4F5HA

Intercoversion of substrate specificity: e. coli aspatate aminotransferase to tyrosine aminotransferase: chimera p3.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
397
structure length
396
Chain Sequence
b'GTFENITAAPADPILGLADLFRADERPGKVDLGIGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKELIVASSYSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Janus: prediction and ranking of mutations required for functional interconversion of enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 146
structure length 396
sequence length 397
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f5hA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f5hA01
3QPGA 1TARA 3FFRA 4XJPA 4FFCA 1N31A 1ZODA 4IXOA 4WYAA 1I41A 3HBXA 3R9AA 3RCHA 4E77A 4F5LA 4ZM4A 2BYLA 1ORDA 1T3IA 3HMUA 3JTXA 1MLYA 3ZZJA 1GCKA 1M32A 3L8AA 3QGUA 1S07A 2W7FA 2CB1A 2VMUA 4P7YA 5G4IA 3WKRA 3H7FA 3WCNA 3DR7A 5FT5A 4BA5A 1D7RA 1X2AA 1OHWA 1AJRA 4ATQA 1GEYA 3VK3A 2WK7A 3AELA 4ADBA 4WLHA 1KL1A 4IXSA 1DGEA 4A6TA 1BT4A 2AY1A 4CVQA 3I5TA 3WGCA 2W7LA 1AICA 2W8UA 2D61A 1G4VA 4JEXA 5G0AA 1ASDA 2X8UA 1MDZA 3KKIA 4W5KA 4H51A 1B5PA 1I29A 3A9XA 4PFFA 1DTYA 1D2FA 3BV0A 1KL2A 2BI2A 3CQ6A 4TV7A 2ZY4A 2DGMA 5F8VA 1AHFA 1UU0A 1Z7DA 2VMSA 3F6TA 4GRXA 1ASGA 3WX9A 2Z9VA 3F9TA 2FNUA 5DJ9A 3ELEA 2FYFA 3E9KA 4N0BA 5LHAA 3W1IA 2AY5A 1BJOB 1WSTA 1AY5A 5EFSA 1P3WA 3QI6A 5G4JA 1TPLA 1X29A 1ASFA 2O0RA 4WXGA 3TQXA 1GD9A 1LC8A 2RFVA 2EH6A 3E6GA 3FD0A 3RCHB 4A0GA 1BJWA 1PMMA 1W7MA 3EIAA 1WYVA 4WP0A 4W1VA 4NOGA 2ZY3A 2OKKA 5FT8A 4BHDA 2DGKA 2HOZA 2GQNA 1CL1A 2C81A 2AY3A 4LW2A 3B46A 3MKJA 4UOYA 3ASAA 5E4ZA 1AMRA 2EO5A 2HUUA 2OATA 4ZSYA 2F8JA 4EMYA 1PMOA 1B5OA 3GBXA 2XBNA 1DJ9A 3A2BA 3ELPA 4EU1A 3WGBA 4RM1A 1C7GA 2BI5A 3KGWA 1XEYA 2VGVA 4WYCA 4XQ2A 4Q31A 4ADDA 2BWPA 2OQXA 3QBOA 1I48A 4CBSA 4F5FA 2W8VA 1BKGA 1GC0A 1WKHA 3ZZKA 1BQAA 2E7IA 4WD2A 3M5UA 3PGYA 4M2KA 4MSOA 2CH2A 1AMQA 3IF2A 2PB0A 2ZSLA 2E7JA 3BN1A 2ZSMA 2WK8A 5TF5A 3JW9A 2CINA 2R5CA 2YCPA 3BWNA 1S09A 3NDNA 3BC8A 4LNJA 5AX8A 2C0RA 5EIGB 3MBBA 1S08A 4M2JA 1MDXA 1SFFA 2AEUA 3LY1A 4K2IA 3E77A 1ARGA 5EUDA 2VIBA 3NTJA 2CSTA 3UAKA 3FDBA 1W7LA 1OHVA 4GE4A 3MADA 1WYVB 3AEMC 2VGZA 3HDOA 4MQQA 5FT4A 2AY8A 1CJ0A 3L44A 4ADCA 3PPLA 4JE5D 1W3UA 4O6ZA 1IJIA 3HL2A 5G2PA 1QGNA 2W8JA 1XI9A 5DJ1A 1YJZA 1RV3A 3BWOA 3NU7A 3UE8A 4UHMA 3FQ8A 4XJOA 1AJSA 2Z9UA 2W7GA 4JF1A 4F5GA 1V2FA 4KXKA 3HQTA 1RVYA 2AY2A 2D7ZA 4ZDPA 1ARSA 3FQAA 1LC7A 2HUIA 3FSLA 4J8LA 1AKCA 2FM1A 1FG7A 4XJMA 2BIAA 3RQ1A 3ASBA 3PIUA 1M0PA 1DFOA 1G7WA 1X0MA 2D64A 1CQ7A 4F5HA 3UWCA 4WXBA 4N0WA 4A0FA 3G0TA 1UU1A 2YKVA 4Q6RA 4W1XA 2GMSA 3I4JA 1ASLA 4RJYA 1J32A 4JEZA 1CZEA 1YJYA 2X5FA 2W7KA 1AKAA 1SVVA 1SF2A 4WYDA 2V0YA 2ZY5A 2R5CB 2FNIA 1SZSA 3ATHA 1KKJA 1LK9A 2VMZA 3AOVA 3AEMA 4WXFA 2X3LA 3FQ7A 2GMUA 2AY9A 4JEVA 1WKGA 2OGEA 4UQVA 2ZC0A 5J8QA 1JF9A 2W7HA 2VYCA 3COGA 2YKXA 3FVUA 1S06A 2G6WA 2BI1A 4RLGA 3KE3A 4R8DA 4OTLA 2CFBA 1G4XA 4CXQA 1MAPA 4IY7A 4W1WA 1YJSA 2EGYA 3FZ6A 3ECDA 1ARIA 3OKSA 1EG5A 2YKYA 4EB7A 2AATA 1ARTA 3N75A 4R2NA 3PDXA 4PVFA 2E7UA 1C0NA 1AJSB 2W7EA 3H14A 4ADEA 1O69A 1CZCA 5EAAA 5M4DA 1JS6A 1ASAA 1LW4A 2QMAA 1LKCA 2BI3A 3DXWA 3EI7A 3FFHA 1D7VA 4WBTA 1DKAA 2BIGA 4K2MA 1ECXA 1FG3A 3R4TA 2D7YA 2ZJGA 2R0TA 1C7NA 3K7YA 1E5EA 1MGVA 1IAYA 1OHYA 1BJNA 3A8UX 4L0OA 4JEWA 2BWNA 3DZZA 8AATA 3BWNC 4F5MA 3PDBA 2Z61A 4E3RA 3LWSA 1BW0A 3GWPA 1SZKA 3USFA 4BQ0A 2JJGA 4AH3A 1AAMA 5EQCA 5D95A 5M49A 1M7YA 1AHGA 2Z1YA 3CQ5A 4E1OA 4ATPA 4EB5A 1U08A 1ASEA 2YOBA 3ZRRA 1V72A 3GSBA 4XAUA 3FVSA 4F4EA 1ASMA 4WYGA 2Z1ZA 4GSAA 1BS0A 1IX7A 4Y0HA 1C4KA 2AY6A 3DC1A 2ZP7A 4ZWMA 3FVXA 3HLMA 3RBLA 2NMPA 2FQ6A 2JJHA 1YOOA 5IWQA 4IYOA 1AIAA 1LC5A 2W8TA 1BJ4A 3LVJA 3WY7A 1I43A 5HXXA 1SPAA 4RJ0A 1IX8A 2BI9A 1JG8A 4UHNA 4B9BA 3B8XA 2AEVA 3GR9A 3HT4A 2BWOA 1CS1A 1TOJA 3W1JA 4A0RA 3FKDA 4JE5A 2Z67A 1KKPA 1B8GA 4OT8A 1KMKA 4R5FA 4B98A 1J04A 3FRKA 4ZDOA 5F9SA 2VI9A 1PFFA 1RV4A 1UKJA 4TN4A 4GEBA 2HUFA 1M0OA 1Z3ZA 4ZM3A 2VMOA 3GZDC 1AMSA 4HVKA 1MDOA 4RAEA 1QISA 1OXPA 4JEYA 4RITA 2Z9WA 4WYFA 3AENA 1IUGA 2R2NA 4MGRA 3PDBB 2ZUKA 3ZRPA 1M0NA 4MQPA 5E5IA 4A72A 4AZKA 3GETA 1H1CA 3P6KA 2QLRA 2VMRA 3AEJC 1AHYA 3ACZA 1D7SA 3A9ZA 1AMAA 1PG8A 3MC6A 1OATA 2DOUA 2VGWA 1N8PA 3LV2A 3NNKA 5HHYA 4F5JA 5FT6A 1QJ5A 2PO3A 3NYSA 2VLHA 1W7NA 3WCOA 2W8WA 3N0LA 5M46A 2VGUA 3QN6A 3NX3A 4OYTA 3KGXA 1N2TA 4CXRA 3NU8A 5BJ3A 4IXZA 4IYOB 1GC4A 2W7IA 1VJOA 2JJEA 4W91A 4HF8A 1DJEA 1AAWA 4MKJA 2Z9XA 1M0QA 3PA9A 1AHEA 7AATA 4A6UA 2CJHA 1ASNA 4A0HA 4PFNA 3WKSA 3VOMA 3GZDA 1B4XA 3CAIA 3QHXA 4KAMA 3AEOA 1GEXA 2DR1A 4BMKA 1TATA 1ZC9A 3BS8A 3DXVA 1B9HA 2PB2A 3QM2A 3CBFA 3WLXA 4QGRA 5M4BA 1AY4A 3AENB 4WYEA 2VMXA 3AEJA 2C44A 2HP1A 5DB5A 4CBRA 2HP2A 3JU7A 2ZY2A 2Z20A 2WK9A 1YAAA 2QB3A 1TASA 1B9IA 4XJLA 4DBCA 1YIYA 5EAVA 2YKUA 1AX4A 3MAUA 1AY8A 3G7QA 4LW4A 1TOGA 2XH1A 3T32A 1TOIA 3RUYA 4IW7A 4LNMA 3B1EA 3FCRA 2HOXA 3LVMA 1M6SA 5DX5A 1Y4IA 9AATA 1GEWA 5HDMA 3BCBA 3GJUA 4AO9A 2ORDA 4ZAHA 5EUNA 4ZDLA 2W7MA 2CJGA 1LW5A 2VI8A 3LVKA 3PAAA 2ZYJA 4LC3A 4XEWA 2OKJA 4GE7A 1ELQA 3NUIA 3BCXA 1QJ3A 2EPJA 3Q8NA 3TATA 5LH9A 3ISLA 4MQRA 1MAQA 3N5MA 3PD6A 1KMJA 2CTZA 1DJUA 5C6UA 3LVLB 3EZSA 4R5ZA 3TFUA 3FTBA 4A00A 2CANA 1ZOBA 1GC3A 2Q7WA 2VMVA 2VMQA 1IX6A 2GSAA 1EQBA 3D6KA 3EI8A 1CQ6A 4A6RA 1ASBA 2D65A 1QZ9A 3MEBA 3JZLA 4OBVA 1O61A 3BB8A 4OCAA 1D7UA 2D63A 4PIWA 1LS3A 5D5SA 1C7OA 2BHXA 2EZ1A 3EI9A 2W7DA 4DGTA 1RVUA 2VLFA 3NUBA 4P3MA 3VK2A 1H0CA 1CL2A 2AY4A 3RI6A 1TOKA 1CQ8A 5EIGA 1ARHA 1EJIA 1WYUA 3MC6C 2VMPA 1VEFA 1M4NA 2X5DA 3B1DA 3E2ZA 3I16A 4WB0A 4E3QA 4F5IA 5K8BA 1OXOA 2BKWA 1IVRA 2CJDA 2OGAA 2VMNA 3VP6A 3ZRQA 5EUEA 3A9YA 3AEPA 5E3KA 1ASCA 4EFFA 4ITGA 3CQ4A 2D66A 3DYDA 1QIRA 3JWAA 4GDYA 2CH1A 2O7CA 4WLJA 1UU2A 4XK1A 4W8IA 1TOEA 3VAXA 2BIEA 2QA3A 3DU4A 4TMRA 3W1HA 3NYUA 1AIBA 1GC2A 1O4SA 2BYJA 3MAFA 1V2EA 3OP7A 4I8AA 4OC9A 4DQ6A 4RKCA 5JAYA 1BQDA 3E2YA 2DKJA 3K40A 3EI6A 2D5YA 3PD6B 3E2FA 4FL0A 3II0A 1G7XA 1WYTA 4UHOA 1V2DA 1MLZA 4RKDA 3F0HA 2EZ2A 1C9CA 4K2BA 3EZ1A 3AV7A 4JF0A 4BA4A 2CY8A 3RBFA 1IBJA 2TPLA 4F5KA 2HORA 4MKKA 4J5UA 2HZPA 4OBUA 1SZUA 4Y0IA 5G09A 4KYOA 4Q76A 1AHXA 1IAXA 3B1CA 3FDDA 2YCNA 2VMYA 3IHJA 5G2QA 2AY7A 3TFTA 3LG0A 3GZCA 4GE9A 1WYUB 3BCAA 4U1TA 3E2ZB 2O1BA 1FC4A 4WB0B 4Y0DA 4AO4A 4AZJA 2VGSA 2YCTA 2YRRA 2GB3A 2VIAA 4ISYA 2DKBA 4U2HA 3JWBA 1GDEA 2E54A 3NYTA 1YIZA 1DGDA 2V1PA 3EI5A 5BJ4A 2QBTA 3WZFA 2QB2A 2HOYA 1S0AA 3DR4A 3K28A 4MY5A 4ZWVA 4RIZA 3DODA 2JJFA 4IX8A 4ZSWA 2YRIA 5I92A 2W7JA 3EIBA 3HVYA 3PJ0A 3AOWA 1ELUA 1W23A 1AKBA 4ZLVA 1GBNA 3EUCA 2JISA 3MAFB 2YHKA 4ITXA 3VK4A 2JGTA 4M2MA 1O62A 2VGTA 3NRAA 2DGLA 3FZ8A 3DRDA 4Q75A 1JS3A 3FZ7A 1BJOA 2JG2A 2R5EA 2VMTA 1QITA 1YNUA 1X28A 1VP4A 2WKAA 1WYTB 2C7TA 3P1TA 4OMAA 4AOAA 2FN6A 2VMWA 3AATA 4ZASA 3TCMA 1E5FA 3G8MA 4LNLA
chains in the Genus database with same CATH superfamily
3QPGA 1TARA 3FFRA 4XJPA 4FFCA 1N31A 1ZODA 4IXOA 4WYAA 1I41A 3HBXA 3R9AA 3RCHA 4E77A 4F5LA 4ZM4A 2BYLA 1ORDA 1T3IA 3HMUA 3JTXA 1MLYA 3ZZJA 1GCKA 1M32A 3L8AA 3QGUA 1S07A 2W7FA 2CB1A 2VMUA 4P7YA 5G4IA 3WKRA 3H7FA 3WCNA 3DR7A 5FT5A 4BA5A 1D7RA 1X2AA 1OHWA 1AJRA 4ATQA 1GEYA 3VK3A 2WK7A 3AELA 4ADBA 4WLHA 1KL1A 4IXSA 1DGEA 4A6TA 1BT4A 2AY1A 4CVQA 3I5TA 3WGCA 2W7LA 1AICA 2W8UA 2D61A 1G4VA 4JEXA 5G0AA 1ASDA 2X8UA 1MDZA 3KKIA 4W5KA 4H51A 1B5PA 1I29A 3A9XA 4PFFA 1DTYA 1D2FA 3BV0A 1KL2A 2BI2A 3CQ6A 3N4RA 4TV7A 2ZY4A 2DGMA 5F8VA 1AHFA 1UU0A 1Z7DA 2VMSA 3F6TA 4GRXA 1ASGA 3WX9A 2Z9VA 3F9TA 2FNUA 5DJ9A 3ELEA 2FYFA 3E9KA 4N0BA 5LHAA 3W1IA 2AY5A 1BJOB 1WSTA 1AY5A 5EFSA 1P3WA 3QI6A 5G4JA 1TPLA 1X29A 1ASFA 2O0RA 4WXGA 3TQXA 1GD9A 1LC8A 2RFVA 2EH6A 3E6GA 3FD0A 3RCHB 4A0GA 1BJWA 4K05A 1PMMA 1W7MA 3EIAA 1WYVA 4WP0A 4W1VA 4NOGA 2ZY3A 2OKKA 5FT8A 4BHDA 2DGKA 2HOZA 2GQNA 1CL1A 2C81A 2AY3A 4LW2A 3B46A 3MKJA 4UOYA 3ASAA 5E4ZA 1AMRA 2EO5A 2HUUA 2OATA 4ZSYA 2F8JA 4EMYA 1PMOA 1B5OA 3GBXA 2XBNA 1DJ9A 3A2BA 3ELPA 4EU1A 3WGBA 4RM1A 1C7GA 2BI5A 3KGWA 1XEYA 2VGVA 4WYCA 4XQ2A 4Q31A 4ADDA 2BWPA 2OQXA 3QBOA 1I48A 4CBSA 4F5FA 2W8VA 1BKGA 1GC0A 1WKHA 3ZZKA 1BQAA 2E7IA 4WD2A 3M5UA 3PGYA 4M2KA 4MSOA 2CH2A 1AMQA 3IF2A 2PB0A 2ZSLA 2E7JA 3BN1A 2ZSMA 2WK8A 5TF5A 3JW9A 2CINA 2R5CA 2YCPA 3BWNA 1S09A 3NDNA 3BC8A 4LNJA 5AX8A 2C0RA 5EIGB 3MBBA 1S08A 4M2JA 1MDXA 1SFFA 2AEUA 3LY1A 4K2IA 3E77A 1ARGA 5EUDA 2VIBA 3NTJA 2CSTA 3UAKA 3FDBA 1W7LA 1OHVA 4GE4A 3MADA 1WYVB 3AEMC 2VGZA 3HDOA 4MQQA 5FT4A 2A1VA 2AY8A 2QSRA 1CJ0A 3L44A 4ADCA 3PPLA 4JE5D 1W3UA 4O6ZA 1IJIA 3HL2A 5G2PA 1QGNA 2W8JA 1XI9A 5DJ1A 1YJZA 1RV3A 3BWOA 3NU7A 3UE8A 4UHMA 3FQ8A 4XJOA 1AJSA 2Z9UA 2W7GA 4JF1A 4F5GA 1V2FA 4KXKA 3HQTA 1RVYA 2AY2A 2D7ZA 4ZDPA 1ARSA 3FQAA 1LC7A 2HUIA 3FSLA 4J8LA 1AKCA 2FM1A 1FG7A 4XJMA 2BIAA 3RQ1A 3ASBA 3PIUA 1M0PA 1DFOA 1G7WA 1X0MA 2D64A 1CQ7A 4F5HA 3UWCA 4WXBA 4N0WA 4A0FA 3G0TA 1UU1A 2YKVA 4Q6RA 4W1XA 2GMSA 3I4JA 1ASLA 4RJYA 1J32A 4JEZA 1CZEA 1YJYA 2X5FA 2W7KA 1AKAA 1SVVA 1SF2A 4WYDA 2V0YA 2FKIA 2ZY5A 2R5CB 2FNIA 1SZSA 3N4XA 3ATHA 1KKJA 1LK9A 2VMZA 3AOVA 3AEMA 4WXFA 2X3LA 3FQ7A 2GMUA 2AY9A 4JEVA 1WKGA 2OGEA 4UQVA 2ZC0A 5J8QA 1JF9A 2W7HA 2VYCA 3COGA 2YKXA 3FVUA 1S06A 2G6WA 2BI1A 4RLGA 3KE3A 4R8DA 4OTLA 2CFBA 1G4XA 4CXQA 1MAPA 4IY7A 4W1WA 1YJSA 2EGYA 3FZ6A 3ECDA 1ARIA 3OKSA 1EG5A 2YKYA 4EB7A 2AATA 1ARTA 3N75A 4R2NA 3PDXA 4PVFA 2E7UA 1C0NA 1AJSB 2W7EA 3H14A 4ADEA 1O69A 1CZCA 5EAAA 5M4DA 1JS6A 1ASAA 1LW4A 2QMAA 1LKCA 2BI3A 3DXWA 3EI7A 3FFHA 1D7VA 4WBTA 1DKAA 2BIGA 4K2MA 1ECXA 3N4SA 1FG3A 3R4TA 2D7YA 2ZJGA 2R0TA 1C7NA 3K7YA 1E5EA 1MGVA 5KTBA 1IAYA 1OHYA 1BJNA 3A8UX 4L0OA 4JEWA 2BWNA 3DZZA 8AATA 3BWNC 4F5MA 3PDBA 2Z61A 4E3RA 3LWSA 1BW0A 3GWPA 1SZKA 3USFA 4BQ0A 2JJGA 4AH3A 1AAMA 5EQCA 5D95A 5M49A 1M7YA 1AHGA 2Z1YA 3CQ5A 4E1OA 4ATPA 4H63Q 4EB5A 1U08A 1ASEA 2YOBA 3ZRRA 2G7JA 1V72A 3GSBA 4XAUA 3FVSA 4F4EA 1ASMA 4WYGA 2Z1ZA 4GSAA 1BS0A 1IX7A 4Y0HA 1C4KA 2AY6A 3DC1A 2ZP7A 4ZWMA 3FVXA 3HLMA 3RBLA 2NMPA 2FQ6A 2JJHA 1YOOA 5IWQA 4IYOA 1AIAA 1LC5A 2W8TA 3H9XA 1BJ4A 3LVJA 3WY7A 1I43A 5HXXA 1SPAA 4RJ0A 1IX8A 2BI9A 1JG8A 4UHNA 4B9BA 3B8XA 2AEVA 3GR9A 3HT4A 2BWOA 1CS1A 1TOJA 3W1JA 4A0RA 3FKDA 4JE5A 2Z67A 1KKPA 1B8GA 4OT8A 1KMKA 4R5FA 4B98A 1J04A 3FRKA 4ZDOA 5F9SA 2VI9A 1PFFA 2KFPA 1RV4A 1UKJA 4TN4A 4GEBA 2HUFA 1M0OA 1Z3ZA 4ZM3A 2VMOA 3GZDC 1AMSA 4HVKA 1MDOA 4RAEA 1QISA 1OXPA 4JEYA 4RITA 2Z9WA 4WYFA 3AENA 1IUGA 2R2NA 4MGRA 3PDBB 2ZUKA 3ZRPA 1M0NA 4MQPA 5E5IA 4A72A 4AZKA 3GETA 1H1CA 3P6KA 2QLRA 2VMRA 3AEJC 1AHYA 3ACZA 1D7SA 3A9ZA 1AMAA 1PG8A 3MC6A 2EYQA 1OATA 2DOUA 2VGWA 1N8PA 3LV2A 3NNKA 5HHYA 4F5JA 5FT6A 1QJ5A 2PO3A 3NYSA 2VLHA 1W7NA 3WCOA 2W8WA 3N0LA 5M46A 2VGUA 3QN6A 3NX3A 4OYTA 3KGXA 1N2TA 4CXRA 3NU8A 5BJ3A 4IXZA 4IYOB 1GC4A 2W7IA 1VJOA 2JJEA 4W91A 4HF8A 1DJEA 1AAWA 4MKJA 2Z9XA 1M0QA 3PA9A 1AHEA 7AATA 4A6UA 2CJHA 1ASNA 4A0HA 4PFNA 3WKSA 3VOMA 3GZDA 1B4XA 3CAIA 3QHXA 4KAMA 3AEOA 1GEXA 2DR1A 4BMKA 1TATA 1ZC9A 3BS8A 3DXVA 1B9HA 2PB2A 3QM2A 3CBFA 3WLXA 4QGRA 5M4BA 1AY4A 3AENB 4WYEA 2VMXA 3AEJA 2C44A 2HP1A 5DB5A 4CBRA 2HP2A 3JU7A 2ZY2A 2Z20A 2WK9A 1YAAA 2QB3A 1TASA 1B9IA 4XJLA 4DBCA 1YIYA 5EAVA 2YKUA 1AX4A 3MAUA 1AY8A 3G7QA 4LW4A 1TOGA 2XH1A 3T32A 1TOIA 3RUYA 4IW7A 4LNMA 3B1EA 3FCRA 2HOXA 3LVMA 1M6SA 5DX5A 1Y4IA 9AATA 1GEWA 5HDMA 3BCBA 3GJUA 4AO9A 2ORDA 4ZAHA 5EUNA 4ZDLA 2W7MA 2CJGA 1LW5A 2VI8A 3LVKA 3PAAA 2ZYJA 4LC3A 4XEWA 2OKJA 4GE7A 1ELQA 3NUIA 3BCXA 1QJ3A 2EPJA 3Q8NA 3TATA 5LH9A 3ISLA 4MQRA 1MAQA 3N5MA 3PD6A 1KMJA 2CTZA 1DJUA 5C6UA 3LVLB 3EZSA 4R5ZA 3TFUA 3FTBA 4A00A 2CANA 1ZOBA 1GC3A 2Q7WA 2VMVA 2VMQA 1IX6A 2GSAA 1EQBA 3D6KA 3EI8A 1CQ6A 4A6RA 1ASBA 2D65A 1QZ9A 3MEBA 3JZLA 4OBVA 1O61A 3BB8A 4OCAA 1D7UA 2D63A 4PIWA 1LS3A 5D5SA 1C7OA 2BHXA 2EZ1A 3EI9A 2W7DA 4DGTA 1RVUA 2VLFA 3NUBA 4P3MA 3VK2A 1H0CA 1CL2A 2AY4A 3RI6A 1TOKA 1CQ8A 5EIGA 1ARHA 1EJIA 1WYUA 3MC6C 2VMPA 1VEFA 1M4NA 2X5DA 3B1DA 3E2ZA 3I16A 4WB0A 4E3QA 4F5IA 5K8BA 1OXOA 2BKWA 1IVRA 2CJDA 2OGAA 2VMNA 3VP6A 3ZRQA 5EUEA 3A9YA 3AEPA 5E3KA 1ASCA 4EFFA 4ITGA 3CQ4A 2D66A 3DYDA 1QIRA 3JWAA 4GDYA 2CH1A 2O7CA 4WLJA 1UU2A 4XK1A 4W8IA 1TOEA 3VAXA 2BIEA 2QA3A 3DU4A 4TMRA 3W1HA 3NYUA 1AIBA 1GC2A 1O4SA 2BYJA 3MAFA 1V2EA 3OP7A 4I8AA 4OC9A 4DQ6A 4RKCA 5JAYA 1BQDA 3E2YA 2DKJA 3K40A 3EI6A 2D5YA 3PD6B 3E2FA 4FL0A 3II0A 1G7XA 1WYTA 4UHOA 1V2DA 1MLZA 4RKDA 2WB6A 3F0HA 2EZ2A 1C9CA 4K2BA 3EZ1A 3AV7A 4JF0A 4BA4A 2CY8A 3RBFA 1IBJA 2TPLA 4F5KA 2HORA 4MKKA 4J5UA 2HZPA 4OBUA 1SZUA 4Y0IA 5G09A 4KYOA 4Q76A 1AHXA 1IAXA 3B1CA 3FDDA 2YCNA 2VMYA 3IHJA 5G2QA 2AY7A 3TFTA 3LG0A 3GZCA 4GE9A 1WYUB 3BCAA 4U1TA 1KAFA 3E2ZB 2O1BA 1FC4A 4WB0B 4Y0DA 4AO4A 4AZJA 3N7NA 2VGSA 2YCTA 2YRRA 2GB3A 2VIAA 4ISYA 2DKBA 4U2HA 3JWBA 1GDEA 2E54A 3NYTA 1YIZA 1DGDA 2V1PA 3EI5A 5BJ4A 2QBTA 3WZFA 2QB2A 2HOYA 1S0AA 3DR4A 3K28A 4MY5A 4ZWVA 4RIZA 3DODA 2JJFA 4IX8A 4ZSWA 2YRIA 5I92A 2W7JA 3EIBA 3HVYA 3PJ0A 3AOWA 1ELUA 1W23A 1AKBA 4ZLVA 1GBNA 3EUCA 2JISA 3MAFB 2YHKA 4ITXA 3VK4A 2JGTA 4M2MA 1O62A 2VGTA 3NRAA 2DGLA 3FZ8A 3DRDA 4Q75A 1JS3A 3FZ7A 1BJOA 2JG2A 2R5EA 2VMTA 1QITA 1YNUA 1X28A 1VP4A 2WKAA 1WYTB 2C7TA 3P1TA 4OMAA 4AOAA 2FN6A 2VMWA 3AATA 4ZASA 3TCMA 1E5FA 3G8MA 4LNLA
chains in the Genus database with same CATH topology
3QPGA 1TARA 3FFRA 4XJPA 4FFCA 1N31A 1ZODA 4IXOA 4WYAA 1I41A 3HBXA 3R9AA 3RCHA 4E77A 4F5LA 4ZM4A 2BYLA 1ORDA 1T3IA 3HMUA 3JTXA 1MLYA 3ZZJA 1GCKA 1M32A 3L8AA 3QGUA 1S07A 2W7FA 2CB1A 2VMUA 4P7YA 5G4IA 3WKRA 3H7FA 3WCNA 3DR7A 5FT5A 4BA5A 1D7RA 1X2AA 1OHWA 1AJRA 4ATQA 1GEYA 3VK3A 2WK7A 3AELA 4ADBA 4WLHA 1KL1A 4IXSA 1DGEA 4A6TA 1BT4A 2AY1A 4CVQA 3I5TA 3WGCA 2W7LA 1AICA 2W8UA 2D61A 1G4VA 4JEXA 5G0AA 1ASDA 2X8UA 1MDZA 3KKIA 4W5KA 4H51A 1B5PA 1I29A 3A9XA 4PFFA 1DTYA 1D2FA 3BV0A 1KL2A 2BI2A 3CQ6A 3N4RA 4TV7A 2ZY4A 2DGMA 5F8VA 1AHFA 1UU0A 1Z7DA 2VMSA 3F6TA 4GRXA 1ASGA 3WX9A 2Z9VA 3F9TA 2FNUA 5DJ9A 3ELEA 2FYFA 3E9KA 4N0BA 5LHAA 3W1IA 2AY5A 1BJOB 1WSTA 1AY5A 5EFSA 1P3WA 3QI6A 5G4JA 1TPLA 1X29A 1ASFA 2O0RA 4WXGA 3TQXA 1GD9A 1LC8A 2RFVA 2EH6A 3E6GA 3FD0A 3RCHB 4A0GA 1BJWA 4K05A 1PMMA 1W7MA 3EIAA 1WYVA 4WP0A 4W1VA 4NOGA 2ZY3A 2OKKA 5FT8A 4BHDA 2DGKA 2HOZA 2GQNA 1CL1A 2C81A 2AY3A 4LW2A 3B46A 3MKJA 4UOYA 3ASAA 5E4ZA 1AMRA 2EO5A 2HUUA 2OATA 4ZSYA 2F8JA 4EMYA 1PMOA 1B5OA 3GBXA 2XBNA 1DJ9A 3A2BA 3ELPA 4EU1A 3WGBA 4RM1A 1C7GA 2BI5A 3KGWA 1XEYA 2VGVA 4WYCA 4XQ2A 4Q31A 4ADDA 2BWPA 2OQXA 3QBOA 1I48A 4CBSA 4F5FA 2W8VA 1BKGA 1GC0A 1WKHA 3ZZKA 1BQAA 2E7IA 4WD2A 3M5UA 3PGYA 4M2KA 4MSOA 2CH2A 1AMQA 3IF2A 2PB0A 2ZSLA 2E7JA 3BN1A 2ZSMA 2WK8A 5TF5A 3JW9A 2CINA 2R5CA 2YCPA 3BWNA 1S09A 3NDNA 3BC8A 4LNJA 5AX8A 2C0RA 5EIGB 3MBBA 1S08A 4M2JA 1MDXA 1SFFA 2AEUA 3LY1A 4K2IA 3E77A 1ARGA 5EUDA 2VIBA 3NTJA 2CSTA 3UAKA 3FDBA 1W7LA 1OHVA 4GE4A 3MADA 1WYVB 3AEMC 2VGZA 3HDOA 4MQQA 5FT4A 2A1VA 2AY8A 2QSRA 1CJ0A 3L44A 4ADCA 3PPLA 4JE5D 1W3UA 4O6ZA 1IJIA 3HL2A 5G2PA 1QGNA 2W8JA 1XI9A 5DJ1A 1YJZA 1RV3A 3BWOA 3NU7A 3UE8A 4UHMA 3FQ8A 4XJOA 1AJSA 2Z9UA 2W7GA 4JF1A 4F5GA 1V2FA 4KXKA 3HQTA 1RVYA 2AY2A 2D7ZA 4ZDPA 1ARSA 3FQAA 1LC7A 2HUIA 3FSLA 4J8LA 1AKCA 2FM1A 1FG7A 4XJMA 2BIAA 3RQ1A 3ASBA 3PIUA 1M0PA 1DFOA 1G7WA 1X0MA 2D64A 1CQ7A 4F5HA 3UWCA 4WXBA 4N0WA 4A0FA 3G0TA 1UU1A 2YKVA 4Q6RA 4W1XA 2GMSA 3I4JA 1ASLA 4RJYA 1J32A 4JEZA 1CZEA 1YJYA 2X5FA 2W7KA 1AKAA 1SVVA 1SF2A 4WYDA 2V0YA 2FKIA 2ZY5A 2R5CB 2FNIA 1SZSA 3N4XA 3ATHA 1KKJA 1LK9A 2VMZA 3AOVA 3AEMA 4WXFA 2X3LA 3FQ7A 2GMUA 2AY9A 4JEVA 1WKGA 2OGEA 4UQVA 2ZC0A 5J8QA 1JF9A 2W7HA 2VYCA 3COGA 2YKXA 3FVUA 1S06A 2G6WA 2BI1A 4RLGA 3KE3A 4R8DA 4OTLA 2CFBA 1G4XA 4CXQA 1MAPA 4IY7A 4W1WA 1YJSA 2EGYA 3FZ6A 3ECDA 1ARIA 3OKSA 1EG5A 2YKYA 4EB7A 2AATA 1ARTA 3N75A 4R2NA 3PDXA 4PVFA 2E7UA 1C0NA 1AJSB 2W7EA 3H14A 4ADEA 1O69A 1CZCA 5EAAA 5M4DA 1JS6A 1ASAA 1LW4A 2QMAA 1LKCA 2BI3A 3DXWA 3EI7A 3FFHA 1D7VA 4WBTA 1DKAA 2BIGA 4K2MA 1ECXA 3N4SA 1FG3A 3R4TA 2D7YA 2ZJGA 2R0TA 1C7NA 3K7YA 1E5EA 1MGVA 5KTBA 1IAYA 1OHYA 1BJNA 3A8UX 4L0OA 4JEWA 2BWNA 3DZZA 8AATA 3BWNC 4F5MA 3PDBA 2Z61A 4E3RA 3LWSA 1BW0A 3GWPA 1SZKA 3USFA 4BQ0A 2JJGA 4AH3A 1AAMA 5EQCA 5D95A 5M49A 1M7YA 1AHGA 2Z1YA 3CQ5A 4E1OA 4ATPA 4H63Q 4EB5A 1U08A 1ASEA 2YOBA 3ZRRA 2G7JA 1V72A 3GSBA 4XAUA 3FVSA 4F4EA 1ASMA 4WYGA 2Z1ZA 4GSAA 1BS0A 1IX7A 4Y0HA 1C4KA 2AY6A 3DC1A 2ZP7A 4ZWMA 3FVXA 3HLMA 3RBLA 2NMPA 2FQ6A 2JJHA 1YOOA 5IWQA 4IYOA 1AIAA 1LC5A 2W8TA 3H9XA 1BJ4A 3LVJA 3WY7A 1I43A 5HXXA 1SPAA 4RJ0A 1IX8A 2BI9A 1JG8A 4UHNA 4B9BA 3B8XA 2AEVA 3GR9A 3HT4A 2BWOA 1CS1A 1TOJA 3W1JA 4A0RA 3FKDA 4JE5A 2Z67A 1KKPA 1B8GA 4OT8A 1KMKA 4R5FA 4B98A 1J04A 3FRKA 4ZDOA 5F9SA 2VI9A 1PFFA 2KFPA 1RV4A 1UKJA 4TN4A 4GEBA 2HUFA 1M0OA 1Z3ZA 4ZM3A 2VMOA 3GZDC 1AMSA 4HVKA 1MDOA 4RAEA 1QISA 1OXPA 4JEYA 4RITA 2Z9WA 4WYFA 3AENA 1IUGA 2R2NA 4MGRA 3PDBB 2ZUKA 3ZRPA 1M0NA 4MQPA 5E5IA 4A72A 4AZKA 3GETA 1H1CA 3P6KA 2QLRA 2VMRA 3AEJC 1AHYA 3ACZA 1D7SA 3A9ZA 1AMAA 1PG8A 3MC6A 2EYQA 1OATA 2DOUA 2VGWA 1N8PA 3LV2A 3NNKA 5HHYA 4F5JA 5FT6A 1QJ5A 2PO3A 3NYSA 2VLHA 1W7NA 3WCOA 2W8WA 3N0LA 5M46A 2VGUA 3QN6A 3NX3A 4OYTA 3KGXA 1N2TA 4CXRA 3NU8A 5BJ3A 4IXZA 4IYOB 1GC4A 2W7IA 1VJOA 2JJEA 4W91A 4HF8A 1DJEA 1AAWA 4MKJA 2Z9XA 1M0QA 3PA9A 1AHEA 7AATA 4A6UA 2CJHA 1ASNA 4A0HA 4PFNA 3WKSA 3VOMA 3GZDA 1B4XA 3CAIA 3QHXA 4KAMA 3AEOA 1GEXA 2DR1A 4BMKA 1TATA 1ZC9A 3BS8A 3DXVA 1B9HA 2PB2A 3QM2A 3CBFA 3WLXA 4QGRA 5M4BA 1AY4A 3AENB 4WYEA 2VMXA 3AEJA 2C44A 2HP1A 5DB5A 4CBRA 2HP2A 3JU7A 2ZY2A 2Z20A 2WK9A 1YAAA 2QB3A 1TASA 1B9IA 4XJLA 4DBCA 1YIYA 5EAVA 2YKUA 1AX4A 3MAUA 1AY8A 3G7QA 4LW4A 1TOGA 2XH1A 3T32A 1TOIA 3RUYA 4IW7A 4LNMA 3B1EA 3FCRA 2HOXA 3LVMA 1M6SA 5DX5A 1Y4IA 9AATA 1GEWA 5HDMA 3BCBA 3GJUA 4AO9A 2ORDA 4ZAHA 5EUNA 4ZDLA 2W7MA 2CJGA 1LW5A 2VI8A 3LVKA 3PAAA 2ZYJA 4LC3A 4XEWA 2OKJA 4GE7A 1ELQA 3NUIA 3BCXA 1QJ3A 2EPJA 3Q8NA 3TATA 5LH9A 3ISLA 4MQRA 1MAQA 3N5MA 3PD6A 1KMJA 2CTZA 1DJUA 5C6UA 3LVLB 3EZSA 4R5ZA 3TFUA 3FTBA 4A00A 2CANA 1ZOBA 1GC3A 2Q7WA 2VMVA 2VMQA 1IX6A 2GSAA 1EQBA 3D6KA 3EI8A 1CQ6A 4A6RA 1ASBA 2D65A 1QZ9A 3MEBA 3JZLA 4OBVA 1O61A 3BB8A 4OCAA 1D7UA 2D63A 4PIWA 1LS3A 5D5SA 1C7OA 2BHXA 2EZ1A 3EI9A 2W7DA 4DGTA 1RVUA 2VLFA 3NUBA 4P3MA 3VK2A 1H0CA 1CL2A 2AY4A 3RI6A 1TOKA 1CQ8A 5EIGA 1ARHA 1EJIA 1WYUA 3MC6C 2VMPA 1VEFA 1M4NA 2X5DA 3B1DA 3E2ZA 3I16A 4WB0A 4E3QA 4F5IA 5K8BA 1OXOA 2BKWA 1IVRA 2CJDA 2OGAA 2VMNA 3VP6A 3ZRQA 5EUEA 3A9YA 3AEPA 5E3KA 1ASCA 4EFFA 4ITGA 3CQ4A 2D66A 3DYDA 1QIRA 3JWAA 4GDYA 2CH1A 2O7CA 4WLJA 1UU2A 4XK1A 4W8IA 1TOEA 3VAXA 2BIEA 2QA3A 3DU4A 4TMRA 3W1HA 3NYUA 1AIBA 1GC2A 1O4SA 2BYJA 3MAFA 1V2EA 3OP7A 4I8AA 4OC9A 4DQ6A 4RKCA 5JAYA 1BQDA 3E2YA 2DKJA 3K40A 3EI6A 2D5YA 3PD6B 3E2FA 4FL0A 3II0A 1G7XA 1WYTA 4UHOA 1V2DA 1MLZA 4RKDA 2WB6A 3F0HA 2EZ2A 1C9CA 4K2BA 3EZ1A 3AV7A 4JF0A 4BA4A 2CY8A 3RBFA 1IBJA 2TPLA 4F5KA 2HORA 4MKKA 4J5UA 2HZPA 4OBUA 1SZUA 4Y0IA 5G09A 4KYOA 4Q76A 1AHXA 1IAXA 3B1CA 3FDDA 2YCNA 2VMYA 3IHJA 5G2QA 2AY7A 3TFTA 3LG0A 3GZCA 4GE9A 1WYUB 3BCAA 4U1TA 3E2ZB 2O1BA 1FC4A 4WB0B 4Y0DA 4AO4A 4AZJA 3N7NA 2VGSA 2YCTA 2YRRA 2GB3A 2VIAA 4ISYA 2DKBA 4U2HA 3JWBA 1GDEA 2E54A 3NYTA 1YIZA 1DGDA 2V1PA 3EI5A 5BJ4A 2QBTA 3WZFA 2QB2A 2HOYA 1S0AA 3DR4A 3K28A 4MY5A 4ZWVA 4RIZA 3DODA 2JJFA 4IX8A 4ZSWA 2YRIA 5I92A 2W7JA 3EIBA 3HVYA 3PJ0A 3AOWA 1ELUA 1W23A 1AKBA 4ZLVA 1GBNA 3EUCA 2JISA 3MAFB 2YHKA 4ITXA 3VK4A 2JGTA 4M2MA 1O62A 2VGTA 3NRAA 2DGLA 3FZ8A 3DRDA 4Q75A 1JS3A 3FZ7A 1BJOA 2JG2A 2R5EA 2VMTA 1QITA 1YNUA 1X28A 1VP4A 2WKAA 1WYTB 2C7TA 3P1TA 4OMAA 4AOAA 2FN6A 2VMWA 3AATA 4ZASA 3TCMA 1E5FA 3G8MA 4LNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPG A;  1TAR A;  3FFR A;  4XJP A;  4FFC A;  1N31 A;  1ZOD A;  4IXO A;  4WYA A;  1I41 A;  3HBX A;  3R9A A;  3RCH A;  4E77 A;  4F5L A;  4ZM4 A;  2BYL A;  1ORD A;  1T3I A;  3HMU A;  3JTX A;  1MLY A;  3ZZJ A;  1GCK A;  1M32 A;  3L8A A;  3QGU A;  1S07 A;  2W7F A;  2CB1 A;  2VMU A;  4P7Y A;  5G4I A;  3WKR A;  3H7F A;  3WCN A;  3DR7 A;  5FT5 A;  4BA5 A;  1D7R A;  1X2A A;  1OHW A;  1AJR A;  4ATQ A;  1GEY A;  3VK3 A;  2WK7 A;  3AEL A;  4ADB A;  4WLH A;  1KL1 A;  4IXS A;  1DGE A;  4A6T A;  1BT4 A;  2AY1 A;  4CVQ A;  3I5T A;  3WGC A;  2W7L A;  1AIC A;  2W8U A;  2D61 A;  1G4V A;  4JEX A;  5G0A A;  1ASD A;  2X8U A;  1MDZ A;  3KKI A;  4W5K A;  4H51 A;  1B5P A;  1I29 A;  3A9X A;  4PFF A;  1DTY A;  1D2F A;  3BV0 A;  1KL2 A;  2BI2 A;  3CQ6 A;  4TV7 A;  2ZY4 A;  2DGM A;  5F8V A;  1AHF A;  1UU0 A;  1Z7D A;  2VMS A;  3F6T A;  4GRX A;  1ASG A;  3WX9 A;  2Z9V A;  3F9T A;  2FNU A;  5DJ9 A;  3ELE A;  2FYF A;  3E9K A;  4N0B A;  5LHA A;  3W1I A;  2AY5 A;  1BJO B;  1WST A;  1AY5 A;  5EFS A;  1P3W A;  3QI6 A;  5G4J A;  1TPL A;  1X29 A;  1ASF A;  2O0R A;  4WXG A;  3TQX A;  1GD9 A;  1LC8 A;  2RFV A;  2EH6 A;  3E6G A;  3FD0 A;  3RCH B;  4A0G A;  1BJW A;  1PMM A;  1W7M A;  3EIA A;  1WYV A;  4WP0 A;  4W1V A;  4NOG A;  2ZY3 A;  2OKK A;  5FT8 A;  4BHD A;  2DGK A;  2HOZ A;  2GQN A;  1CL1 A;  2C81 A;  2AY3 A;  4LW2 A;  3B46 A;  3MKJ A;  4UOY A;  3ASA A;  5E4Z A;  1AMR A;  2EO5 A;  2HUU A;  2OAT A;  4ZSY A;  2F8J A;  4EMY A;  1PMO A;  1B5O A;  3GBX A;  2XBN A;  1DJ9 A;  3A2B A;  3ELP A;  4EU1 A;  3WGB A;  4RM1 A;  1C7G A;  2BI5 A;  3KGW A;  1XEY A;  2VGV A;  4WYC A;  4XQ2 A;  4Q31 A;  4ADD A;  2BWP A;  2OQX A;  3QBO A;  1I48 A;  4CBS A;  4F5F A;  2W8V A;  1BKG A;  1GC0 A;  1WKH A;  3ZZK A;  1BQA A;  2E7I A;  4WD2 A;  3M5U A;  3PGY A;  4M2K A;  4MSO A;  2CH2 A;  1AMQ A;  3IF2 A;  2PB0 A;  2ZSL A;  2E7J A;  3BN1 A;  2ZSM A;  2WK8 A;  5TF5 A;  3JW9 A;  2CIN A;  2R5C A;  2YCP A;  3BWN A;  1S09 A;  3NDN A;  3BC8 A;  4LNJ A;  5AX8 A;  2C0R A;  5EIG B;  3MBB A;  1S08 A;  4M2J A;  1MDX A;  1SFF A;  2AEU A;  3LY1 A;  4K2I A;  3E77 A;  1ARG A;  5EUD A;  2VIB A;  3NTJ A;  2CST A;  3UAK A;  3FDB A;  1W7L A;  1OHV A;  4GE4 A;  3MAD A;  1WYV B;  3AEM C;  2VGZ A;  3HDO A;  4MQQ A;  5FT4 A;  2AY8 A;  1CJ0 A;  3L44 A;  4ADC A;  3PPL A;  4JE5 D;  1W3U A;  4O6Z A;  1IJI A;  3HL2 A;  5G2P A;  1QGN A;  2W8J A;  1XI9 A;  5DJ1 A;  1YJZ A;  1RV3 A;  3BWO A;  3NU7 A;  3UE8 A;  4UHM A;  3FQ8 A;  4XJO A;  1AJS A;  2Z9U A;  2W7G A;  4JF1 A;  4F5G A;  1V2F A;  4KXK A;  3HQT A;  1RVY A;  2AY2 A;  2D7Z A;  4ZDP A;  1ARS A;  3FQA A;  1LC7 A;  2HUI A;  3FSL A;  4J8L A;  1AKC A;  2FM1 A;  1FG7 A;  4XJM A;  2BIA A;  3RQ1 A;  3ASB A;  3PIU A;  1M0P A;  1DFO A;  1G7W A;  1X0M A;  2D64 A;  1CQ7 A;  4F5H A;  3UWC A;  4WXB A;  4N0W A;  4A0F A;  3G0T A;  1UU1 A;  2YKV A;  4Q6R A;  4W1X A;  2GMS A;  3I4J A;  1ASL A;  4RJY A;  1J32 A;  4JEZ A;  1CZE A;  1YJY A;  2X5F A;  2W7K A;  1AKA A;  1SVV A;  1SF2 A;  4WYD A;  2V0Y A;  2ZY5 A;  2R5C B;  2FNI A;  1SZS A;  3ATH A;  1KKJ A;  1LK9 A;  2VMZ A;  3AOV A;  3AEM A;  4WXF A;  2X3L A;  3FQ7 A;  2GMU A;  2AY9 A;  4JEV A;  1WKG A;  2OGE A;  4UQV A;  2ZC0 A;  5J8Q A;  1JF9 A;  2W7H A;  2VYC A;  3COG A;  2YKX A;  3FVU A;  1S06 A;  2G6W A;  2BI1 A;  4RLG A;  3KE3 A;  4R8D A;  4OTL A;  2CFB A;  1G4X A;  4CXQ A;  1MAP A;  4IY7 A;  4W1W A;  1YJS A;  2EGY A;  3FZ6 A;  3ECD A;  1ARI A;  3OKS A;  1EG5 A;  2YKY A;  4EB7 A;  2AAT A;  1ART A;  3N75 A;  4R2N A;  3PDX A;  4PVF A;  2E7U A;  1C0N A;  1AJS B;  2W7E A;  3H14 A;  4ADE A;  1O69 A;  1CZC A;  5EAA A;  5M4D A;  1JS6 A;  1ASA A;  1LW4 A;  2QMA A;  1LKC A;  2BI3 A;  3DXW A;  3EI7 A;  3FFH A;  1D7V A;  4WBT A;  1DKA A;  2BIG A;  4K2M A;  1ECX A;  1FG3 A;  3R4T A;  2D7Y A;  2ZJG A;  2R0T A;  1C7N A;  3K7Y A;  1E5E A;  1MGV A;  1IAY A;  1OHY A;  1BJN A;  3A8U X;  4L0O A;  4JEW A;  2BWN A;  3DZZ A;  8AAT A;  3BWN C;  4F5M A;  3PDB A;  2Z61 A;  4E3R A;  3LWS A;  1BW0 A;  3GWP A;  1SZK A;  3USF A;  4BQ0 A;  2JJG A;  4AH3 A;  1AAM A;  5EQC A;  5D95 A;  5M49 A;  1M7Y A;  1AHG A;  2Z1Y A;  3CQ5 A;  4E1O A;  4ATP A;  4EB5 A;  1U08 A;  1ASE A;  2YOB A;  3ZRR A;  1V72 A;  3GSB A;  4XAU A;  3FVS A;  4F4E A;  1ASM A;  4WYG A;  2Z1Z A;  4GSA A;  1BS0 A;  1IX7 A;  4Y0H A;  1C4K A;  2AY6 A;  3DC1 A;  2ZP7 A;  4ZWM A;  3FVX A;  3HLM A;  3RBL A;  2NMP A;  2FQ6 A;  2JJH A;  1YOO A;  5IWQ A;  4IYO A;  1AIA A;  1LC5 A;  2W8T A;  1BJ4 A;  3LVJ A;  3WY7 A;  1I43 A;  5HXX A;  1SPA A;  4RJ0 A;  1IX8 A;  2BI9 A;  1JG8 A;  4UHN A;  4B9B A;  3B8X A;  2AEV A;  3GR9 A;  3HT4 A;  2BWO A;  1CS1 A;  1TOJ A;  3W1J A;  4A0R A;  3FKD A;  4JE5 A;  2Z67 A;  1KKP A;  1B8G A;  4OT8 A;  1KMK A;  4R5F A;  4B98 A;  1J04 A;  3FRK A;  4ZDO A;  5F9S A;  2VI9 A;  1PFF A;  1RV4 A;  1UKJ A;  4TN4 A;  4GEB A;  2HUF A;  1M0O A;  1Z3Z A;  4ZM3 A;  2VMO A;  3GZD C;  1AMS A;  4HVK A;  1MDO A;  4RAE A;  1QIS A;  1OXP A;  4JEY A;  4RIT A;  2Z9W A;  4WYF A;  3AEN A;  1IUG A;  2R2N A;  4MGR A;  3PDB B;  2ZUK A;  3ZRP A;  1M0N A;  4MQP A;  5E5I A;  4A72 A;  4AZK A;  3GET A;  1H1C A;  3P6K A;  2QLR A;  2VMR A;  3AEJ C;  1AHY A;  3ACZ A;  1D7S A;  3A9Z A;  1AMA A;  1PG8 A;  3MC6 A;  1OAT A;  2DOU A;  2VGW A;  1N8P A;  3LV2 A;  3NNK A;  5HHY A;  4F5J A;  5FT6 A;  1QJ5 A;  2PO3 A;  3NYS A;  2VLH A;  1W7N A;  3WCO A;  2W8W A;  3N0L A;  5M46 A;  2VGU A;  3QN6 A;  3NX3 A;  4OYT A;  3KGX A;  1N2T A;  4CXR A;  3NU8 A;  5BJ3 A;  4IXZ A;  4IYO B;  1GC4 A;  2W7I A;  1VJO A;  2JJE A;  4W91 A;  4HF8 A;  1DJE A;  1AAW A;  4MKJ A;  2Z9X A;  1M0Q A;  3PA9 A;  1AHE A;  7AAT A;  4A6U A;  2CJH A;  1ASN A;  4A0H A;  4PFN A;  3WKS A;  3VOM A;  3GZD A;  1B4X A;  3CAI A;  3QHX A;  4KAM A;  3AEO A;  1GEX A;  2DR1 A;  4BMK A;  1TAT A;  1ZC9 A;  3BS8 A;  3DXV A;  1B9H A;  2PB2 A;  3QM2 A;  3CBF A;  3WLX A;  4QGR A;  5M4B A;  1AY4 A;  3AEN B;  4WYE A;  2VMX A;  3AEJ A;  2C44 A;  2HP1 A;  5DB5 A;  4CBR A;  2HP2 A;  3JU7 A;  2ZY2 A;  2Z20 A;  2WK9 A;  1YAA A;  2QB3 A;  1TAS A;  1B9I A;  4XJL A;  4DBC A;  1YIY A;  5EAV A;  2YKU A;  1AX4 A;  3MAU A;  1AY8 A;  3G7Q A;  4LW4 A;  1TOG A;  2XH1 A;  3T32 A;  1TOI A;  3RUY A;  4IW7 A;  4LNM A;  3B1E A;  3FCR A;  2HOX A;  3LVM A;  1M6S A;  5DX5 A;  1Y4I A;  9AAT A;  1GEW A;  5HDM A;  3BCB A;  3GJU A;  4AO9 A;  2ORD A;  4ZAH A;  5EUN A;  4ZDL A;  2W7M A;  2CJG A;  1LW5 A;  2VI8 A;  3LVK A;  3PAA A;  2ZYJ A;  4LC3 A;  4XEW A;  2OKJ A;  4GE7 A;  1ELQ A;  3NUI A;  3BCX A;  1QJ3 A;  2EPJ A;  3Q8N A;  3TAT A;  5LH9 A;  3ISL A;  4MQR A;  1MAQ A;  3N5M A;  3PD6 A;  1KMJ A;  2CTZ A;  1DJU A;  5C6U A;  3LVL B;  3EZS A;  4R5Z A;  3TFU A;  3FTB A;  4A00 A;  2CAN A;  1ZOB A;  1GC3 A;  2Q7W A;  2VMV A;  2VMQ A;  1IX6 A;  2GSA A;  1EQB A;  3D6K A;  3EI8 A;  1CQ6 A;  4A6R A;  1ASB A;  2D65 A;  1QZ9 A;  3MEB A;  3JZL A;  4OBV A;  1O61 A;  3BB8 A;  4OCA A;  1D7U A;  2D63 A;  4PIW A;  1LS3 A;  5D5S A;  1C7O A;  2BHX A;  2EZ1 A;  3EI9 A;  2W7D A;  4DGT A;  1RVU A;  2VLF A;  3NUB A;  4P3M A;  3VK2 A;  1H0C A;  1CL2 A;  2AY4 A;  3RI6 A;  1TOK A;  1CQ8 A;  5EIG A;  1ARH A;  1EJI A;  1WYU A;  3MC6 C;  2VMP A;  1VEF A;  1M4N A;  2X5D A;  3B1D A;  3E2Z A;  3I16 A;  4WB0 A;  4E3Q A;  4F5I A;  5K8B A;  1OXO A;  2BKW A;  1IVR A;  2CJD A;  2OGA A;  2VMN A;  3VP6 A;  3ZRQ A;  5EUE A;  3A9Y A;  3AEP A;  5E3K A;  1ASC A;  4EFF A;  4ITG A;  3CQ4 A;  2D66 A;  3DYD A;  1QIR A;  3JWA A;  4GDY A;  2CH1 A;  2O7C A;  4WLJ A;  1UU2 A;  4XK1 A;  4W8I A;  1TOE A;  3VAX A;  2BIE A;  2QA3 A;  3DU4 A;  4TMR A;  3W1H A;  3NYU A;  1AIB A;  1GC2 A;  1O4S A;  2BYJ A;  3MAF A;  1V2E A;  3OP7 A;  4I8A A;  4OC9 A;  4DQ6 A;  4RKC A;  5JAY A;  1BQD A;  3E2Y A;  2DKJ A;  3K40 A;  3EI6 A;  2D5Y A;  3PD6 B;  3E2F A;  4FL0 A;  3II0 A;  1G7X A;  1WYT A;  4UHO A;  1V2D A;  1MLZ A;  4RKD A;  3F0H A;  2EZ2 A;  1C9C A;  4K2B A;  3EZ1 A;  3AV7 A;  4JF0 A;  4BA4 A;  2CY8 A;  3RBF A;  1IBJ A;  2TPL A;  4F5K A;  2HOR A;  4MKK A;  4J5U A;  2HZP A;  4OBU A;  1SZU A;  4Y0I A;  5G09 A;  4KYO A;  4Q76 A;  1AHX A;  1IAX A;  3B1C A;  3FDD A;  2YCN A;  2VMY A;  3IHJ A;  5G2Q A;  2AY7 A;  3TFT A;  3LG0 A;  3GZC A;  4GE9 A;  1WYU B;  3BCA A;  4U1T A;  3E2Z B;  2O1B A;  1FC4 A;  4WB0 B;  4Y0D A;  4AO4 A;  4AZJ A;  2VGS A;  2YCT A;  2YRR A;  2GB3 A;  2VIA A;  4ISY A;  2DKB A;  4U2H A;  3JWB A;  1GDE A;  2E54 A;  3NYT A;  1YIZ A;  1DGD A;  2V1P A;  3EI5 A;  5BJ4 A;  2QBT A;  3WZF A;  2QB2 A;  2HOY A;  1S0A A;  3DR4 A;  3K28 A;  4MY5 A;  4ZWV A;  4RIZ A;  3DOD A;  2JJF A;  4IX8 A;  4ZSW A;  2YRI A;  5I92 A;  2W7J A;  3EIB A;  3HVY A;  3PJ0 A;  3AOW A;  1ELU A;  1W23 A;  1AKB A;  4ZLV A;  1GBN A;  3EUC A;  2JIS A;  3MAF B;  2YHK A;  4ITX A;  3VK4 A;  2JGT A;  4M2M A;  1O62 A;  2VGT A;  3NRA A;  2DGL A;  3FZ8 A;  3DRD A;  4Q75 A;  1JS3 A;  3FZ7 A;  1BJO A;  2JG2 A;  2R5E A;  2VMT A;  1QIT A;  1YNU A;  1X28 A;  1VP4 A;  2WKA A;  1WYT B;  2C7T A;  3P1T A;  4OMA A;  4AOA A;  2FN6 A;  2VMW A;  3AAT A;  4ZAS A;  3TCM A;  1E5F A;  3G8M A;  4LNL A; 
#chains in the Genus database with same CATH topology
 3QPG A;  1TAR A;  3FFR A;  4XJP A;  4FFC A;  1N31 A;  1ZOD A;  4IXO A;  4WYA A;  1I41 A;  3HBX A;  3R9A A;  3RCH A;  4E77 A;  4F5L A;  4ZM4 A;  2BYL A;  1ORD A;  1T3I A;  3HMU A;  3JTX A;  1MLY A;  3ZZJ A;  1GCK A;  1M32 A;  3L8A A;  3QGU A;  1S07 A;  2W7F A;  2CB1 A;  2VMU A;  4P7Y A;  5G4I A;  3WKR A;  3H7F A;  3WCN A;  3DR7 A;  5FT5 A;  4BA5 A;  1D7R A;  1X2A A;  1OHW A;  1AJR A;  4ATQ A;  1GEY A;  3VK3 A;  2WK7 A;  3AEL A;  4ADB A;  4WLH A;  1KL1 A;  4IXS A;  1DGE A;  4A6T A;  1BT4 A;  2AY1 A;  4CVQ A;  3I5T A;  3WGC A;  2W7L A;  1AIC A;  2W8U A;  2D61 A;  1G4V A;  4JEX A;  5G0A A;  1ASD A;  2X8U A;  1MDZ A;  3KKI A;  4W5K A;  4H51 A;  1B5P A;  1I29 A;  3A9X A;  4PFF A;  1DTY A;  1D2F A;  3BV0 A;  1KL2 A;  2BI2 A;  3CQ6 A;  3N4R A;  4TV7 A;  2ZY4 A;  2DGM A;  5F8V A;  1AHF A;  1UU0 A;  1Z7D A;  2VMS A;  3F6T A;  4GRX A;  1ASG A;  3WX9 A;  2Z9V A;  3F9T A;  2FNU A;  5DJ9 A;  3ELE A;  2FYF A;  3E9K A;  4N0B A;  5LHA A;  3W1I A;  2AY5 A;  1BJO B;  1WST A;  1AY5 A;  5EFS A;  1P3W A;  3QI6 A;  5G4J A;  1TPL A;  1X29 A;  1ASF A;  2O0R A;  4WXG A;  3TQX A;  1GD9 A;  1LC8 A;  2RFV A;  2EH6 A;  3E6G A;  3FD0 A;  3RCH B;  4A0G A;  1BJW A;  4K05 A;  1PMM A;  1W7M A;  3EIA A;  1WYV A;  4WP0 A;  4W1V A;  4NOG A;  2ZY3 A;  2OKK A;  5FT8 A;  4BHD A;  2DGK A;  2HOZ A;  2GQN A;  1CL1 A;  2C81 A;  2AY3 A;  4LW2 A;  3B46 A;  3MKJ A;  4UOY A;  3ASA A;  5E4Z A;  1AMR A;  2EO5 A;  2HUU A;  2OAT A;  4ZSY A;  2F8J A;  4EMY A;  1PMO A;  1B5O A;  3GBX A;  2XBN A;  1DJ9 A;  3A2B A;  3ELP A;  4EU1 A;  3WGB A;  4RM1 A;  1C7G A;  2BI5 A;  3KGW A;  1XEY A;  2VGV A;  4WYC A;  4XQ2 A;  4Q31 A;  4ADD A;  2BWP A;  2OQX A;  3QBO A;  1I48 A;  4CBS A;  4F5F A;  2W8V A;  1BKG A;  1GC0 A;  1WKH A;  3ZZK A;  1BQA A;  2E7I A;  4WD2 A;  3M5U A;  3PGY A;  4M2K A;  4MSO A;  2CH2 A;  1AMQ A;  3IF2 A;  2PB0 A;  2ZSL A;  2E7J A;  3BN1 A;  2ZSM A;  2WK8 A;  5TF5 A;  3JW9 A;  2CIN A;  2R5C A;  2YCP A;  3BWN A;  1S09 A;  3NDN A;  3BC8 A;  4LNJ A;  5AX8 A;  2C0R A;  5EIG B;  3MBB A;  1S08 A;  4M2J A;  1MDX A;  1SFF A;  2AEU A;  3LY1 A;  4K2I A;  3E77 A;  1ARG A;  5EUD A;  2VIB A;  3NTJ A;  2CST A;  3UAK A;  3FDB A;  1W7L A;  1OHV A;  4GE4 A;  3MAD A;  1WYV B;  3AEM C;  2VGZ A;  3HDO A;  4MQQ A;  5FT4 A;  2A1V A;  2AY8 A;  2QSR A;  1CJ0 A;  3L44 A;  4ADC A;  3PPL A;  4JE5 D;  1W3U A;  4O6Z A;  1IJI A;  3HL2 A;  5G2P A;  1QGN A;  2W8J A;  1XI9 A;  5DJ1 A;  1YJZ A;  1RV3 A;  3BWO A;  3NU7 A;  3UE8 A;  4UHM A;  3FQ8 A;  4XJO A;  1AJS A;  2Z9U A;  2W7G A;  4JF1 A;  4F5G A;  1V2F A;  4KXK A;  3HQT A;  1RVY A;  2AY2 A;  2D7Z A;  4ZDP A;  1ARS A;  3FQA A;  1LC7 A;  2HUI A;  3FSL A;  4J8L A;  1AKC A;  2FM1 A;  1FG7 A;  4XJM A;  2BIA A;  3RQ1 A;  3ASB A;  3PIU A;  1M0P A;  1DFO A;  1G7W A;  1X0M A;  2D64 A;  1CQ7 A;  4F5H A;  3UWC A;  4WXB A;  4N0W A;  4A0F A;  3G0T A;  1UU1 A;  2YKV A;  4Q6R A;  4W1X A;  2GMS A;  3I4J A;  1ASL A;  4RJY A;  1J32 A;  4JEZ A;  1CZE A;  1YJY A;  2X5F A;  2W7K A;  1AKA A;  1SVV A;  1SF2 A;  4WYD A;  2V0Y A;  2FKI A;  2ZY5 A;  2R5C B;  2FNI A;  1SZS A;  3N4X A;  3ATH A;  1KKJ A;  1LK9 A;  2VMZ A;  3AOV A;  3AEM A;  4WXF A;  2X3L A;  3FQ7 A;  2GMU A;  2AY9 A;  4JEV A;  1WKG A;  2OGE A;  4UQV A;  2ZC0 A;  5J8Q A;  1JF9 A;  2W7H A;  2VYC A;  3COG A;  2YKX A;  3FVU A;  1S06 A;  2G6W A;  2BI1 A;  4RLG A;  3KE3 A;  4R8D A;  4OTL A;  2CFB A;  1G4X A;  4CXQ A;  1MAP A;  4IY7 A;  4W1W A;  1YJS A;  2EGY A;  3FZ6 A;  3ECD A;  1ARI A;  3OKS A;  1EG5 A;  2YKY A;  4EB7 A;  2AAT A;  1ART A;  3N75 A;  4R2N A;  3PDX A;  4PVF A;  2E7U A;  1C0N A;  1AJS B;  2W7E A;  3H14 A;  4ADE A;  1O69 A;  1CZC A;  5EAA A;  5M4D A;  1JS6 A;  1ASA A;  1LW4 A;  2QMA A;  1LKC A;  2BI3 A;  3DXW A;  3EI7 A;  3FFH A;  1D7V A;  4WBT A;  1DKA A;  2BIG A;  4K2M A;  1ECX A;  3N4S A;  1FG3 A;  3R4T A;  2D7Y A;  2ZJG A;  2R0T A;  1C7N A;  3K7Y A;  1E5E A;  1MGV A;  5KTB A;  1IAY A;  1OHY A;  1BJN A;  3A8U X;  4L0O A;  4JEW A;  2BWN A;  3DZZ A;  8AAT A;  3BWN C;  4F5M A;  3PDB A;  2Z61 A;  4E3R A;  3LWS A;  1BW0 A;  3GWP A;  1SZK A;  3USF A;  4BQ0 A;  2JJG A;  4AH3 A;  1AAM A;  5EQC A;  5D95 A;  5M49 A;  1M7Y A;  1AHG A;  2Z1Y A;  3CQ5 A;  4E1O A;  4ATP A;  4H63 Q;  4EB5 A;  1U08 A;  1ASE A;  2YOB A;  3ZRR A;  2G7J A;  1V72 A;  3GSB A;  4XAU A;  3FVS A;  4F4E A;  1ASM A;  4WYG A;  2Z1Z A;  4GSA A;  1BS0 A;  1IX7 A;  4Y0H A;  1C4K A;  2AY6 A;  3DC1 A;  2ZP7 A;  4ZWM A;  3FVX A;  3HLM A;  3RBL A;  2NMP A;  2FQ6 A;  2JJH A;  1YOO A;  5IWQ A;  4IYO A;  1AIA A;  1LC5 A;  2W8T A;  3H9X A;  1BJ4 A;  3LVJ A;  3WY7 A;  1I43 A;  5HXX A;  1SPA A;  4RJ0 A;  1IX8 A;  2BI9 A;  1JG8 A;  4UHN A;  4B9B A;  3B8X A;  2AEV A;  3GR9 A;  3HT4 A;  2BWO A;  1CS1 A;  1TOJ A;  3W1J A;  4A0R A;  3FKD A;  4JE5 A;  2Z67 A;  1KKP A;  1B8G A;  4OT8 A;  1KMK A;  4R5F A;  4B98 A;  1J04 A;  3FRK A;  4ZDO A;  5F9S A;  2VI9 A;  1PFF A;  2KFP A;  1RV4 A;  1UKJ A;  4TN4 A;  4GEB A;  2HUF A;  1M0O A;  1Z3Z A;  4ZM3 A;  2VMO A;  3GZD C;  1AMS A;  4HVK A;  1MDO A;  4RAE A;  1QIS A;  1OXP A;  4JEY A;  4RIT A;  2Z9W A;  4WYF A;  3AEN A;  1IUG A;  2R2N A;  4MGR A;  3PDB B;  2ZUK A;  3ZRP A;  1M0N A;  4MQP A;  5E5I A;  4A72 A;  4AZK A;  3GET A;  1H1C A;  3P6K A;  2QLR A;  2VMR A;  3AEJ C;  1AHY A;  3ACZ A;  1D7S A;  3A9Z A;  1AMA A;  1PG8 A;  3MC6 A;  2EYQ A;  1OAT A;  2DOU A;  2VGW A;  1N8P A;  3LV2 A;  3NNK A;  5HHY A;  4F5J A;  5FT6 A;  1QJ5 A;  2PO3 A;  3NYS A;  2VLH A;  1W7N A;  3WCO A;  2W8W A;  3N0L A;  5M46 A;  2VGU A;  3QN6 A;  3NX3 A;  4OYT A;  3KGX A;  1N2T A;  4CXR A;  3NU8 A;  5BJ3 A;  4IXZ A;  4IYO B;  1GC4 A;  2W7I A;  1VJO A;  2JJE A;  4W91 A;  4HF8 A;  1DJE A;  1AAW A;  4MKJ A;  2Z9X A;  1M0Q A;  3PA9 A;  1AHE A;  7AAT A;  4A6U A;  2CJH A;  1ASN A;  4A0H A;  4PFN A;  3WKS A;  3VOM A;  3GZD A;  1B4X A;  3CAI A;  3QHX A;  4KAM A;  3AEO A;  1GEX A;  2DR1 A;  4BMK A;  1TAT A;  1ZC9 A;  3BS8 A;  3DXV A;  1B9H A;  2PB2 A;  3QM2 A;  3CBF A;  3WLX A;  4QGR A;  5M4B A;  1AY4 A;  3AEN B;  4WYE A;  2VMX A;  3AEJ A;  2C44 A;  2HP1 A;  5DB5 A;  4CBR A;  2HP2 A;  3JU7 A;  2ZY2 A;  2Z20 A;  2WK9 A;  1YAA A;  2QB3 A;  1TAS A;  1B9I A;  4XJL A;  4DBC A;  1YIY A;  5EAV A;  2YKU A;  1AX4 A;  3MAU A;  1AY8 A;  3G7Q A;  4LW4 A;  1TOG A;  2XH1 A;  3T32 A;  1TOI A;  3RUY A;  4IW7 A;  4LNM A;  3B1E A;  3FCR A;  2HOX A;  3LVM A;  1M6S A;  5DX5 A;  1Y4I A;  9AAT A;  1GEW A;  5HDM A;  3BCB A;  3GJU A;  4AO9 A;  2ORD A;  4ZAH A;  5EUN A;  4ZDL A;  2W7M A;  2CJG A;  1LW5 A;  2VI8 A;  3LVK A;  3PAA A;  2ZYJ A;  4LC3 A;  4XEW A;  2OKJ A;  4GE7 A;  1ELQ A;  3NUI A;  3BCX A;  1QJ3 A;  2EPJ A;  3Q8N A;  3TAT A;  5LH9 A;  3ISL A;  4MQR A;  1MAQ A;  3N5M A;  3PD6 A;  1KMJ A;  2CTZ A;  1DJU A;  5C6U A;  3LVL B;  3EZS A;  4R5Z A;  3TFU A;  3FTB A;  4A00 A;  2CAN A;  1ZOB A;  1GC3 A;  2Q7W A;  2VMV A;  2VMQ A;  1IX6 A;  2GSA A;  1EQB A;  3D6K A;  3EI8 A;  1CQ6 A;  4A6R A;  1ASB A;  2D65 A;  1QZ9 A;  3MEB A;  3JZL A;  4OBV A;  1O61 A;  3BB8 A;  4OCA A;  1D7U A;  2D63 A;  4PIW A;  1LS3 A;  5D5S A;  1C7O A;  2BHX A;  2EZ1 A;  3EI9 A;  2W7D A;  4DGT A;  1RVU A;  2VLF A;  3NUB A;  4P3M A;  3VK2 A;  1H0C A;  1CL2 A;  2AY4 A;  3RI6 A;  1TOK A;  1CQ8 A;  5EIG A;  1ARH A;  1EJI A;  1WYU A;  3MC6 C;  2VMP A;  1VEF A;  1M4N A;  2X5D A;  3B1D A;  3E2Z A;  3I16 A;  4WB0 A;  4E3Q A;  4F5I A;  5K8B A;  1OXO A;  2BKW A;  1IVR A;  2CJD A;  2OGA A;  2VMN A;  3VP6 A;  3ZRQ A;  5EUE A;  3A9Y A;  3AEP A;  5E3K A;  1ASC A;  4EFF A;  4ITG A;  3CQ4 A;  2D66 A;  3DYD A;  1QIR A;  3JWA A;  4GDY A;  2CH1 A;  2O7C A;  4WLJ A;  1UU2 A;  4XK1 A;  4W8I A;  1TOE A;  3VAX A;  2BIE A;  2QA3 A;  3DU4 A;  4TMR A;  3W1H A;  3NYU A;  1AIB A;  1GC2 A;  1O4S A;  2BYJ A;  3MAF A;  1V2E A;  3OP7 A;  4I8A A;  4OC9 A;  4DQ6 A;  4RKC A;  5JAY A;  1BQD A;  3E2Y A;  2DKJ A;  3K40 A;  3EI6 A;  2D5Y A;  3PD6 B;  3E2F A;  4FL0 A;  3II0 A;  1G7X A;  1WYT A;  4UHO A;  1V2D A;  1MLZ A;  4RKD A;  2WB6 A;  3F0H A;  2EZ2 A;  1C9C A;  4K2B A;  3EZ1 A;  3AV7 A;  4JF0 A;  4BA4 A;  2CY8 A;  3RBF A;  1IBJ A;  2TPL A;  4F5K A;  2HOR A;  4MKK A;  4J5U A;  2HZP A;  4OBU A;  1SZU A;  4Y0I A;  5G09 A;  4KYO A;  4Q76 A;  1AHX A;  1IAX A;  3B1C A;  3FDD A;  2YCN A;  2VMY A;  3IHJ A;  5G2Q A;  2AY7 A;  3TFT A;  3LG0 A;  3GZC A;  4GE9 A;  1WYU B;  3BCA A;  4U1T A;  1KAF A;  3E2Z B;  2O1B A;  1FC4 A;  4WB0 B;  4Y0D A;  4AO4 A;  4AZJ A;  3N7N A;  2VGS A;  2YCT A;  2YRR A;  2GB3 A;  2VIA A;  4ISY A;  2DKB A;  4U2H A;  3JWB A;  1GDE A;  2E54 A;  3NYT A;  1YIZ A;  1DGD A;  2V1P A;  3EI5 A;  5BJ4 A;  2QBT A;  3WZF A;  2QB2 A;  2HOY A;  1S0A A;  3DR4 A;  3K28 A;  4MY5 A;  4ZWV A;  4RIZ A;  3DOD A;  2JJF A;  4IX8 A;  4ZSW A;  2YRI A;  5I92 A;  2W7J A;  3EIB A;  3HVY A;  3PJ0 A;  3AOW A;  1ELU A;  1W23 A;  1AKB A;  4ZLV A;  1GBN A;  3EUC A;  2JIS A;  3MAF B;  2YHK A;  4ITX A;  3VK4 A;  2JGT A;  4M2M A;  1O62 A;  2VGT A;  3NRA A;  2DGL A;  3FZ8 A;  3DRD A;  4Q75 A;  1JS3 A;  3FZ7 A;  1BJO A;  2JG2 A;  2R5E A;  2VMT A;  1QIT A;  1YNU A;  1X28 A;  1VP4 A;  2WKA A;  1WYT B;  2C7T A;  3P1T A;  4OMA A;  4AOA A;  2FN6 A;  2VMW A;  3AAT A;  4ZAS A;  3TCM A;  1E5F A;  3G8M A;  4LNL A; 
#chains in the Genus database with same CATH homology
 3QPG A;  1TAR A;  3FFR A;  4XJP A;  4FFC A;  1N31 A;  1ZOD A;  4IXO A;  4WYA A;  1I41 A;  3HBX A;  3R9A A;  3RCH A;  4E77 A;  4F5L A;  4ZM4 A;  2BYL A;  1ORD A;  1T3I A;  3HMU A;  3JTX A;  1MLY A;  3ZZJ A;  1GCK A;  1M32 A;  3L8A A;  3QGU A;  1S07 A;  2W7F A;  2CB1 A;  2VMU A;  4P7Y A;  5G4I A;  3WKR A;  3H7F A;  3WCN A;  3DR7 A;  5FT5 A;  4BA5 A;  1D7R A;  1X2A A;  1OHW A;  1AJR A;  4ATQ A;  1GEY A;  3VK3 A;  2WK7 A;  3AEL A;  4ADB A;  4WLH A;  1KL1 A;  4IXS A;  1DGE A;  4A6T A;  1BT4 A;  2AY1 A;  4CVQ A;  3I5T A;  3WGC A;  2W7L A;  1AIC A;  2W8U A;  2D61 A;  1G4V A;  4JEX A;  5G0A A;  1ASD A;  2X8U A;  1MDZ A;  3KKI A;  4W5K A;  4H51 A;  1B5P A;  1I29 A;  3A9X A;  4PFF A;  1DTY A;  1D2F A;  3BV0 A;  1KL2 A;  2BI2 A;  3CQ6 A;  3N4R A;  4TV7 A;  2ZY4 A;  2DGM A;  5F8V A;  1AHF A;  1UU0 A;  1Z7D A;  2VMS A;  3F6T A;  4GRX A;  1ASG A;  3WX9 A;  2Z9V A;  3F9T A;  2FNU A;  5DJ9 A;  3ELE A;  2FYF A;  3E9K A;  4N0B A;  5LHA A;  3W1I A;  2AY5 A;  1BJO B;  1WST A;  1AY5 A;  5EFS A;  1P3W A;  3QI6 A;  5G4J A;  1TPL A;  1X29 A;  1ASF A;  2O0R A;  4WXG A;  3TQX A;  1GD9 A;  1LC8 A;  2RFV A;  2EH6 A;  3E6G A;  3FD0 A;  3RCH B;  4A0G A;  1BJW A;  4K05 A;  1PMM A;  1W7M A;  3EIA A;  1WYV A;  4WP0 A;  4W1V A;  4NOG A;  2ZY3 A;  2OKK A;  5FT8 A;  4BHD A;  2DGK A;  2HOZ A;  2GQN A;  1CL1 A;  2C81 A;  2AY3 A;  4LW2 A;  3B46 A;  3MKJ A;  4UOY A;  3ASA A;  5E4Z A;  1AMR A;  2EO5 A;  2HUU A;  2OAT A;  4ZSY A;  2F8J A;  4EMY A;  1PMO A;  1B5O A;  3GBX A;  2XBN A;  1DJ9 A;  3A2B A;  3ELP A;  4EU1 A;  3WGB A;  4RM1 A;  1C7G A;  2BI5 A;  3KGW A;  1XEY A;  2VGV A;  4WYC A;  4XQ2 A;  4Q31 A;  4ADD A;  2BWP A;  2OQX A;  3QBO A;  1I48 A;  4CBS A;  4F5F A;  2W8V A;  1BKG A;  1GC0 A;  1WKH A;  3ZZK A;  1BQA A;  2E7I A;  4WD2 A;  3M5U A;  3PGY A;  4M2K A;  4MSO A;  2CH2 A;  1AMQ A;  3IF2 A;  2PB0 A;  2ZSL A;  2E7J A;  3BN1 A;  2ZSM A;  2WK8 A;  5TF5 A;  3JW9 A;  2CIN A;  2R5C A;  2YCP A;  3BWN A;  1S09 A;  3NDN A;  3BC8 A;  4LNJ A;  5AX8 A;  2C0R A;  5EIG B;  3MBB A;  1S08 A;  4M2J A;  1MDX A;  1SFF A;  2AEU A;  3LY1 A;  4K2I A;  3E77 A;  1ARG A;  5EUD A;  2VIB A;  3NTJ A;  2CST A;  3UAK A;  3FDB A;  1W7L A;  1OHV A;  4GE4 A;  3MAD A;  1WYV B;  3AEM C;  2VGZ A;  3HDO A;  4MQQ A;  5FT4 A;  2A1V A;  2AY8 A;  2QSR A;  1CJ0 A;  3L44 A;  4ADC A;  3PPL A;  4JE5 D;  1W3U A;  4O6Z A;  1IJI A;  3HL2 A;  5G2P A;  1QGN A;  2W8J A;  1XI9 A;  5DJ1 A;  1YJZ A;  1RV3 A;  3BWO A;  3NU7 A;  3UE8 A;  4UHM A;  3FQ8 A;  4XJO A;  1AJS A;  2Z9U A;  2W7G A;  4JF1 A;  4F5G A;  1V2F A;  4KXK A;  3HQT A;  1RVY A;  2AY2 A;  2D7Z A;  4ZDP A;  1ARS A;  3FQA A;  1LC7 A;  2HUI A;  3FSL A;  4J8L A;  1AKC A;  2FM1 A;  1FG7 A;  4XJM A;  2BIA A;  3RQ1 A;  3ASB A;  3PIU A;  1M0P A;  1DFO A;  1G7W A;  1X0M A;  2D64 A;  1CQ7 A;  4F5H A;  3UWC A;  4WXB A;  4N0W A;  4A0F A;  3G0T A;  1UU1 A;  2YKV A;  4Q6R A;  4W1X A;  2GMS A;  3I4J A;  1ASL A;  4RJY A;  1J32 A;  4JEZ A;  1CZE A;  1YJY A;  2X5F A;  2W7K A;  1AKA A;  1SVV A;  1SF2 A;  4WYD A;  2V0Y A;  2FKI A;  2ZY5 A;  2R5C B;  2FNI A;  1SZS A;  3N4X A;  3ATH A;  1KKJ A;  1LK9 A;  2VMZ A;  3AOV A;  3AEM A;  4WXF A;  2X3L A;  3FQ7 A;  2GMU A;  2AY9 A;  4JEV A;  1WKG A;  2OGE A;  4UQV A;  2ZC0 A;  5J8Q A;  1JF9 A;  2W7H A;  2VYC A;  3COG A;  2YKX A;  3FVU A;  1S06 A;  2G6W A;  2BI1 A;  4RLG A;  3KE3 A;  4R8D A;  4OTL A;  2CFB A;  1G4X A;  4CXQ A;  1MAP A;  4IY7 A;  4W1W A;  1YJS A;  2EGY A;  3FZ6 A;  3ECD A;  1ARI A;  3OKS A;  1EG5 A;  2YKY A;  4EB7 A;  2AAT A;  1ART A;  3N75 A;  4R2N A;  3PDX A;  4PVF A;  2E7U A;  1C0N A;  1AJS B;  2W7E A;  3H14 A;  4ADE A;  1O69 A;  1CZC A;  5EAA A;  5M4D A;  1JS6 A;  1ASA A;  1LW4 A;  2QMA A;  1LKC A;  2BI3 A;  3DXW A;  3EI7 A;  3FFH A;  1D7V A;  4WBT A;  1DKA A;  2BIG A;  4K2M A;  1ECX A;  3N4S A;  1FG3 A;  3R4T A;  2D7Y A;  2ZJG A;  2R0T A;  1C7N A;  3K7Y A;  1E5E A;  1MGV A;  5KTB A;  1IAY A;  1OHY A;  1BJN A;  3A8U X;  4L0O A;  4JEW A;  2BWN A;  3DZZ A;  8AAT A;  3BWN C;  4F5M A;  3PDB A;  2Z61 A;  4E3R A;  3LWS A;  1BW0 A;  3GWP A;  1SZK A;  3USF A;  4BQ0 A;  2JJG A;  4AH3 A;  1AAM A;  5EQC A;  5D95 A;  5M49 A;  1M7Y A;  1AHG A;  2Z1Y A;  3CQ5 A;  4E1O A;  4ATP A;  4H63 Q;  4EB5 A;  1U08 A;  1ASE A;  2YOB A;  3ZRR A;  2G7J A;  1V72 A;  3GSB A;  4XAU A;  3FVS A;  4F4E A;  1ASM A;  4WYG A;  2Z1Z A;  4GSA A;  1BS0 A;  1IX7 A;  4Y0H A;  1C4K A;  2AY6 A;  3DC1 A;  2ZP7 A;  4ZWM A;  3FVX A;  3HLM A;  3RBL A;  2NMP A;  2FQ6 A;  2JJH A;  1YOO A;  5IWQ A;  4IYO A;  1AIA A;  1LC5 A;  2W8T A;  3H9X A;  1BJ4 A;  3LVJ A;  3WY7 A;  1I43 A;  5HXX A;  1SPA A;  4RJ0 A;  1IX8 A;  2BI9 A;  1JG8 A;  4UHN A;  4B9B A;  3B8X A;  2AEV A;  3GR9 A;  3HT4 A;  2BWO A;  1CS1 A;  1TOJ A;  3W1J A;  4A0R A;  3FKD A;  4JE5 A;  2Z67 A;  1KKP A;  1B8G A;  4OT8 A;  1KMK A;  4R5F A;  4B98 A;  1J04 A;  3FRK A;  4ZDO A;  5F9S A;  2VI9 A;  1PFF A;  2KFP A;  1RV4 A;  1UKJ A;  4TN4 A;  4GEB A;  2HUF A;  1M0O A;  1Z3Z A;  4ZM3 A;  2VMO A;  3GZD C;  1AMS A;  4HVK A;  1MDO A;  4RAE A;  1QIS A;  1OXP A;  4JEY A;  4RIT A;  2Z9W A;  4WYF A;  3AEN A;  1IUG A;  2R2N A;  4MGR A;  3PDB B;  2ZUK A;  3ZRP A;  1M0N A;  4MQP A;  5E5I A;  4A72 A;  4AZK A;  3GET A;  1H1C A;  3P6K A;  2QLR A;  2VMR A;  3AEJ C;  1AHY A;  3ACZ A;  1D7S A;  3A9Z A;  1AMA A;  1PG8 A;  3MC6 A;  2EYQ A;  1OAT A;  2DOU A;  2VGW A;  1N8P A;  3LV2 A;  3NNK A;  5HHY A;  4F5J A;  5FT6 A;  1QJ5 A;  2PO3 A;  3NYS A;  2VLH A;  1W7N A;  3WCO A;  2W8W A;  3N0L A;  5M46 A;  2VGU A;  3QN6 A;  3NX3 A;  4OYT A;  3KGX A;  1N2T A;  4CXR A;  3NU8 A;  5BJ3 A;  4IXZ A;  4IYO B;  1GC4 A;  2W7I A;  1VJO A;  2JJE A;  4W91 A;  4HF8 A;  1DJE A;  1AAW A;  4MKJ A;  2Z9X A;  1M0Q A;  3PA9 A;  1AHE A;  7AAT A;  4A6U A;  2CJH A;  1ASN A;  4A0H A;  4PFN A;  3WKS A;  3VOM A;  3GZD A;  1B4X A;  3CAI A;  3QHX A;  4KAM A;  3AEO A;  1GEX A;  2DR1 A;  4BMK A;  1TAT A;  1ZC9 A;  3BS8 A;  3DXV A;  1B9H A;  2PB2 A;  3QM2 A;  3CBF A;  3WLX A;  4QGR A;  5M4B A;  1AY4 A;  3AEN B;  4WYE A;  2VMX A;  3AEJ A;  2C44 A;  2HP1 A;  5DB5 A;  4CBR A;  2HP2 A;  3JU7 A;  2ZY2 A;  2Z20 A;  2WK9 A;  1YAA A;  2QB3 A;  1TAS A;  1B9I A;  4XJL A;  4DBC A;  1YIY A;  5EAV A;  2YKU A;  1AX4 A;  3MAU A;  1AY8 A;  3G7Q A;  4LW4 A;  1TOG A;  2XH1 A;  3T32 A;  1TOI A;  3RUY A;  4IW7 A;  4LNM A;  3B1E A;  3FCR A;  2HOX A;  3LVM A;  1M6S A;  5DX5 A;  1Y4I A;  9AAT A;  1GEW A;  5HDM A;  3BCB A;  3GJU A;  4AO9 A;  2ORD A;  4ZAH A;  5EUN A;  4ZDL A;  2W7M A;  2CJG A;  1LW5 A;  2VI8 A;  3LVK A;  3PAA A;  2ZYJ A;  4LC3 A;  4XEW A;  2OKJ A;  4GE7 A;  1ELQ A;  3NUI A;  3BCX A;  1QJ3 A;  2EPJ A;  3Q8N A;  3TAT A;  5LH9 A;  3ISL A;  4MQR A;  1MAQ A;  3N5M A;  3PD6 A;  1KMJ A;  2CTZ A;  1DJU A;  5C6U A;  3LVL B;  3EZS A;  4R5Z A;  3TFU A;  3FTB A;  4A00 A;  2CAN A;  1ZOB A;  1GC3 A;  2Q7W A;  2VMV A;  2VMQ A;  1IX6 A;  2GSA A;  1EQB A;  3D6K A;  3EI8 A;  1CQ6 A;  4A6R A;  1ASB A;  2D65 A;  1QZ9 A;  3MEB A;  3JZL A;  4OBV A;  1O61 A;  3BB8 A;  4OCA A;  1D7U A;  2D63 A;  4PIW A;  1LS3 A;  5D5S A;  1C7O A;  2BHX A;  2EZ1 A;  3EI9 A;  2W7D A;  4DGT A;  1RVU A;  2VLF A;  3NUB A;  4P3M A;  3VK2 A;  1H0C A;  1CL2 A;  2AY4 A;  3RI6 A;  1TOK A;  1CQ8 A;  5EIG A;  1ARH A;  1EJI A;  1WYU A;  3MC6 C;  2VMP A;  1VEF A;  1M4N A;  2X5D A;  3B1D A;  3E2Z A;  3I16 A;  4WB0 A;  4E3Q A;  4F5I A;  5K8B A;  1OXO A;  2BKW A;  1IVR A;  2CJD A;  2OGA A;  2VMN A;  3VP6 A;  3ZRQ A;  5EUE A;  3A9Y A;  3AEP A;  5E3K A;  1ASC A;  4EFF A;  4ITG A;  3CQ4 A;  2D66 A;  3DYD A;  1QIR A;  3JWA A;  4GDY A;  2CH1 A;  2O7C A;  4WLJ A;  1UU2 A;  4XK1 A;  4W8I A;  1TOE A;  3VAX A;  2BIE A;  2QA3 A;  3DU4 A;  4TMR A;  3W1H A;  3NYU A;  1AIB A;  1GC2 A;  1O4S A;  2BYJ A;  3MAF A;  1V2E A;  3OP7 A;  4I8A A;  4OC9 A;  4DQ6 A;  4RKC A;  5JAY A;  1BQD A;  3E2Y A;  2DKJ A;  3K40 A;  3EI6 A;  2D5Y A;  3PD6 B;  3E2F A;  4FL0 A;  3II0 A;  1G7X A;  1WYT A;  4UHO A;  1V2D A;  1MLZ A;  4RKD A;  2WB6 A;  3F0H A;  2EZ2 A;  1C9C A;  4K2B A;  3EZ1 A;  3AV7 A;  4JF0 A;  4BA4 A;  2CY8 A;  3RBF A;  1IBJ A;  2TPL A;  4F5K A;  2HOR A;  4MKK A;  4J5U A;  2HZP A;  4OBU A;  1SZU A;  4Y0I A;  5G09 A;  4KYO A;  4Q76 A;  1AHX A;  1IAX A;  3B1C A;  3FDD A;  2YCN A;  2VMY A;  3IHJ A;  5G2Q A;  2AY7 A;  3TFT A;  3LG0 A;  3GZC A;  4GE9 A;  1WYU B;  3BCA A;  4U1T A;  3E2Z B;  2O1B A;  1FC4 A;  4WB0 B;  4Y0D A;  4AO4 A;  4AZJ A;  3N7N A;  2VGS A;  2YCT A;  2YRR A;  2GB3 A;  2VIA A;  4ISY A;  2DKB A;  4U2H A;  3JWB A;  1GDE A;  2E54 A;  3NYT A;  1YIZ A;  1DGD A;  2V1P A;  3EI5 A;  5BJ4 A;  2QBT A;  3WZF A;  2QB2 A;  2HOY A;  1S0A A;  3DR4 A;  3K28 A;  4MY5 A;  4ZWV A;  4RIZ A;  3DOD A;  2JJF A;  4IX8 A;  4ZSW A;  2YRI A;  5I92 A;  2W7J A;  3EIB A;  3HVY A;  3PJ0 A;  3AOW A;  1ELU A;  1W23 A;  1AKB A;  4ZLV A;  1GBN A;  3EUC A;  2JIS A;  3MAF B;  2YHK A;  4ITX A;  3VK4 A;  2JGT A;  4M2M A;  1O62 A;  2VGT A;  3NRA A;  2DGL A;  3FZ8 A;  3DRD A;  4Q75 A;  1JS3 A;  3FZ7 A;  1BJO A;  2JG2 A;  2R5E A;  2VMT A;  1QIT A;  1YNU A;  1X28 A;  1VP4 A;  2WKA A;  1WYT B;  2C7T A;  3P1T A;  4OMA A;  4AOA A;  2FN6 A;  2VMW A;  3AAT A;  4ZAS A;  3TCM A;  1E5F A;  3G8M A;  4LNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...