H A;  1M0P A;  2YCN A;  1AX4 A;  3GSB A;  2O0R A;  2VLH A;  2BWN A;  1YJY A;  5HHY A;  1S08 A;  1SZU A;  3E2Z B;  4WXG A;  4LC3 A;  5EUE A;  5G09 A;  2CIN A;  2VI8 A;  1C4K A;  1RVU A;  3AEP A;  3K7Y A;  1GEY A;  1MDX A;  3BC8 A;  3GBX A;  3VAX A;  5EIG A;  1RVY A;  2DOU A;  3ACZ A;  4W1W A;  2W8U A;  3N7N A;  1TPL A;  2BI9 A;  3JTX A;  1V72 A;  1B9I A;  2AY3 A;  2YKY A;  3JWA A;  1B5O A;  1TOK A;  2W7M A;  4ZM4 A;  1D7S A;  4ATQ A;  2W7L A;  2GQN A;  3PDB A;  4A6T A;  1SF2 A;  3NYS A;  3TQX A;  1SZS A;  1AHY A;  2QMA A;  4JEW A;  1G7W A;  2EYQ A;  1AHE A;  1AMR A;  1ELU A;  1MDZ A;  2CST A;  3B1D A;  4ATP A;  1EG5 A;  2YOB A;  3KE3 A;  2GMU A;  3ATH A;  3NRA A;  4CXQ A;  3H14 A;  1OAT A;  1AHG A;  2JIS A;  2Z9U A;  3FDD A;  4TMR A;  3BN1 A;  3MAF B;  1BQD A;  2CB1 A;  4WB0 A;  5BJ3 A;  1AKA A;  2VLF A;  1TAR A;  2RFV A;  1YAA A;  1M4N A;  1AMA A;  4WYG A;  3PGY A;  4IXS A;  3EZ1 A;  4ZDL A;  4ADC A;  1CJ0 A;  2CH2 A;  3A9X A;  2BKW A;  4E3R A;  4CBR A;  1G7X A;  2BI3 A;  1AMQ A;  2HZP A;  4ZDO A;  2V0Y A;  1AIB A;  3EI6 A;  2BWO A;  4IY7 A;  2CJH A;  3WZF A;  5AX8 A;  3B46 A;  2D7Y A;  1BJW A;  1JS6 A;  2DR1 A;  2X5F A;  1WYT A;  1GD9 A;  4OCA A;  1ZC9 A;  4ZDP A;  2W7F A;  1E5F A;  3DU4 A;  2BI2 A;  5BJ4 A;  5E5I A;  3AEM C;  1DJU A;  1G4V A;  4AO9 A;  1B4X A;  1AY8 A;  2VMW A;  4E1O A;  3BCA A;  3FZ7 A;  1M0N A;  2G6W A;  2R0T A;  1QJ3 A;  2FM1 A;  3DR4 A;  2VGS A;  2AY4 A;  3EIB A;  3FVU A;  2Z1Z A;  3HMU A;  1N8P A;  4XJO A;  3QPG A;  4PFN A;  1RV3 A;  3BS8 A;  2KFP A;  3WY7 A;  1CQ6 A;  3BCB A;  4GE4 A;  4OTL A;  2ZY4 A;  5DJ9 A;  4OT8 A;  3RBF A;  4E3Q A;  5DX5 A;  5J8Q A;  2HP2 A;  1KKP A;  4EB5 A;  3AEO A;  1ASE A;  1CZE A;  2R5C A;  4FFC A;  4MQR A;  4BA5 A;  4BA4 A;  1O69 A;  2YCP A;  3BV0 A;  3N5M A;  2W8J A;  4ZWV A;  1LS3 A;  1UKJ A;  4RIT A;  4UHO A;  1GC4 A;  2DGL A;  2YRI A;  1Y4I A;  4HVK A;  3NTJ A;  3ELP A;  2VIA A;  2VMT A;  4PIW A;  1PG8 A;  1YNU A;  1ECX A;  1YJZ A;  2YCT A;  2VMP A;  1XI9 A;  3N0L A;  1PMM A;  4MGR A;  2VMY A;  3DXW A;  3MEB A;  2GSA A;  3GET A;  3P6K A;  4EU1 A;  1ART A;  1AY5 A;  3MC6 A;  3HQT A;  1AIA A;  4O6Z A;  3EI5 A;  1W7L A;  4WD2 A;  3TCM A;  4A6U A;  4ZLV A;  1GCK A;  4ZSY A;  2DKB A;  3JW9 A;  3ECD A;  1BT4 A;  5EUD A;  2YHK A;  2Z20 A;  2EO5 A;  3B1C A;  1YOO A;  4GRX A;  4MQQ A;  3NX3 A;  1M7Y A;  2EGY A;  2C44 A;  2VMV A;  3N75 A;  1KAF A;  2GB3 A;  3Q8N A;  1N2T A;  4E77 A;  3EI8 A;  1OXO A;  1IAY A;  2JJF A;  2VMZ A;  4RM1 A;  4WXF A;  1GC2 A;  4IYO B;  4WP0 A;  1WYV B;  2ZSM A;  4ISY A;  4LW2 A;  3FVX A;  2PO3 A;  3WKR A;  5D95 A;  3P1T A;  2DKJ A;  5JAY A;  1GEX A;  1I41 A;  1WYU B;  3LY1 A;  4ZWM A;  1IAX A;  2Q7W A;  4W1V A;  1PMO A;  2VGU A;  2YKV A;  1EQB A;  3AOV A;  3KGX A;  2VGW A;  1LC8 A;  4F5L A;  5D5S A;  1N31 A;  2ZY2 A;  3MAD A;  4ADE A;  1FC4 A;  1MLZ A;  2Z9W A;  3ZRQ A;  1ARS A;  2X5D A;  1ASB A;  3AEN A;  4KAM A;  4TN4 A;  2W7H A;  3M5U A;  3KKI A;  2G7J A;  2JJG A;  1YJS A;  5M4D A;  4F5F A;  3UE8 A;  3QI6 A;  3HL2 A;  3JWB A;  1C9C A;  2W8W A;  4JF0 A;  2X3L A;  2JJE A;  1MLY A;  3D6K A;  1MAQ A;  5FT8 A;  2VMX A;  1BJ4 A;  2OKJ A;  1WST A;  1BW0 A;  2R2N A;  3A8U X;  3PAA A;  4K2M A;  4EFF A;  4RIZ A;  3ZZJ A;  2BI1 A;  1AHF A;  1IX8 A;  1KKJ A;  2W7G A;  4JEY A;  3RI6 A;  4CVQ A;  4XJM A;  4AZK A;  2VGT A;  4RLG A;  3CQ6 A;  2HUI A;  2EPJ A;  2EZ1 A;  2V1P A;  3DR7 A;  5G0A A;  4KXK A;  4LNJ A;  5K8B A;  3DYD A;  2VMU A;  4FL0 A;  3FDB A;  4W91 A;  1M6S A;  4P7Y A;  1IUG A;  2C7T A;  2JGT A;  2QB2 A;  3EZS A;  4MKJ A;  4F5J A;  3DRD A;  4CXR A;  4JF1 A;  3MKJ A;  3PDX A;  5HXX A;  3DXV A;  5G2Q A;  1C0N A;  1FG7 A;  4ZM3 A;  2NMP A;  1VP4 A;  3PA9 A;  4IXZ A;  3ASA A;  3MC6 C;  4M2M A;  4RAE A;  3G8M A;  4N0W A;  4W8I A;  1OHW A;  4ZAS A;  4R8D A;  1AJS A;  1WKH A;  1BJO A;  1TOE A;  3PD6 B;  3LVL B;  4A72 A;  3W1I A;  4BQ0 A;  1ASL A;  1VEF A;  1D7U A;  4ZSW A;  1LW4 A;  4U2H A;  2AY5 A;  3TFT A;  2F8J A;  3JZL A;  2CJG A;  1M0Q A;  3UAK A;  3AEJ A;  1DKA A;  1X2A A;  2C81 A;  4F5G A;  2E54 A;  3R4T A;  1AKC A;  4MQP A;  1VJO A;  2BWP A;  2CTZ A;  1ASC A;  2AY7 A;  3G0T A;  4B98 A;  1MGV A;  4GDY A;  2BI5 A;  2O1B A;  4Y0D A;  5LH9 A;  3RCH B;  1QIT A;  3UWC A;  5G2P A;  1SVV A;  2BYJ A;  5M49 A;  3A9Z A;  1P3W A;  3CQ5 A;  5G4I A;  2ZC0 A;  3K40 A;  4JEX A;  2Z61 A;  2R5E A;  2BHX A;  3TAT A;  1C7G A;  1G4X A;  3GJU A;  3GR9 A;  4B9B A;  4XQ2 A;  1PFF A;  3AV7 A;  5EIG B;  1IX6 A;  4RJY A;  3BWN A;  3GZD C;  1AIC A;  1AY4 A;  2W7I A;  4PFF A;  1MAP A;  1UU0 A;  2ZY5 A;  1GC3 A;  4A0R A;  2AEV A;  5DJ1 A;  3ISL A;  4F4E A;  1C7O A;  1TOJ A;  2PB2 A;  4DBC A;  2AY1 A;  1WYV A;  3PDB B;  4QGR A;  2CY8 A;  2AEU A;  2Z9X A;  3NUI A;  2WK7 A;  1ELQ A;  2WK9 A;  5M46 A; 
#chains in the Genus database with same CATH homology
 1S06 A;  4JEZ A;  3B1E A;  2TPL A;  3G7Q A;  4XJP A;  1M0O A;  4AOA A;  4XAU A;  1ASA A;  2ZJG A;  3I5T A;  4BMK A;  1BQA A;  1FG3 A;  1V2E A;  2QLR A;  3FFH A;  1XEY A;  2W7K A;  3E9K A;  4WB0 B;  3QHX A;  5HDM A;  2HOZ A;  2AAT A;  4OYT A;  1V2D A;  4A0F A;  3CBF A;  3QGU A;  3L44 A;  4P3M A;  3E2Z A;  4UQV A;  2VMR A;  2CH1 A;  3FVS A;  4Q75 A;  7AAT A;  1ASD A;  2D63 A;  3R9A A;  1KMJ A;  1ARH A;  3ZRP A;  3L8A A;  1SFF A;  2W7E A;  1TOI A;  4Y0I A;  2O7C A;  3FTB A;  3NU8 A;  5EAV A;  4Y0H A;  1WYT B;  1JG8 A;  1QJ5 A;  1QIR A;  1U08 A;  3WLX A;  1H1C A;  4A0H A;  4UOY A;  3B8X A;  2BIE A;  1KL1 A;  4Q6R A;  1W7M A;  2FNU A;  2A1V A;  3BWO A;  4WLH A;  1JS3 A;  4Q31 A;  1ASM A;  3AOW A;  4NOG A;  1GC0 A;  1DGD A;  3F0H A;  3FD0 A;  4JE5 D;  2QB3 A;  3W1J A;  1B9H A;  3PIU A;  4K05 A;  4WYE A;  1Z3Z A;  4R5F A;  3AEJ C;  1AKB A;  5C6U A;  3MAF A;  1YIY A;  4R5Z A;  2CJD A;  2D65 A;  2W8V A;  3EI7 A;  3GZD A;  2VMO A;  1ZOD A;  3E77 A;  2DGM A;  1AHX A;  4ZAH A;  2YKU A;  2WKA A;  4MY5 A;  2ZSL A;  1H0C A;  4BHD A;  4TV7 A;  1IX7 A;  4CBS A;  4F5M A;  2ZY3 A;  1LW5 A;  1ASG A;  1MDO A;  1E5E A;  1YIZ A;  2XBN A;  2DGK A;  3BCX A;  4PVF A;  2Z9V A;  2YRR A;  3CQ4 A;  4AO4 A;  5IWQ A;  3FFR A;  1V2F A;  2R5C B;  2D61 A;  1I29 A;  1AMS A;  3A2B A;  2WK8 A;  3NUB A;  4OBV A;  8AAT A;  1KMK A;  4XEW A;  2PB0 A;  3LV2 A;  4LW4 A;  2YKX A;  3BWN C;  3F6T A;  1CL1 A;  1D7R A;  1O62 A;  2ZYJ A;  1M32 A;  1C7N A;  2HP1 A;  2XH1 A;  1QZ9 A;  3DC1 A;  2FYF A;  1OHV A;  4AH3 A;  4UHN A;  2EZ2 A;  3FKD A;  4A00 A;  3H7F A;  4K2B A;  2W7J A;  4WLJ A;  1CQ8 A;  2E7U A;  5FT5 A;  1O61 A;  2OQX A;  2VYC A;  2AY6 A;  2CFB A;  2Z67 A;  1IVR A;  4Q76 A;  3I4J A;  5F9S A;  3NU7 A;  1JF9 A;  1WKG A;  1Z7D A;  2WB6 A;  3PJ0 A;  4JE5 A;  3PPL A;  2GMS A;  2W8T A;  4EMY A;  3RQ1 A;  4LNL A;  4W5K A;  4MKK A;  1CZC A;  4RKC A;  2D66 A;  3I16 A;  2OAT A;  5F8V A;  1EJI A;  3VP6 A;  2HUU A;  1CL2 A;  1J32 A;  5FT4 A;  2ORD A;  4U1T A;  1LC5 A;  2C0R A;  3NYU A;  5G4J A;  3WGB A;  3WX9 A;  4ADB A;  4L0O A;  1LC7 A;  1DGE A;  3II0 A;  4ITX A;  4WXB A;  1BS0 A;  2OGA A;  2VGV A;  3HVY A;  3HLM A;  3EUC A;  5E3K A;  3HBX A;  4WYD A;  1X29 A;  3RBL A;  1QGN A;  3WCN A;  5E4Z A;  3N4S A;  2FNI A;  4RKD A;  1S09 A;  1ORD A;  3TFU A;  1CS1 A;  2Z1Y A;  3VK2 A;  3K28 A;  3AEN B;  3ELE A;  3HDO A;  4LNM A;  4I8A A;  9AAT A;  4WYC A;  4DQ6 A;  1ZOB A;  1I43 A;  1AAW A;  4GE7 A;  4J5U A;  3GZC A;  4OMA A;  3KGW A;  3FRK A;  4IW7 A;  3EI9 A;  1ASN A;  2OGE A;  3AEL A;  4ADD A;  1AJR A;  4DGT A;  4M2K A;  4OBU A;  1O4S A;  4IYO A;  4AZJ A;  1S0A A;  1TOG A;  2BIG A;  3HT4 A;  1W3U A;  3RUY A;  3VOM A;  5EFS A;  4H63 Q;  1DJE A;  2JJH A;  2VMN A;  1IBJ A;  1WYU A;  2OKK A;  3MBB A;  2VMS A;  4JEV A;  3FQA A;  1ASF A;  4MSO A;  1X0M A;  5TF5 A;  2FKI A;  2VMQ A;  4KYO A;  1S07 A;  4K2I A;  2AY8 A;  3A9Y A;  1D2F A;  3COG A;  3GWP A;  4GE9 A;  4EB7 A;  3IHJ A;  4J8L A;  1ARG A;  2E7I A;  3VK4 A;  5EUN A;  2VI9 A;  3BB8 A;  4A6R A;  5I92 A;  4GSA A;  3N4X A;  1B5P A;  1DJ9 A;  4XK1 A;  4XJL A;  3FSL A;  4H51 A;  5KTB A;  3FZ8 A;  1CQ7 A;  4N0B A;  2QSR A;  4GEB A;  4R2N A;  1AJS B;  1DFO A;  1BJO B;  1GEW A;  1RV4 A;  3DOD A;  2HOX A;  2HUF A;  3WKS A;  2FQ6 A;  3WCO A;  4F5I A;  3LVJ A;  3WGC A;  3LVM A;  2QA3 A;  3USF A;  5LHA A;  2AY9 A;  4A0G A;  2CAN A;  5EQC A;  3E6G A;  3FCR A;  3T32 A;  1OHY A;  3NDN A;  1GBN A;  1LKC A;  3JU7 A;  1DTY A;  1SZK A;  2AY2 A;  4OC9 A;  1AAM A;  2BYL A;  2D7Z A;  4WYF A;  3W1H A;  2QBT A;  1ARI A;  1LK9 A;  2FN6 A;  2ZP7 A;  1D7V A;  2HOR A;  2VIB A;  1OXP A;  1TAS A;  2BIA A;  3FQ8 A;  3CAI A;  4IXO A;  1UU1 A;  1BJN A;  5FT6 A;  3MAU A;  1UU2 A;  1SPA A;  4WBT A;  1T3I A;  4F5K A;  3OKS A;  3IF2 A;  3DZZ A;  3FQ7 A;  4IX8 A;  1TAT A;  2D64 A;  3AEM A;  5EAA A;  3H9X A;  5DB5 A;  4M2J A;  3F9T A;  1B8G A;  1GDE A;  4WYA A;  3ZZK A;  3EIA A;  3E2F A;  3ASB A;  3LVK A;  5M4B A;  1I48 A;  3N4R A;  1X28 A;  2W7D A;  3PD6 A;  3AAT A;  3ZRR A;  2D5Y A;  2HOY A;  3LG0 A;  3NYT A;  3NNK A;  1IJI A;  3LWS A;  1W23 A;  4RJ0 A;  2JG2 A;  1BKG A;  2E7J A;  3QBO A;  4HF8 A;  3VK3 A;  3QM2 A;  3FZ6 A;  1QIS A;  2ZUK A;  2X8U A;  1J04 A;  4W1X A;  3E2Y A;  2EH6 A;  3QN6 A;  4UHM A;  1W7N A;  3RCH A;  1KL2 A;  2VGZ A;  4ITG A;  3OP7 A;  4F5H A;  1M0P A;  2YCN A;  1AX4 A;  3GSB A;  2O0R A;  2VLH A;  2BWN A;  1YJY A;  5HHY A;  1S08 A;  1SZU A;  3E2Z B;  4WXG A;  4LC3 A;  5EUE A;  5G09 A;  2CIN A;  2VI8 A;  1C4K A;  1RVU A;  3AEP A;  3K7Y A;  1GEY A;  1MDX A;  3BC8 A;  3GBX A;  3VAX A;  5EIG A;  1RVY A;  2DOU A;  3ACZ A;  4W1W A;  2W8U A;  3N7N A;  1TPL A;  2BI9 A;  3JTX A;  1V72 A;  1B9I A;  2AY3 A;  2YKY A;  3JWA A;  1B5O A;  1TOK A;  2W7M A;  4ZM4 A;  1D7S A;  4ATQ A;  2W7L A;  2GQN A;  3PDB A;  4A6T A;  1SF2 A;  3NYS A;  3TQX A;  1SZS A;  1AHY A;  2QMA A;  4JEW A;  1G7W A;  2EYQ A;  1AHE A;  1AMR A;  1ELU A;  1MDZ A;  2CST A;  3B1D A;  4ATP A;  1EG5 A;  2YOB A;  3KE3 A;  2GMU A;  3ATH A;  3NRA A;  4CXQ A;  3H14 A;  1OAT A;  1AHG A;  2JIS A;  2Z9U A;  3FDD A;  4TMR A;  3BN1 A;  3MAF B;  1BQD A;  2CB1 A;  4WB0 A;  5BJ3 A;  1AKA A;  2VLF A;  1TAR A;  2RFV A;  1YAA A;  1M4N A;  1AMA A;  4WYG A;  3PGY A;  4IXS A;  3EZ1 A;  4ZDL A;  4ADC A;  1CJ0 A;  2CH2 A;  3A9X A;  2BKW A;  4E3R A;  4CBR A;  1G7X A;  2BI3 A;  1AMQ A;  2HZP A;  4ZDO A;  2V0Y A;  1AIB A;  3EI6 A;  2BWO A;  4IY7 A;  2CJH A;  3WZF A;  5AX8 A;  3B46 A;  2D7Y A;  1BJW A;  1JS6 A;  2DR1 A;  2X5F A;  1WYT A;  1GD9 A;  4OCA A;  1ZC9 A;  4ZDP A;  2W7F A;  1E5F A;  3DU4 A;  2BI2 A;  5BJ4 A;  5E5I A;  3AEM C;  1DJU A;  1G4V A;  4AO9 A;  1B4X A;  1AY8 A;  2VMW A;  4E1O A;  3BCA A;  3FZ7 A;  1M0N A;  2G6W A;  2R0T A;  1QJ3 A;  2FM1 A;  3DR4 A;  2VGS A;  2AY4 A;  3EIB A;  3FVU A;  2Z1Z A;  3HMU A;  1N8P A;  4XJO A;  3QPG A;  4PFN A;  1RV3 A;  3BS8 A;  2KFP A;  3WY7 A;  1CQ6 A;  3BCB A;  4GE4 A;  4OTL A;  2ZY4 A;  5DJ9 A;  4OT8 A;  3RBF A;  4E3Q A;  5DX5 A;  5J8Q A;  2HP2 A;  1KKP A;  4EB5 A;  3AEO A;  1ASE A;  1CZE A;  2R5C A;  4FFC A;  4MQR A;  4BA5 A;  4BA4 A;  1O69 A;  2YCP A;  3BV0 A;  3N5M A;  2W8J A;  4ZWV A;  1LS3 A;  1UKJ A;  4RIT A;  4UHO A;  1GC4 A;  2DGL A;  2YRI A;  1Y4I A;  4HVK A;  3NTJ A;  3ELP A;  2VIA A;  2VMT A;  4PIW A;  1PG8 A;  1YNU A;  1ECX A;  1YJZ A;  2YCT A;  2VMP A;  1XI9 A;  3N0L A;  1PMM A;  4MGR A;  2VMY A;  3DXW A;  3MEB A;  2GSA A;  3GET A;  3P6K A;  4EU1 A;  1ART A;  1AY5 A;  3MC6 A;  3HQT A;  1AIA A;  4O6Z A;  3EI5 A;  1W7L A;  4WD2 A;  3TCM A;  4A6U A;  4ZLV A;  1GCK A;  4ZSY A;  2DKB A;  3JW9 A;  3ECD A;  1BT4 A;  5EUD A;  2YHK A;  2Z20 A;  2EO5 A;  3B1C A;  1YOO A;  4GRX A;  4MQQ A;  3NX3 A;  1M7Y A;  2EGY A;  2C44 A;  2VMV A;  3N75 A;  2GB3 A;  3Q8N A;  1N2T A;  4E77 A;  3EI8 A;  1OXO A;  1IAY A;  2JJF A;  2VMZ A;  4RM1 A;  4WXF A;  1GC2 A;  4IYO B;  4WP0 A;  1WYV B;  2ZSM A;  4ISY A;  4LW2 A;  3FVX A;  2PO3 A;  3WKR A;  5D95 A;  3P1T A;  2DKJ A;  5JAY A;  1GEX A;  1I41 A;  1WYU B;  3LY1 A;  4ZWM A;  1IAX A;  2Q7W A;  4W1V A;  1PMO A;  2VGU A;  2YKV A;  1EQB A;  3AOV A;  3KGX A;  2VGW A;  1LC8 A;  4F5L A;  5D5S A;  1N31 A;  2ZY2 A;  3MAD A;  4ADE A;  1FC4 A;  1MLZ A;  2Z9W A;  3ZRQ A;  1ARS A;  2X5D A;  1ASB A;  3AEN A;  4KAM A;  4TN4 A;  2W7H A;  3M5U A;  3KKI A;  2G7J A;  2JJG A;  1YJS A;  5M4D A;  4F5F A;  3UE8 A;  3QI6 A;  3HL2 A;  3JWB A;  1C9C A;  2W8W A;  4JF0 A;  2X3L A;  2JJE A;  1MLY A;  3D6K A;  1MAQ A;  5FT8 A;  2VMX A;  1BJ4 A;  2OKJ A;  1WST A;  1BW0 A;  2R2N A;  3A8U X;  3PAA A;  4K2M A;  4EFF A;  4RIZ A;  3ZZJ A;  2BI1 A;  1AHF A;  1IX8 A;  1KKJ A;  2W7G A;  4JEY A;  3RI6 A;  4CVQ A;  4XJM A;  4AZK A;  2VGT A;  4RLG A;  3CQ6 A;  2HUI A;  2EPJ A;  2EZ1 A;  2V1P A;  3DR7 A;  5G0A A;  4KXK A;  4LNJ A;  5K8B A;  3DYD A;  2VMU A;  4FL0 A;  3FDB A;  4W91 A;  1M6S A;  4P7Y A;  1IUG A;  2C7T A;  2JGT A;  2QB2 A;  3EZS A;  4MKJ A;  4F5J A;  3DRD A;  4CXR A;  4JF1 A;  3MKJ A;  3PDX A;  5HXX A;  3DXV A;  5G2Q A;  1C0N A;  1FG7 A;  4ZM3 A;  2NMP A;  1VP4 A;  3PA9 A;  4IXZ A;  3ASA A;  3MC6 C;  4M2M A;  4RAE A;  3G8M A;  4N0W A;  4W8I A;  1OHW A;  4ZAS A;  4R8D A;  1AJS A;  1WKH A;  1BJO A;  1TOE A;  3PD6 B;  3LVL B;  4A72 A;  3W1I A;  4BQ0 A;  1ASL A;  1VEF A;  1D7U A;  4ZSW A;  1LW4 A;  4U2H A;  2AY5 A;  3TFT A;  2F8J A;  3JZL A;  2CJG A;  1M0Q A;  3UAK A;  3AEJ A;  1DKA A;  1X2A A;  2C81 A;  4F5G A;  2E54 A;  3R4T A;  1AKC A;  4MQP A;  1VJO A;  2BWP A;  2CTZ A;  1ASC A;  2AY7 A;  3G0T A;  4B98 A;  1MGV A;  4GDY A;  2BI5 A;  2O1B A;  4Y0D A;  5LH9 A;  3RCH B;  1QIT A;  3UWC A;  5G2P A;  1SVV A;  2BYJ A;  5M49 A;  3A9Z A;  1P3W A;  3CQ5 A;  5G4I A;  2ZC0 A;  3K40 A;  4JEX A;  2Z61 A;  2R5E A;  2BHX A;  3TAT A;  1C7G A;  1G4X A;  3GJU A;  3GR9 A;  4B9B A;  4XQ2 A;  1PFF A;  3AV7 A;  5EIG B;  1IX6 A;  4RJY A;  3BWN A;  3GZD C;  1AIC A;  1AY4 A;  2W7I A;  4PFF A;  1MAP A;  1UU0 A;  2ZY5 A;  1GC3 A;  4A0R A;  2AEV A;  5DJ1 A;  3ISL A;  4F4E A;  1C7O A;  1TOJ A;  2PB2 A;  4DBC A;  2AY1 A;  1WYV A;  3PDB B;  4QGR A;  2CY8 A;  2AEU A;  2Z9X A;  3NUI A;  2WK7 A;  1ELQ A;  2WK9 A;  5M46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...