4ZAHA

Crystal structure of sugar aminotransferase wece with external aldimine vii from escherichia coli k-12
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
377
structure length
370
Chain Sequence
b'HMIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQKYTWRDIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFHYIPLHGCPAGEHFGEFHGEDRYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-4-amino-4,6-dideoxygalactose transaminase
publication title Structural Basis for the Stereochemical Control of Amine Installation in Nucleotide Sugar Aminotransferases.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transferase
total genus 132
structure length 370
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.6.1.59: dTDP-4-amino-4,6-dideoxygalactose transaminase.
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4zahA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4zahA02
1FG7A 3EUCA 3FZ8A 3GWPA 1YJZA 4GRXA 2ORDA 1M0NA 2CTZA 3BS8A 4OT8A 2X8UA 2EO5A 3DR7A 4ZSYA 3DODA 3QM2A 1BKGA 4WYAA 3LVJA 3HLMA 1I48A 2D66A 3BV0A 3R4TA 4A0GA 1BJOB 2BYLA 3PA9A 1IVRA 4GEBA 4MGRA 4OCAA 5EUDA 3FZ7A 4ZAHA 2VMTA 1O69A 3W1HA 1OHVA 3RI6A 4MQQA 5LHAA 2BI2A 3ZRQA 1E5EA 3B8XA 4PFFA 1KMJA 1ARSA 4OBVA 3KKIA 3PDBA 3HL2A 3E9KA 4ZDPA 1TPLA 1CJ0A 1XI9A 1SPAA 4JF1A 4Y0HA 3F0HA 2O0RA 4W5KA 1LW5A 3CQ5A 2CINA 3P6KA 3ISLA 3EI7A 5FT6A 1VJOA 1M7YA 2QA3A 3G8MA 2BKWA 3LG0A 1GC0A 2VMWA 3MC6C 1AX4A 5HHYA 2HORA 4IYOA 3NX3A 2JJGA 1OHYA 2CSTA 1RVUA 2GB3A 3BB8A 3I4JA 4A6TA 3R9AA 1ASMA 1DGEA 3CQ6A 1DJEA 4DBCA 4CXRA 2NMPA 5K8BA 2VGVA 3JZLA 4WYGA 2VI8A 3FFHA 2EZ1A 1VP4A 1YAAA 4ZASA 1TOGA 5E5IA 3MAUA 2E7UA 2JJHA 5G2PA 1CZEA 1G4VA 2CH1A 4MSOA 1BJ4A 3DZZA 3USFA 4F5MA 4I8AA 5I92A 2YHKA 4ZWVA 3QHXA 2PO3A 4RIZA 2XBNA 5BJ3A 8AATA 2ZUKA 3JTXA 3MAFA 4ADBA 3BCXA 4XJOA 4K2BA 4U1TA 1D7UA 5EUNA 3AEJA 3FVUA 1D2FA 4ISYA 1I41A 2CJGA 4KAMA 1QJ3A 5G4JA 3GBXA 4WLHA 4JE5A 1IAYA 2VMVA 3PD6B 2VMPA 4F5FA 1EG5A 3BN1A 3NYUA 2Z20A 2Z1ZA 4IXSA 1XEYA 4PIWA 3FSLA 1JS6A 4JF0A 1BT4A 3FFRA 4ITXA 4Y0IA 1AY5A 4B9BA 3OP7A 4MQPA 5FT8A 3KGXA 4HVKA 2HUIA 4LNLA 5EAVA 3RCHB 3AATA 2W7MA 3WGCA 2BI3A 1S09A 1TOIA 1O62A 1WSTA 1B9HA 4RJ0A 4L0OA 3BWNA 1WYTA 1AICA 4GE4A 3LVKA 5FT5A 3JW9A 3PPLA 1KMKA 3GR9A 5EUEA 2W7JA 4AZJA 3NYSA 1N2TA 4M2JA 1LK9A 3EI8A 3H7FA 4P3MA 1W7LA 2RFVA 2E7JA 1G4XA 3B1CA 3L8AA 4CXQA 1TARA 4NOGA 1KL2A 2HOXA 3K40A 2W7HA 3NYTA 4E77A 2F8JA 2VIAA 3ASAA 1MDXA 2BI5A 1YIYA 1ASLA 3JWAA 5HDMA 2R2NA 4IX8A 2DKJA 1BQDA 1ARTA 1EQBA 2AY2A 4A6UA 1AMQA 2ZYJA 4AH3A 4PVFA 3GZDA 3GSBA 3NRAA 4FFCA 2HOZA 4N0BA 2YCPA 3F6TA 2AEVA 2EZ2A 4CVQA 3G0TA 1C9CA 4F5IA 3JWBA 1GBNA 3CBFA 1S06A 1SZKA 2AY9A 1ASGA 4Q76A 4TMRA 1OXOA 2C44A 2VI9A 2HUFA 3A8UX 2VLFA 1MAPA 3UWCA 3E2ZA 4XJLA 4RJYA 3EZ1A 2DR1A 4WB0B 5JAYA 5IWQA 2CANA 1S0AA 2JGTA 3AEOA 1AY8A 1SFFA 1AMRA 1IJIA 3FDBA 2VMZA 3FDDA 2FQ6A 3HMUA 3FCRA 1T3IA 2BIAA 1AJSA 4MY5A 4EU1A 1V2DA 1WKGA 3WLXA 2FM1A 3DXVA 7AATA 1DFOA 1QZ9A 3EI6A 2YOBA 2HOYA 4GE7A 2D61A 5G0AA 4QGRA 1AAWA 3CQ4A 3HVYA 2AY7A 4IXZA 5EAAA 4MKJA 3PDBB 9AATA 2VLHA 2DGMA 2XH1A 1ELUA 2JISA 2GQNA 2VMQA 1SF2A 5DJ9A 1AHYA 3N5MA 5F9SA 1MDOA 1X0MA 4BMKA 1AMAA 3DXWA 3ACZA 4R5ZA 2ZY2A 1MAQA 3DC1A 1JF9A 4HF8A 5AX8A 3T32A 1ASBA 2R0TA 1OHWA 4E3QA 1GC2A 5E4ZA 1YJYA 1ARHA 2QLRA 2VGUA 3COGA 4F5HA 2HP2A 1ASDA 4A0RA 1CQ7A 3DU4A 1QIRA 1LC8A 3PIUA 5C6UA 2VGSA 1AIBA 1V72A 1MLZA 2QB3A 4P7YA 1G7XA 1ASCA 1JS3A 1W23A 3LWSA 2FNIA 4Y0DA 1C4KA 4WP0A 2YRIA 2W7KA 3EI5A 2ZY3A 2GMUA 4IXOA 1TATA 5F8VA 2W7EA 4BHDA 4MQRA 1X28A 3HQTA 3A9XA 1B8GA 1M4NA 1OATA 1BJNA 1UU2A 1H0CA 4ZLVA 2WK7A 4Q31A 3MKJA 3MADA 3BCAA 4WXGA 3WGBA 4U2HA 2JJFA 3TCMA 3EIAA 1X29A 3QPGA 3II0A 1AHGA 4O6ZA 4OTLA 3WCOA 4BA5A 3DRDA 1YNUA 3TFTA 2Z1YA 2OGEA 4UHNA 3P1TA 3IHJA 2CH2A 1BQAA 1I43A 3EIBA 3VP6A 1D7RA 4LC3A 3PGYA 2HUUA 4F5LA 2Z61A 3GETA 2BWPA 2QMAA 3LY1A 4IW7A 3HDOA 4LW4A 4EB7A 2AATA 3ATHA 3WY7A 3VK4A 4IY7A 2JG2A 2AY6A 2BIGA 4W91A 1ZODA 1AMSA 4F5KA 4MKKA 1WKHA 4TN4A 2OATA 2VMYA 1ASEA 4WYEA 1KKJA 4J8LA 1GD9A 3NU8A 1IX8A 4GE9A 2DGLA 1DJ9A 4W8IA 1J04A 2WK8A 4WYDA 2W8JA 3RBLA 1C7OA 3NNKA 4ZWMA 1AHXA 4ADDA 4UOYA 2DKBA 3A9ZA 4ZSWA 1AJRA 2ZY4A 3NDNA 2QBTA 3NU7A 4Q75A 3ZRRA 3HT4A 5G2QA 1KKPA 3BC8A 4H51A 2D64A 4WXBA 1SZSA 2D65A 5G4IA 4CBSA 2Z67A 2D5YA 4FL0A 4R5FA 3RQ1A 2TPLA 2AY8A 2YKXA 3DR4A 4AO9A 1B5PA 2WKAA 3HBXA 4A6RA 4ATPA 1CS1A 1EJIA 2D7YA 5M46A 1X2AA 1N31A 1AHEA 3AEPA 1DJUA 4ZM3A 4JEWA 5BJ4A 3IF2A 2X5DA 4W1XA 1IX7A 5EIGB 1G7WA 3ECDA 3BWOA 4WYCA 2GSAA 2EGYA 3VAXA 5M49A 1Y4IA 1RV3A 1CQ8A 1D7SA 1B5OA 2Z9UA 3BWNC 5DX5A 1PG8A 1W7MA 3AEMA 3VK3A 1CL1A 4N0WA 3FVXA 5LH9A 3NUIA 4XJMA 2Z9XA 2C81A 2Z9VA 4JE5D 1IUGA 2BYJA 4XJPA 3BCBA 1M0QA 2PB0A 1V2FA 4UHOA 3ZRPA 2VYCA 5DJ1A 4UHMA 4LW2A 1H1CA 2OGAA 4WXFA 2FYFA 4BA4A 1GEWA 3RCHA 1M0OA 2DOUA 5HXXA 2O1BA 2CFBA 4A72A 1O4SA 3ELEA 1ORDA 1O61A 1IX6A 1PMOA 2QB2A 2C0RA 3UAKA 2Z9WA 1MDZA 2VMNA 3FZ6A 4Q6RA 3H14A 3UE8A 3W1IA 5M4DA 1ZC9A 1LC7A 3KGWA 3F9TA 2W7IA 1DKAA 2CJDA 4OBUA 4XAUA 3VK2A 1BW0A 1IAXA 4B98A 1QISA 4OMAA 3ZZJA 3TFUA 2D7ZA 1V2EA 3FQAA 3RUYA 2V1PA 1VEFA 1U08A 4M2KA 2W8UA 3A2BA 2YCNA 1W3UA 3FQ8A 1AY4A 5M4BA 5TF5A 1GEYA 1PMMA 1W7NA 2VGTA 4A00A 4K2IA 3FTBA 2W8VA 3OKSA 4F5GA 3AOWA 1C0NA 4F4EA 3E2YA 3PDXA 4XEWA 3B1EA 2E7IA 1WYVA 4WYFA 2X5FA 4BQ0A 1IBJA 4IYOB 4J5UA 4A0HA 4DGTA 3WX9A 4M2MA 4WB0A 2D63A 4KXKA 4PFNA 1LS3A 2C7TA 3K7YA 1M0PA 3FKDA 2VMRA 1WYUA 3I5TA 2ZP7A 1CL2A 4GSAA 3WKRA 3N75A 3AENA 4JEXA 2R5CA 4F5JA 1J32A 3NUBA 1ASNA 2EPJA 3QGUA 1CQ6A 1YIZA 2BI9A 1C7NA 3NTJA 4AZKA 3MC6A 1D7VA 3AELA 3G7QA 3M5UA 4RKDA 2FNUA 3N0LA 2YRRA 2V0YA 2ZJGA 4XQ2A 1AIAA 2W7FA 1GDEA 2VGWA 4UQVA 4ZDLA 1BJOA 3MBBA 3K28A 1S07A 4KYOA 4EB5A 1GCKA 1Z7DA 3DYDA 3MAFB 1UU0A 1SVVA 1Z3ZA 1KL1A 1BS0A 2FN6A 1QGNA 2BI1A 2ZSLA 1QJ5A 3E77A 4W1WA 4JEZA 4AO4A 2VMSA 3GZCA 3PJ0A 2BWOA 2HP1A 4ADCA 1JG8A 1TOKA 1UKJA 4ZDOA 1TOJA 1ARGA 2AEUA 3B46A 3MEBA 3WCNA 1N8PA 3E2FA 3QI6A 3AV7A 1AHFA 1ASAA 1TASA 2BHXA 1P3WA 2ZSMA 1LKCA 4JEVA 2VMUA 4JEYA 2AY5A 2R5EA 4LNMA 4OYTA 2ZC0A 1ARIA 3QBOA 4R2NA 1WYTB 4ITGA 2OKJA 1LC5A 3AOVA 4AOAA 5D5SA 2YCTA 3ELPA 2ZY5A 1TOEA 1ELQA 2VIBA 5J8QA 2BIEA 1SZUA 2CB1A 1GEXA 1S08A 2G6WA 3D6KA 1LW4A 1MGVA 5G09A 2VMXA 2VGZA 2YKVA 4GDYA 3TATA 1ECXA 2YKYA 3WZFA 2CY8A 4CBRA 3AEJC 2W7GA 1B9IA 3W1JA 4RITA 4LNJA 1E5FA 3VOMA 2HZPA 2W7DA 3ZZKA 1RVYA 4TV7A 4RKCA 2BWNA 5DB5A 1AKCA 2AY1A 2CJHA 1AAMA 1OXPA 3A9YA 2DGKA 1RV4A 3LVLB 2W8WA 4EFFA 3ASBA 3TQXA 5D95A 3E2ZB 5FT4A 5E3KA 1M32A 3CAIA 4E1OA 2WK9A 3FQ7A 1C7GA 1GC4A 2W8TA 4RAEA 1M6SA 1AKAA 4A0FA 4ZM4A 3PD6A 1FC4A 3FD0A 1MLYA 1CZCA 1AJSB 1AKBA 3E6GA 3I16A 1BJWA 2O7CA 4RLGA 2X3LA 3EI9A 4K2MA 3EZSA 1DGDA 4WD2A 4E3RA 2Q7WA 1GC3A 1PFFA 3B1DA 3LV2A 4EMYA 4WLJA 4ADEA 3RBFA 3L44A 3KE3A 1YJSA 3GZDC 3LVMA 2VMOA 2AY3A 4WBTA 4OC9A 4R8DA 3AEMC 2JJEA 2YKUA 3GJUA 1YOOA 4RM1A 1ZOBA 4XK1A 1WYVB 1DTYA 5EIGA 3WKSA 2GMSA 4DQ6A 1UU1A 3FRKA 5EFSA 2EH6A 2OQXA 5EQCA 3QN6A 2OKKA 4W1VA 1QITA 4ATQA 3FVSA 1B4XA 2AY4A 1FG3A 1WYUB 3JU7A 2PB2A 2W7LA 3PAAA 3Q8NA 1ASFA 1I29A 2E54A 3AENB 2R5CB
chains in the Genus database with same CATH superfamily
1FG7A 3EUCA 3FZ8A 3GWPA 1YJZA 4GRXA 2ORDA 1M0NA 2G7JA 2CTZA 3BS8A 4OT8A 2X8UA 2EO5A 3DR7A 4ZSYA 3DODA 3QM2A 1BKGA 4WYAA 3LVJA 3HLMA 1I48A 2D66A 3BV0A 3R4TA 4A0GA 1BJOB 2BYLA 3PA9A 1IVRA 4GEBA 4MGRA 4OCAA 5EUDA 3FZ7A 4ZAHA 2VMTA 1O69A 3W1HA 1OHVA 3RI6A 4MQQA 5LHAA 2BI2A 3ZRQA 1E5EA 3B8XA 4PFFA 1KMJA 1ARSA 4OBVA 3KKIA 3PDBA 3HL2A 3E9KA 4ZDPA 1TPLA 1CJ0A 1XI9A 1SPAA 4JF1A 4Y0HA 2WB6A 3F0HA 2O0RA 4W5KA 1LW5A 3CQ5A 2CINA 3P6KA 3ISLA 3EI7A 5FT6A 1VJOA 1M7YA 2QA3A 3G8MA 2BKWA 3LG0A 1GC0A 2VMWA 3MC6C 1AX4A 5HHYA 2HORA 4IYOA 3NX3A 2JJGA 1OHYA 2CSTA 1RVUA 2GB3A 3BB8A 3I4JA 4A6TA 3R9AA 1ASMA 1DGEA 3CQ6A 1DJEA 4DBCA 4CXRA 2NMPA 5K8BA 2VGVA 3JZLA 4WYGA 2VI8A 3FFHA 2EZ1A 1VP4A 1YAAA 4ZASA 1TOGA 5E5IA 3MAUA 2E7UA 2JJHA 5G2PA 1CZEA 1G4VA 2CH1A 4MSOA 1BJ4A 3DZZA 3USFA 4F5MA 4I8AA 5I92A 2YHKA 4ZWVA 3QHXA 2PO3A 4RIZA 2XBNA 5BJ3A 8AATA 2ZUKA 3JTXA 3MAFA 4ADBA 3BCXA 4XJOA 4K2BA 4U1TA 1D7UA 5EUNA 3AEJA 3FVUA 1D2FA 4ISYA 1I41A 2CJGA 4KAMA 1QJ3A 5G4JA 3GBXA 4WLHA 4JE5A 1IAYA 2VMVA 3PD6B 2VMPA 4F5FA 1EG5A 3BN1A 3NYUA 2Z20A 2Z1ZA 4IXSA 1XEYA 4PIWA 3FSLA 1JS6A 4JF0A 1BT4A 3FFRA 4ITXA 4Y0IA 1AY5A 4B9BA 3OP7A 4MQPA 5FT8A 3KGXA 4HVKA 2HUIA 4LNLA 5EAVA 3RCHB 3AATA 2W7MA 3WGCA 2BI3A 1S09A 1TOIA 1O62A 1WSTA 1B9HA 4RJ0A 4L0OA 3BWNA 1WYTA 1AICA 4GE4A 3LVKA 5FT5A 3JW9A 3PPLA 1KMKA 3GR9A 5EUEA 2W7JA 4AZJA 3NYSA 1N2TA 4M2JA 1LK9A 3EI8A 3H7FA 4P3MA 1W7LA 2RFVA 2E7JA 1G4XA 3B1CA 3L8AA 4CXQA 2A1VA 1TARA 4NOGA 1KL2A 2HOXA 3K40A 2W7HA 3NYTA 4E77A 2F8JA 2VIAA 3ASAA 3N7NA 1MDXA 2BI5A 1YIYA 1ASLA 3JWAA 5HDMA 2R2NA 4IX8A 2DKJA 1BQDA 1ARTA 1EQBA 2AY2A 4A6UA 1AMQA 2ZYJA 4AH3A 4PVFA 3GZDA 3GSBA 3NRAA 4FFCA 2HOZA 4N0BA 2YCPA 3F6TA 2AEVA 2EZ2A 4CVQA 3G0TA 1C9CA 4F5IA 3JWBA 1GBNA 3CBFA 1S06A 1SZKA 2AY9A 1ASGA 4Q76A 4TMRA 1OXOA 2C44A 2VI9A 2HUFA 3A8UX 2VLFA 1MAPA 3UWCA 3E2ZA 4XJLA 4RJYA 3EZ1A 2DR1A 4WB0B 5JAYA 5IWQA 2CANA 1S0AA 2JGTA 3AEOA 1AY8A 1SFFA 1AMRA 1IJIA 3FDBA 2VMZA 3FDDA 2FQ6A 3HMUA 3FCRA 1T3IA 2KFPA 2BIAA 1AJSA 4MY5A 4EU1A 1V2DA 1WKGA 3WLXA 2FM1A 3DXVA 7AATA 1DFOA 1QZ9A 3EI6A 2YOBA 2HOYA 4GE7A 2D61A 5G0AA 4QGRA 1AAWA 3CQ4A 3HVYA 2AY7A 4IXZA 5EAAA 4MKJA 3PDBB 9AATA 2VLHA 2DGMA 2XH1A 1ELUA 2JISA 2GQNA 2VMQA 1SF2A 5DJ9A 1AHYA 3N5MA 5F9SA 1MDOA 1X0MA 4BMKA 1AMAA 3DXWA 3ACZA 4R5ZA 2ZY2A 1MAQA 3DC1A 1JF9A 4HF8A 5AX8A 3T32A 1ASBA 2R0TA 1OHWA 4E3QA 1GC2A 5E4ZA 1YJYA 1ARHA 2QLRA 2VGUA 3COGA 4F5HA 2HP2A 1ASDA 4A0RA 1CQ7A 3DU4A 1QIRA 1LC8A 3PIUA 5C6UA 2VGSA 1AIBA 1V72A 1MLZA 2QB3A 4P7YA 1G7XA 1ASCA 1JS3A 1W23A 3LWSA 2FNIA 4Y0DA 1C4KA 4WP0A 2YRIA 2W7KA 3EI5A 2ZY3A 2GMUA 4IXOA 1TATA 5F8VA 2W7EA 4BHDA 4MQRA 1X28A 3HQTA 3A9XA 1B8GA 1M4NA 3N4XA 1OATA 1BJNA 1UU2A 1H0CA 4ZLVA 2WK7A 4Q31A 3MKJA 3MADA 3BCAA 4WXGA 3WGBA 4U2HA 2JJFA 3TCMA 3EIAA 1X29A 3QPGA 3II0A 1AHGA 4O6ZA 4OTLA 3WCOA 4BA5A 2FKIA 3DRDA 1YNUA 3TFTA 2Z1YA 2OGEA 4UHNA 3P1TA 3IHJA 2CH2A 1BQAA 1I43A 3EIBA 3VP6A 1D7RA 4LC3A 3PGYA 2HUUA 4F5LA 2Z61A 3GETA 2BWPA 2QMAA 3LY1A 4IW7A 3HDOA 4LW4A 4EB7A 2AATA 3ATHA 3WY7A 3VK4A 4IY7A 2EYQA 2JG2A 2AY6A 2BIGA 4W91A 1ZODA 1AMSA 4F5KA 4MKKA 1WKHA 4TN4A 2OATA 2VMYA 1ASEA 4WYEA 1KKJA 4J8LA 1GD9A 3NU8A 1IX8A 4GE9A 2DGLA 1DJ9A 4W8IA 1J04A 2WK8A 4WYDA 2W8JA 3RBLA 1C7OA 3NNKA 4ZWMA 1AHXA 4ADDA 4UOYA 2DKBA 3A9ZA 4ZSWA 1AJRA 2ZY4A 3NDNA 2QBTA 3NU7A 4Q75A 3ZRRA 3HT4A 5G2QA 1KKPA 3BC8A 4H51A 2D64A 4WXBA 1SZSA 2D65A 5G4IA 4CBSA 2Z67A 2D5YA 4FL0A 4R5FA 3RQ1A 2TPLA 2AY8A 2YKXA 3DR4A 4AO9A 1B5PA 2WKAA 3HBXA 4A6RA 4K05A 4ATPA 1CS1A 1EJIA 2D7YA 5M46A 1X2AA 1N31A 1AHEA 3AEPA 1DJUA 4ZM3A 4JEWA 5BJ4A 3IF2A 2X5DA 4W1XA 1IX7A 5EIGB 1G7WA 3ECDA 3BWOA 4WYCA 2GSAA 2EGYA 3VAXA 5M49A 1Y4IA 1RV3A 1CQ8A 1D7SA 3N4RA 1B5OA 2Z9UA 3BWNC 5DX5A 1PG8A 1W7MA 3AEMA 3VK3A 1CL1A 4N0WA 3FVXA 5LH9A 3NUIA 4XJMA 2Z9XA 2C81A 2Z9VA 4JE5D 1IUGA 2BYJA 4XJPA 3BCBA 1M0QA 2PB0A 1V2FA 4UHOA 3ZRPA 2VYCA 5DJ1A 4UHMA 4LW2A 1H1CA 2OGAA 4WXFA 2FYFA 4BA4A 1GEWA 3RCHA 1M0OA 2DOUA 5HXXA 2O1BA 2CFBA 4A72A 1O4SA 3ELEA 1ORDA 1O61A 1IX6A 1PMOA 2QB2A 2C0RA 3UAKA 2Z9WA 1MDZA 2VMNA 3FZ6A 4Q6RA 3H14A 3UE8A 3W1IA 5M4DA 1ZC9A 1LC7A 3KGWA 3F9TA 2W7IA 1DKAA 2CJDA 4OBUA 4XAUA 3VK2A 1BW0A 1IAXA 4B98A 1QISA 4OMAA 3ZZJA 3TFUA 2D7ZA 1V2EA 3FQAA 3RUYA 2V1PA 1VEFA 1U08A 4M2KA 2W8UA 3A2BA 2YCNA 1W3UA 3FQ8A 1AY4A 5M4BA 5TF5A 1GEYA 1PMMA 1W7NA 2VGTA 4A00A 4K2IA 3FTBA 2W8VA 3OKSA 4F5GA 3AOWA 1C0NA 4F4EA 3E2YA 3PDXA 4XEWA 3B1EA 2E7IA 1WYVA 4WYFA 2X5FA 4BQ0A 1IBJA 4IYOB 4J5UA 4A0HA 5KTBA 4DGTA 3WX9A 4M2MA 4WB0A 2D63A 4KXKA 4PFNA 1LS3A 2C7TA 3K7YA 1M0PA 3FKDA 2VMRA 1WYUA 3I5TA 2ZP7A 1CL2A 4GSAA 3WKRA 3N75A 3AENA 4JEXA 2R5CA 4F5JA 1J32A 3NUBA 1ASNA 2EPJA 3QGUA 1CQ6A 1YIZA 2BI9A 1C7NA 3NTJA 4AZKA 3MC6A 1D7VA 3AELA 3G7QA 3M5UA 4RKDA 2FNUA 3N0LA 2YRRA 2V0YA 2ZJGA 4XQ2A 1AIAA 2W7FA 1GDEA 2VGWA 4UQVA 4ZDLA 1BJOA 3MBBA 3K28A 1S07A 4KYOA 4EB5A 1GCKA 1Z7DA 3DYDA 3MAFB 1UU0A 1SVVA 1Z3ZA 1KL1A 1BS0A 2FN6A 1QGNA 2BI1A 2ZSLA 1QJ5A 3E77A 4W1WA 4JEZA 4AO4A 2VMSA 3GZCA 3PJ0A 2BWOA 2HP1A 4ADCA 1JG8A 1TOKA 1UKJA 4ZDOA 1TOJA 1ARGA 2AEUA 3B46A 3MEBA 3WCNA 1N8PA 3E2FA 3QI6A 3AV7A 1AHFA 1ASAA 1TASA 2BHXA 1P3WA 2ZSMA 1LKCA 4JEVA 2VMUA 4JEYA 2AY5A 2R5EA 4LNMA 4OYTA 2ZC0A 3N4SA 1ARIA 3QBOA 4R2NA 1WYTB 4ITGA 2OKJA 1LC5A 3AOVA 4AOAA 5D5SA 2YCTA 3ELPA 2ZY5A 1TOEA 1ELQA 2VIBA 5J8QA 2BIEA 1SZUA 2CB1A 1GEXA 1S08A 2G6WA 3D6KA 4H63Q 1LW4A 1MGVA 5G09A 2VMXA 2VGZA 2YKVA 4GDYA 3TATA 1ECXA 2YKYA 3WZFA 2CY8A 4CBRA 3AEJC 2W7GA 1B9IA 3W1JA 4RITA 4LNJA 1E5FA 3VOMA 3H9XA 2HZPA 2W7DA 3ZZKA 1RVYA 4TV7A 4RKCA 2BWNA 5DB5A 1AKCA 2AY1A 1KAFA 2CJHA 1AAMA 1OXPA 3A9YA 2DGKA 1RV4A 3LVLB 2W8WA 4EFFA 3ASBA 3TQXA 5D95A 3E2ZB 5FT4A 5E3KA 1M32A 3CAIA 4E1OA 2WK9A 3FQ7A 1C7GA 1GC4A 2W8TA 4RAEA 1M6SA 1AKAA 4A0FA 4ZM4A 3PD6A 1FC4A 3FD0A 1MLYA 1CZCA 1AJSB 1AKBA 3E6GA 3I16A 1BJWA 2O7CA 4RLGA 2X3LA 3EI9A 4K2MA 3EZSA 1DGDA 4WD2A 4E3RA 2Q7WA 1GC3A 1PFFA 3B1DA 3LV2A 4EMYA 4WLJA 4ADEA 3RBFA 2QSRA 3L44A 3KE3A 1YJSA 3GZDC 3LVMA 2VMOA 2AY3A 4WBTA 4OC9A 4R8DA 3AEMC 2JJEA 2YKUA 3GJUA 1YOOA 4RM1A 1ZOBA 4XK1A 1WYVB 1DTYA 5EIGA 3WKSA 2GMSA 4DQ6A 1UU1A 3FRKA 5EFSA 2EH6A 2OQXA 5EQCA 3QN6A 2OKKA 4W1VA 1QITA 4ATQA 3FVSA 1B4XA 2AY4A 1FG3A 1WYUB 3JU7A 2PB2A 2W7LA 3PAAA 3Q8NA 1ASFA 1I29A 2E54A 3AENB 2R5CB
chains in the Genus database with same CATH topology
1FG7A 3EUCA 3FZ8A 3GWPA 1YJZA 4GRXA 2ORDA 1M0NA 2G7JA 2CTZA 3BS8A 4OT8A 2X8UA 2EO5A 3DR7A 4ZSYA 3DODA 3QM2A 1BKGA 4WYAA 3LVJA 3HLMA 1I48A 2D66A 3BV0A 3R4TA 4A0GA 1BJOB 2BYLA 3PA9A 1IVRA 4GEBA 4MGRA 4OCAA 5EUDA 3FZ7A 4ZAHA 2VMTA 1O69A 3W1HA 1OHVA 3RI6A 4MQQA 5LHAA 2BI2A 3ZRQA 1E5EA 3B8XA 4PFFA 1KMJA 1ARSA 4OBVA 3KKIA 3PDBA 3HL2A 3E9KA 4ZDPA 1TPLA 1CJ0A 1XI9A 1SPAA 4JF1A 4Y0HA 2WB6A 3F0HA 2O0RA 4W5KA 1LW5A 3CQ5A 2CINA 3P6KA 3ISLA 3EI7A 5FT6A 1VJOA 1M7YA 2QA3A 3G8MA 2BKWA 3LG0A 1GC0A 2VMWA 3MC6C 1AX4A 5HHYA 2HORA 4IYOA 3NX3A 2JJGA 1OHYA 2CSTA 1RVUA 2GB3A 3BB8A 3I4JA 4A6TA 3R9AA 1ASMA 1DGEA 3CQ6A 1DJEA 4DBCA 4CXRA 2NMPA 5K8BA 2VGVA 3JZLA 4WYGA 2VI8A 3FFHA 2EZ1A 1VP4A 1YAAA 4ZASA 1TOGA 5E5IA 3MAUA 2E7UA 2JJHA 5G2PA 1CZEA 1G4VA 2CH1A 4MSOA 1BJ4A 3DZZA 3USFA 4F5MA 4I8AA 5I92A 2YHKA 4ZWVA 3QHXA 2PO3A 4RIZA 2XBNA 5BJ3A 8AATA 2ZUKA 3JTXA 3MAFA 4ADBA 3BCXA 4XJOA 4K2BA 4U1TA 1D7UA 5EUNA 3AEJA 3FVUA 1D2FA 4ISYA 1I41A 2CJGA 4KAMA 1QJ3A 5G4JA 3GBXA 4WLHA 4JE5A 1IAYA 2VMVA 3PD6B 2VMPA 4F5FA 1EG5A 3BN1A 3NYUA 2Z20A 2Z1ZA 4IXSA 1XEYA 4PIWA 3FSLA 1JS6A 4JF0A 1BT4A 3FFRA 4ITXA 4Y0IA 1AY5A 4B9BA 3OP7A 4MQPA 5FT8A 3KGXA 4HVKA 2HUIA 4LNLA 5EAVA 3RCHB 3AATA 2W7MA 3WGCA 2BI3A 1S09A 1TOIA 1O62A 1WSTA 1B9HA 4RJ0A 4L0OA 3BWNA 1WYTA 1AICA 4GE4A 3LVKA 5FT5A 3JW9A 3PPLA 1KMKA 3GR9A 5EUEA 2W7JA 4AZJA 3NYSA 1N2TA 4M2JA 1LK9A 3EI8A 3H7FA 4P3MA 1W7LA 2RFVA 2E7JA 1G4XA 3B1CA 3L8AA 4CXQA 2A1VA 1TARA 4NOGA 1KL2A 2HOXA 3K40A 2W7HA 3NYTA 4E77A 2F8JA 2VIAA 3ASAA 3N7NA 1MDXA 2BI5A 1YIYA 1ASLA 3JWAA 5HDMA 2R2NA 4IX8A 2DKJA 1BQDA 1ARTA 1EQBA 2AY2A 4A6UA 1AMQA 2ZYJA 4AH3A 4PVFA 3GZDA 3GSBA 3NRAA 4FFCA 2HOZA 4N0BA 2YCPA 3F6TA 2AEVA 2EZ2A 4CVQA 3G0TA 1C9CA 4F5IA 3JWBA 1GBNA 3CBFA 1S06A 1SZKA 2AY9A 1ASGA 4Q76A 4TMRA 1OXOA 2C44A 2VI9A 2HUFA 3A8UX 2VLFA 1MAPA 3UWCA 3E2ZA 4XJLA 4RJYA 3EZ1A 2DR1A 4WB0B 5JAYA 5IWQA 2CANA 1S0AA 2JGTA 3AEOA 1AY8A 1SFFA 1AMRA 1IJIA 3FDBA 2VMZA 3FDDA 2FQ6A 3HMUA 3FCRA 1T3IA 2KFPA 2BIAA 1AJSA 4MY5A 4EU1A 1V2DA 1WKGA 3WLXA 2FM1A 3DXVA 7AATA 1DFOA 1QZ9A 3EI6A 2YOBA 2HOYA 4GE7A 2D61A 5G0AA 4QGRA 1AAWA 3CQ4A 3HVYA 2AY7A 4IXZA 5EAAA 4MKJA 3PDBB 9AATA 2VLHA 2DGMA 2XH1A 1ELUA 2JISA 2GQNA 2VMQA 1SF2A 5DJ9A 1AHYA 3N5MA 5F9SA 1MDOA 1X0MA 4BMKA 1AMAA 3DXWA 3ACZA 4R5ZA 2ZY2A 1MAQA 3DC1A 1JF9A 4HF8A 5AX8A 3T32A 1ASBA 2R0TA 1OHWA 4E3QA 1GC2A 5E4ZA 1YJYA 1ARHA 2QLRA 2VGUA 3COGA 4F5HA 2HP2A 1ASDA 4A0RA 1CQ7A 3DU4A 1QIRA 1LC8A 3PIUA 5C6UA 2VGSA 1AIBA 1V72A 1MLZA 2QB3A 4P7YA 1G7XA 1ASCA 1JS3A 1W23A 3LWSA 2FNIA 4Y0DA 1C4KA 4WP0A 2YRIA 2W7KA 3EI5A 2ZY3A 2GMUA 4IXOA 1TATA 5F8VA 2W7EA 4BHDA 4MQRA 1X28A 3HQTA 3A9XA 1B8GA 1M4NA 3N4XA 1OATA 1BJNA 1UU2A 1H0CA 4ZLVA 2WK7A 4Q31A 3MKJA 3MADA 3BCAA 4WXGA 3WGBA 4U2HA 2JJFA 3TCMA 3EIAA 1X29A 3QPGA 3II0A 1AHGA 4O6ZA 4OTLA 3WCOA 4BA5A 2FKIA 3DRDA 1YNUA 3TFTA 2Z1YA 2OGEA 4UHNA 3P1TA 3IHJA 2CH2A 1BQAA 1I43A 3EIBA 3VP6A 1D7RA 4LC3A 3PGYA 2HUUA 4F5LA 2Z61A 3GETA 2BWPA 2QMAA 3LY1A 4IW7A 3HDOA 4LW4A 4EB7A 2AATA 3ATHA 3WY7A 3VK4A 4IY7A 2EYQA 2JG2A 2AY6A 2BIGA 4W91A 1ZODA 1AMSA 4F5KA 4MKKA 1WKHA 4TN4A 2OATA 2VMYA 1ASEA 4WYEA 1KKJA 4J8LA 1GD9A 3NU8A 1IX8A 4GE9A 2DGLA 1DJ9A 4W8IA 1J04A 2WK8A 4WYDA 2W8JA 3RBLA 1C7OA 3NNKA 4ZWMA 1AHXA 4ADDA 4UOYA 2DKBA 3A9ZA 4ZSWA 1AJRA 2ZY4A 3NDNA 2QBTA 3NU7A 4Q75A 3ZRRA 3HT4A 5G2QA 1KKPA 3BC8A 4H51A 2D64A 4WXBA 1SZSA 2D65A 5G4IA 4CBSA 2Z67A 2D5YA 4FL0A 4R5FA 3RQ1A 2TPLA 2AY8A 2YKXA 3DR4A 4AO9A 1B5PA 2WKAA 3HBXA 4A6RA 4K05A 4ATPA 1CS1A 1EJIA 2D7YA 5M46A 1X2AA 1N31A 1AHEA 3AEPA 1DJUA 4ZM3A 4JEWA 5BJ4A 3IF2A 2X5DA 4W1XA 1IX7A 5EIGB 1G7WA 3ECDA 3BWOA 4WYCA 2GSAA 2EGYA 3VAXA 5M49A 1Y4IA 1RV3A 1CQ8A 1D7SA 3N4RA 1B5OA 2Z9UA 3BWNC 5DX5A 1PG8A 1W7MA 3AEMA 3VK3A 1CL1A 4N0WA 3FVXA 5LH9A 3NUIA 4XJMA 2Z9XA 2C81A 2Z9VA 4JE5D 1IUGA 2BYJA 4XJPA 3BCBA 1M0QA 2PB0A 1V2FA 4UHOA 3ZRPA 2VYCA 5DJ1A 4UHMA 4LW2A 1H1CA 2OGAA 4WXFA 2FYFA 4BA4A 1GEWA 3RCHA 1M0OA 2DOUA 5HXXA 2O1BA 2CFBA 4A72A 1O4SA 3ELEA 1ORDA 1O61A 1IX6A 1PMOA 2QB2A 2C0RA 3UAKA 2Z9WA 1MDZA 2VMNA 3FZ6A 4Q6RA 3H14A 3UE8A 3W1IA 5M4DA 1ZC9A 1LC7A 3KGWA 3F9TA 2W7IA 1DKAA 2CJDA 4OBUA 4XAUA 3VK2A 1BW0A 1IAXA 4B98A 1QISA 4OMAA 3ZZJA 3TFUA 2D7ZA 1V2EA 3FQAA 3RUYA 2V1PA 1VEFA 1U08A 4M2KA 2W8UA 3A2BA 2YCNA 1W3UA 3FQ8A 1AY4A 5M4BA 5TF5A 1GEYA 1PMMA 1W7NA 2VGTA 4A00A 4K2IA 3FTBA 2W8VA 3OKSA 4F5GA 3AOWA 1C0NA 4F4EA 3E2YA 3PDXA 4XEWA 3B1EA 2E7IA 1WYVA 4WYFA 2X5FA 4BQ0A 1IBJA 4IYOB 4J5UA 4A0HA 5KTBA 4DGTA 3WX9A 4M2MA 4WB0A 2D63A 4KXKA 4PFNA 1LS3A 2C7TA 3K7YA 1M0PA 3FKDA 2VMRA 1WYUA 3I5TA 2ZP7A 1CL2A 4GSAA 3WKRA 3N75A 3AENA 4JEXA 2R5CA 4F5JA 1J32A 3NUBA 1ASNA 2EPJA 3QGUA 1CQ6A 1YIZA 2BI9A 1C7NA 3NTJA 4AZKA 3MC6A 1D7VA 3AELA 3G7QA 3M5UA 4RKDA 2FNUA 3N0LA 2YRRA 2V0YA 2ZJGA 4XQ2A 1AIAA 2W7FA 1GDEA 2VGWA 4UQVA 4ZDLA 1BJOA 3MBBA 3K28A 1S07A 4KYOA 4EB5A 1GCKA 1Z7DA 3DYDA 3MAFB 1UU0A 1SVVA 1Z3ZA 1KL1A 1BS0A 2FN6A 1QGNA 2BI1A 2ZSLA 1QJ5A 3E77A 4W1WA 4JEZA 4AO4A 2VMSA 3GZCA 3PJ0A 2BWOA 2HP1A 4ADCA 1JG8A 1TOKA 1UKJA 4ZDOA 1TOJA 1ARGA 2AEUA 3B46A 3MEBA 3WCNA 1N8PA 3E2FA 3QI6A 3AV7A 1AHFA 1ASAA 1TASA 2BHXA 1P3WA 2ZSMA 1LKCA 4JEVA 2VMUA 4JEYA 2AY5A 2R5EA 4LNMA 4OYTA 2ZC0A 3N4SA 1ARIA 3QBOA 4R2NA 1WYTB 4ITGA 2OKJA 1LC5A 3AOVA 4AOAA 5D5SA 2YCTA 3ELPA 2ZY5A 1TOEA 1ELQA 2VIBA 5J8QA 2BIEA 1SZUA 2CB1A 1GEXA 1S08A 2G6WA 3D6KA 4H63Q 1LW4A 1MGVA 5G09A 2VMXA 2VGZA 2YKVA 4GDYA 3TATA 1ECXA 2YKYA 3WZFA 2CY8A 4CBRA 3AEJC 2W7GA 1B9IA 3W1JA 4RITA 4LNJA 1E5FA 3VOMA 3H9XA 2HZPA 2W7DA 3ZZKA 1RVYA 4TV7A 4RKCA 2BWNA 5DB5A 1AKCA 2AY1A 2CJHA 1AAMA 1OXPA 3A9YA 2DGKA 1RV4A 3LVLB 2W8WA 4EFFA 3ASBA 3TQXA 5D95A 3E2ZB 5FT4A 5E3KA 1M32A 3CAIA 4E1OA 2WK9A 3FQ7A 1C7GA 1GC4A 2W8TA 4RAEA 1M6SA 1AKAA 4A0FA 4ZM4A 3PD6A 1FC4A 3FD0A 1MLYA 1CZCA 1AJSB 1AKBA 3E6GA 3I16A 1BJWA 2O7CA 4RLGA 2X3LA 3EI9A 4K2MA 3EZSA 1DGDA 4WD2A 4E3RA 2Q7WA 1GC3A 1PFFA 3B1DA 3LV2A 4EMYA 4WLJA 4ADEA 3RBFA 2QSRA 3L44A 3KE3A 1YJSA 3GZDC 3LVMA 2VMOA 2AY3A 4WBTA 4OC9A 4R8DA 3AEMC 2JJEA 2YKUA 3GJUA 1YOOA 4RM1A 1ZOBA 4XK1A 1WYVB 1DTYA 5EIGA 3WKSA 2GMSA 4DQ6A 1UU1A 3FRKA 5EFSA 2EH6A 2OQXA 5EQCA 3QN6A 2OKKA 4W1VA 1QITA 4ATQA 3FVSA 1B4XA 2AY4A 1FG3A 1WYUB 3JU7A 2PB2A 2W7LA 3PAAA 3Q8NA 1ASFA 1I29A 2E54A 3AENB 2R5CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FG7 A;  3EUC A;  3FZ8 A;  3GWP A;  1YJZ A;  4GRX A;  2ORD A;  1M0N A;  2CTZ A;  3BS8 A;  4OT8 A;  2X8U A;  2EO5 A;  3DR7 A;  4ZSY A;  3DOD A;  3QM2 A;  1BKG A;  4WYA A;  3LVJ A;  3HLM A;  1I48 A;  2D66 A;  3BV0 A;  3R4T A;  4A0G A;  1BJO B;  2BYL A;  3PA9 A;  1IVR A;  4GEB A;  4MGR A;  4OCA A;  5EUD A;  3FZ7 A;  4ZAH A;  2VMT A;  1O69 A;  3W1H A;  1OHV A;  3RI6 A;  4MQQ A;  5LHA A;  2BI2 A;  3ZRQ A;  1E5E A;  3B8X A;  4PFF A;  1KMJ A;  1ARS A;  4OBV A;  3KKI A;  3PDB A;  3HL2 A;  3E9K A;  4ZDP A;  1TPL A;  1CJ0 A;  1XI9 A;  1SPA A;  4JF1 A;  4Y0H A;  3F0H A;  2O0R A;  4W5K A;  1LW5 A;  3CQ5 A;  2CIN A;  3P6K A;  3ISL A;  3EI7 A;  5FT6 A;  1VJO A;  1M7Y A;  2QA3 A;  3G8M A;  2BKW A;  3LG0 A;  1GC0 A;  2VMW A;  3MC6 C;  1AX4 A;  5HHY A;  2HOR A;  4IYO A;  3NX3 A;  2JJG A;  1OHY A;  2CST A;  1RVU A;  2GB3 A;  3BB8 A;  3I4J A;  4A6T A;  3R9A A;  1ASM A;  1DGE A;  3CQ6 A;  1DJE A;  4DBC A;  4CXR A;  2NMP A;  5K8B A;  2VGV A;  3JZL A;  4WYG A;  2VI8 A;  3FFH A;  2EZ1 A;  1VP4 A;  1YAA A;  4ZAS A;  1TOG A;  5E5I A;  3MAU A;  2E7U A;  2JJH A;  5G2P A;  1CZE A;  1G4V A;  2CH1 A;  4MSO A;  1BJ4 A;  3DZZ A;  3USF A;  4F5M A;  4I8A A;  5I92 A;  2YHK A;  4ZWV A;  3QHX A;  2PO3 A;  4RIZ A;  2XBN A;  5BJ3 A;  8AAT A;  2ZUK A;  3JTX A;  3MAF A;  4ADB A;  3BCX A;  4XJO A;  4K2B A;  4U1T A;  1D7U A;  5EUN A;  3AEJ A;  3FVU A;  1D2F A;  4ISY A;  1I41 A;  2CJG A;  4KAM A;  1QJ3 A;  5G4J A;  3GBX A;  4WLH A;  4JE5 A;  1IAY A;  2VMV A;  3PD6 B;  2VMP A;  4F5F A;  1EG5 A;  3BN1 A;  3NYU A;  2Z20 A;  2Z1Z A;  4IXS A;  1XEY A;  4PIW A;  3FSL A;  1JS6 A;  4JF0 A;  1BT4 A;  3FFR A;  4ITX A;  4Y0I A;  1AY5 A;  4B9B A;  3OP7 A;  4MQP A;  5FT8 A;  3KGX A;  4HVK A;  2HUI A;  4LNL A;  5EAV A;  3RCH B;  3AAT A;  2W7M A;  3WGC A;  2BI3 A;  1S09 A;  1TOI A;  1O62 A;  1WST A;  1B9H A;  4RJ0 A;  4L0O A;  3BWN A;  1WYT A;  1AIC A;  4GE4 A;  3LVK A;  5FT5 A;  3JW9 A;  3PPL A;  1KMK A;  3GR9 A;  5EUE A;  2W7J A;  4AZJ A;  3NYS A;  1N2T A;  4M2J A;  1LK9 A;  3EI8 A;  3H7F A;  4P3M A;  1W7L A;  2RFV A;  2E7J A;  1G4X A;  3B1C A;  3L8A A;  4CXQ A;  1TAR A;  4NOG A;  1KL2 A;  2HOX A;  3K40 A;  2W7H A;  3NYT A;  4E77 A;  2F8J A;  2VIA A;  3ASA A;  1MDX A;  2BI5 A;  1YIY A;  1ASL A;  3JWA A;  5HDM A;  2R2N A;  4IX8 A;  2DKJ A;  1BQD A;  1ART A;  1EQB A;  2AY2 A;  4A6U A;  1AMQ A;  2ZYJ A;  4AH3 A;  4PVF A;  3GZD A;  3GSB A;  3NRA A;  4FFC A;  2HOZ A;  4N0B A;  2YCP A;  3F6T A;  2AEV A;  2EZ2 A;  4CVQ A;  3G0T A;  1C9C A;  4F5I A;  3JWB A;  1GBN A;  3CBF A;  1S06 A;  1SZK A;  2AY9 A;  1ASG A;  4Q76 A;  4TMR A;  1OXO A;  2C44 A;  2VI9 A;  2HUF A;  3A8U X;  2VLF A;  1MAP A;  3UWC A;  3E2Z A;  4XJL A;  4RJY A;  3EZ1 A;  2DR1 A;  4WB0 B;  5JAY A;  5IWQ A;  2CAN A;  1S0A A;  2JGT A;  3AEO A;  1AY8 A;  1SFF A;  1AMR A;  1IJI A;  3FDB A;  2VMZ A;  3FDD A;  2FQ6 A;  3HMU A;  3FCR A;  1T3I A;  2BIA A;  1AJS A;  4MY5 A;  4EU1 A;  1V2D A;  1WKG A;  3WLX A;  2FM1 A;  3DXV A;  7AAT A;  1DFO A;  1QZ9 A;  3EI6 A;  2YOB A;  2HOY A;  4GE7 A;  2D61 A;  5G0A A;  4QGR A;  1AAW A;  3CQ4 A;  3HVY A;  2AY7 A;  4IXZ A;  5EAA A;  4MKJ A;  3PDB B;  9AAT A;  2VLH A;  2DGM A;  2XH1 A;  1ELU A;  2JIS A;  2GQN A;  2VMQ A;  1SF2 A;  5DJ9 A;  1AHY A;  3N5M A;  5F9S A;  1MDO A;  1X0M A;  4BMK A;  1AMA A;  3DXW A;  3ACZ A;  4R5Z A;  2ZY2 A;  1MAQ A;  3DC1 A;  1JF9 A;  4HF8 A;  5AX8 A;  3T32 A;  1ASB A;  2R0T A;  1OHW A;  4E3Q A;  1GC2 A;  5E4Z A;  1YJY A;  1ARH A;  2QLR A;  2VGU A;  3COG A;  4F5H A;  2HP2 A;  1ASD A;  4A0R A;  1CQ7 A;  3DU4 A;  1QIR A;  1LC8 A;  3PIU A;  5C6U A;  2VGS A;  1AIB A;  1V72 A;  1MLZ A;  2QB3 A;  4P7Y A;  1G7X A;  1ASC A;  1JS3 A;  1W23 A;  3LWS A;  2FNI A;  4Y0D A;  1C4K A;  4WP0 A;  2YRI A;  2W7K A;  3EI5 A;  2ZY3 A;  2GMU A;  4IXO A;  1TAT A;  5F8V A;  2W7E A;  4BHD A;  4MQR A;  1X28 A;  3HQT A;  3A9X A;  1B8G A;  1M4N A;  1OAT A;  1BJN A;  1UU2 A;  1H0C A;  4ZLV A;  2WK7 A;  4Q31 A;  3MKJ A;  3MAD A;  3BCA A;  4WXG A;  3WGB A;  4U2H A;  2JJF A;  3TCM A;  3EIA A;  1X29 A;  3QPG A;  3II0 A;  1AHG A;  4O6Z A;  4OTL A;  3WCO A;  4BA5 A;  3DRD A;  1YNU A;  3TFT A;  2Z1Y A;  2OGE A;  4UHN A;  3P1T A;  3IHJ A;  2CH2 A;  1BQA A;  1I43 A;  3EIB A;  3VP6 A;  1D7R A;  4LC3 A;  3PGY A;  2HUU A;  4F5L A;  2Z61 A;  3GET A;  2BWP A;  2QMA A;  3LY1 A;  4IW7 A;  3HDO A;  4LW4 A;  4EB7 A;  2AAT A;  3ATH A;  3WY7 A;  3VK4 A;  4IY7 A;  2JG2 A;  2AY6 A;  2BIG A;  4W91 A;  1ZOD A;  1AMS A;  4F5K A;  4MKK A;  1WKH A;  4TN4 A;  2OAT A;  2VMY A;  1ASE A;  4WYE A;  1KKJ A;  4J8L A;  1GD9 A;  3NU8 A;  1IX8 A;  4GE9 A;  2DGL A;  1DJ9 A;  4W8I A;  1J04 A;  2WK8 A;  4WYD A;  2W8J A;  3RBL A;  1C7O A;  3NNK A;  4ZWM A;  1AHX A;  4ADD A;  4UOY A;  2DKB A;  3A9Z A;  4ZSW A;  1AJR A;  2ZY4 A;  3NDN A;  2QBT A;  3NU7 A;  4Q75 A;  3ZRR A;  3HT4 A;  5G2Q A;  1KKP A;  3BC8 A;  4H51 A;  2D64 A;  4WXB A;  1SZS A;  2D65 A;  5G4I A;  4CBS A;  2Z67 A;  2D5Y A;  4FL0 A;  4R5F A;  3RQ1 A;  2TPL A;  2AY8 A;  2YKX A;  3DR4 A;  4AO9 A;  1B5P A;  2WKA A;  3HBX A;  4A6R A;  4ATP A;  1CS1 A;  1EJI A;  2D7Y A;  5M46 A;  1X2A A;  1N31 A;  1AHE A;  3AEP A;  1DJU A;  4ZM3 A;  4JEW A;  5BJ4 A;  3IF2 A;  2X5D A;  4W1X A;  1IX7 A;  5EIG B;  1G7W A;  3ECD A;  3BWO A;  4WYC A;  2GSA A;  2EGY A;  3VAX A;  5M49 A;  1Y4I A;  1RV3 A;  1CQ8 A;  1D7S A;  1B5O A;  2Z9U A;  3BWN C;  5DX5 A;  1PG8 A;  1W7M A;  3AEM A;  3VK3 A;  1CL1 A;  4N0W A;  3FVX A;  5LH9 A;  3NUI A;  4XJM A;  2Z9X A;  2C81 A;  2Z9V A;  4JE5 D;  1IUG A;  2BYJ A;  4XJP A;  3BCB A;  1M0Q A;  2PB0 A;  1V2F A;  4UHO A;  3ZRP A;  2VYC A;  5DJ1 A;  4UHM A;  4LW2 A;  1H1C A;  2OGA A;  4WXF A;  2FYF A;  4BA4 A;  1GEW A;  3RCH A;  1M0O A;  2DOU A;  5HXX A;  2O1B A;  2CFB A;  4A72 A;  1O4S A;  3ELE A;  1ORD A;  1O61 A;  1IX6 A;  1PMO A;  2QB2 A;  2C0R A;  3UAK A;  2Z9W A;  1MDZ A;  2VMN A;  3FZ6 A;  4Q6R A;  3H14 A;  3UE8 A;  3W1I A;  5M4D A;  1ZC9 A;  1LC7 A;  3KGW A;  3F9T A;  2W7I A;  1DKA A;  2CJD A;  4OBU A;  4XAU A;  3VK2 A;  1BW0 A;  1IAX A;  4B98 A;  1QIS A;  4OMA A;  3ZZJ A;  3TFU A;  2D7Z A;  1V2E A;  3FQA A;  3RUY A;  2V1P A;  1VEF A;  1U08 A;  4M2K A;  2W8U A;  3A2B A;  2YCN A;  1W3U A;  3FQ8 A;  1AY4 A;  5M4B A;  5TF5 A;  1GEY A;  1PMM A;  1W7N A;  2VGT A;  4A00 A;  4K2I A;  3FTB A;  2W8V A;  3OKS A;  4F5G A;  3AOW A;  1C0N A;  4F4E A;  3E2Y A;  3PDX A;  4XEW A;  3B1E A;  2E7I A;  1WYV A;  4WYF A;  2X5F A;  4BQ0 A;  1IBJ A;  4IYO B;  4J5U A;  4A0H A;  4DGT A;  3WX9 A;  4M2M A;  4WB0 A;  2D63 A;  4KXK A;  4PFN A;  1LS3 A;  2C7T A;  3K7Y A;  1M0P A;  3FKD A;  2VMR A;  1WYU A;  3I5T A;  2ZP7 A;  1CL2 A;  4GSA A;  3WKR A;  3N75 A;  3AEN A;  4JEX A;  2R5C A;  4F5J A;  1J32 A;  3NUB A;  1ASN A;  2EPJ A;  3QGU A;  1CQ6 A;  1YIZ A;  2BI9 A;  1C7N A;  3NTJ A;  4AZK A;  3MC6 A;  1D7V A;  3AEL A;  3G7Q A;  3M5U A;  4RKD A;  2FNU A;  3N0L A;  2YRR A;  2V0Y A;  2ZJG A;  4XQ2 A;  1AIA A;  2W7F A;  1GDE A;  2VGW A;  4UQV A;  4ZDL A;  1BJO A;  3MBB A;  3K28 A;  1S07 A;  4KYO A;  4EB5 A;  1GCK A;  1Z7D A;  3DYD A;  3MAF B;  1UU0 A;  1SVV A;  1Z3Z A;  1KL1 A;  1BS0 A;  2FN6 A;  1QGN A;  2BI1 A;  2ZSL A;  1QJ5 A;  3E77 A;  4W1W A;  4JEZ A;  4AO4 A;  2VMS A;  3GZC A;  3PJ0 A;  2BWO A;  2HP1 A;  4ADC A;  1JG8 A;  1TOK A;  1UKJ A;  4ZDO A;  1TOJ A;  1ARG A;  2AEU A;  3B46 A;  3MEB A;  3WCN A;  1N8P A;  3E2F A;  3QI6 A;  3AV7 A;  1AHF A;  1ASA A;  1TAS A;  2BHX A;  1P3W A;  2ZSM A;  1LKC A;  4JEV A;  2VMU A;  4JEY A;  2AY5 A;  2R5E A;  4LNM A;  4OYT A;  2ZC0 A;  1ARI A;  3QBO A;  4R2N A;  1WYT B;  4ITG A;  2OKJ A;  1LC5 A;  3AOV A;  4AOA A;  5D5S A;  2YCT A;  3ELP A;  2ZY5 A;  1TOE A;  1ELQ A;  2VIB A;  5J8Q A;  2BIE A;  1SZU A;  2CB1 A;  1GEX A;  1S08 A;  2G6W A;  3D6K A;  1LW4 A;  1MGV A;  5G09 A;  2VMX A;  2VGZ A;  2YKV A;  4GDY A;  3TAT A;  1ECX A;  2YKY A;  3WZF A;  2CY8 A;  4CBR A;  3AEJ C;  2W7G A;  1B9I A;  3W1J A;  4RIT A;  4LNJ A;  1E5F A;  3VOM A;  2HZP A;  2W7D A;  3ZZK A;  1RVY A;  4TV7 A;  4RKC A;  2BWN A;  5DB5 A;  1AKC A;  2AY1 A;  2CJH A;  1AAM A;  1OXP A;  3A9Y A;  2DGK A;  1RV4 A;  3LVL B;  2W8W A;  4EFF A;  3ASB A;  3TQX A;  5D95 A;  3E2Z B;  5FT4 A;  5E3K A;  1M32 A;  3CAI A;  4E1O A;  2WK9 A;  3FQ7 A;  1C7G A;  1GC4 A;  2W8T A;  4RAE A;  1M6S A;  1AKA A;  4A0F A;  4ZM4 A;  3PD6 A;  1FC4 A;  3FD0 A;  1MLY A;  1CZC A;  1AJS B;  1AKB A;  3E6G A;  3I16 A;  1BJW A;  2O7C A;  4RLG A;  2X3L A;  3EI9 A;  4K2M A;  3EZS A;  1DGD A;  4WD2 A;  4E3R A;  2Q7W A;  1GC3 A;  1PFF A;  3B1D A;  3LV2 A;  4EMY A;  4WLJ A;  4ADE A;  3RBF A;  3L44 A;  3KE3 A;  1YJS A;  3GZD C;  3LVM A;  2VMO A;  2AY3 A;  4WBT A;  4OC9 A;  4R8D A;  3AEM C;  2JJE A;  2YKU A;  3GJU A;  1YOO A;  4RM1 A;  1ZOB A;  4XK1 A;  1WYV B;  1DTY A;  5EIG A;  3WKS A;  2GMS A;  4DQ6 A;  1UU1 A;  3FRK A;  5EFS A;  2EH6 A;  2OQX A;  5EQC A;  3QN6 A;  2OKK A;  4W1V A;  1QIT A;  4ATQ A;  3FVS A;  1B4X A;  2AY4 A;  1FG3 A;  1WYU B;  3JU7 A;  2PB2 A;  2W7L A;  3PAA A;  3Q8N A;  1ASF A;  1I29 A;  2E54 A;  3AEN B;  2R5C B; 
#chains in the Genus database with same CATH topology
 1FG7 A;  3EUC A;  3FZ8 A;  3GWP A;  1YJZ A;  4GRX A;  2ORD A;  1M0N A;  2G7J A;  2CTZ A;  3BS8 A;  4OT8 A;  2X8U A;  2EO5 A;  3DR7 A;  4ZSY A;  3DOD A;  3QM2 A;  1BKG A;  4WYA A;  3LVJ A;  3HLM A;  1I48 A;  2D66 A;  3BV0 A;  3R4T A;  4A0G A;  1BJO B;  2BYL A;  3PA9 A;  1IVR A;  4GEB A;  4MGR A;  4OCA A;  5EUD A;  3FZ7 A;  4ZAH A;  2VMT A;  1O69 A;  3W1H A;  1OHV A;  3RI6 A;  4MQQ A;  5LHA A;  2BI2 A;  3ZRQ A;  1E5E A;  3B8X A;  4PFF A;  1KMJ A;  1ARS A;  4OBV A;  3KKI A;  3PDB A;  3HL2 A;  3E9K A;  4ZDP A;  1TPL A;  1CJ0 A;  1XI9 A;  1SPA A;  4JF1 A;  4Y0H A;  2WB6 A;  3F0H A;  2O0R A;  4W5K A;  1LW5 A;  3CQ5 A;  2CIN A;  3P6K A;  3ISL A;  3EI7 A;  5FT6 A;  1VJO A;  1M7Y A;  2QA3 A;  3G8M A;  2BKW A;  3LG0 A;  1GC0 A;  2VMW A;  3MC6 C;  1AX4 A;  5HHY A;  2HOR A;  4IYO A;  3NX3 A;  2JJG A;  1OHY A;  2CST A;  1RVU A;  2GB3 A;  3BB8 A;  3I4J A;  4A6T A;  3R9A A;  1ASM A;  1DGE A;  3CQ6 A;  1DJE A;  4DBC A;  4CXR A;  2NMP A;  5K8B A;  2VGV A;  3JZL A;  4WYG A;  2VI8 A;  3FFH A;  2EZ1 A;  1VP4 A;  1YAA A;  4ZAS A;  1TOG A;  5E5I A;  3MAU A;  2E7U A;  2JJH A;  5G2P A;  1CZE A;  1G4V A;  2CH1 A;  4MSO A;  1BJ4 A;  3DZZ A;  3USF A;  4F5M A;  4I8A A;  5I92 A;  2YHK A;  4ZWV A;  3QHX A;  2PO3 A;  4RIZ A;  2XBN A;  5BJ3 A;  8AAT A;  2ZUK A;  3JTX A;  3MAF A;  4ADB A;  3BCX A;  4XJO A;  4K2B A;  4U1T A;  1D7U A;  5EUN A;  3AEJ A;  3FVU A;  1D2F A;  4ISY A;  1I41 A;  2CJG A;  4KAM A;  1QJ3 A;  5G4J A;  3GBX A;  4WLH A;  4JE5 A;  1IAY A;  2VMV A;  3PD6 B;  2VMP A;  4F5F A;  1EG5 A;  3BN1 A;  3NYU A;  2Z20 A;  2Z1Z A;  4IXS A;  1XEY A;  4PIW A;  3FSL A;  1JS6 A;  4JF0 A;  1BT4 A;  3FFR A;  4ITX A;  4Y0I A;  1AY5 A;  4B9B A;  3OP7 A;  4MQP A;  5FT8 A;  3KGX A;  4HVK A;  2HUI A;  4LNL A;  5EAV A;  3RCH B;  3AAT A;  2W7M A;  3WGC A;  2BI3 A;  1S09 A;  1TOI A;  1O62 A;  1WST A;  1B9H A;  4RJ0 A;  4L0O A;  3BWN A;  1WYT A;  1AIC A;  4GE4 A;  3LVK A;  5FT5 A;  3JW9 A;  3PPL A;  1KMK A;  3GR9 A;  5EUE A;  2W7J A;  4AZJ A;  3NYS A;  1N2T A;  4M2J A;  1LK9 A;  3EI8 A;  3H7F A;  4P3M A;  1W7L A;  2RFV A;  2E7J A;  1G4X A;  3B1C A;  3L8A A;  4CXQ A;  2A1V A;  1TAR A;  4NOG A;  1KL2 A;  2HOX A;  3K40 A;  2W7H A;  3NYT A;  4E77 A;  2F8J A;  2VIA A;  3ASA A;  3N7N A;  1MDX A;  2BI5 A;  1YIY A;  1ASL A;  3JWA A;  5HDM A;  2R2N A;  4IX8 A;  2DKJ A;  1BQD A;  1ART A;  1EQB A;  2AY2 A;  4A6U A;  1AMQ A;  2ZYJ A;  4AH3 A;  4PVF A;  3GZD A;  3GSB A;  3NRA A;  4FFC A;  2HOZ A;  4N0B A;  2YCP A;  3F6T A;  2AEV A;  2EZ2 A;  4CVQ A;  3G0T A;  1C9C A;  4F5I A;  3JWB A;  1GBN A;  3CBF A;  1S06 A;  1SZK A;  2AY9 A;  1ASG A;  4Q76 A;  4TMR A;  1OXO A;  2C44 A;  2VI9 A;  2HUF A;  3A8U X;  2VLF A;  1MAP A;  3UWC A;  3E2Z A;  4XJL A;  4RJY A;  3EZ1 A;  2DR1 A;  4WB0 B;  5JAY A;  5IWQ A;  2CAN A;  1S0A A;  2JGT A;  3AEO A;  1AY8 A;  1SFF A;  1AMR A;  1IJI A;  3FDB A;  2VMZ A;  3FDD A;  2FQ6 A;  3HMU A;  3FCR A;  1T3I A;  2KFP A;  2BIA A;  1AJS A;  4MY5 A;  4EU1 A;  1V2D A;  1WKG A;  3WLX A;  2FM1 A;  3DXV A;  7AAT A;  1DFO A;  1QZ9 A;  3EI6 A;  2YOB A;  2HOY A;  4GE7 A;  2D61 A;  5G0A A;  4QGR A;  1AAW A;  3CQ4 A;  3HVY A;  2AY7 A;  4IXZ A;  5EAA A;  4MKJ A;  3PDB B;  9AAT A;  2VLH A;  2DGM A;  2XH1 A;  1ELU A;  2JIS A;  2GQN A;  2VMQ A;  1SF2 A;  5DJ9 A;  1AHY A;  3N5M A;  5F9S A;  1MDO A;  1X0M A;  4BMK A;  1AMA A;  3DXW A;  3ACZ A;  4R5Z A;  2ZY2 A;  1MAQ A;  3DC1 A;  1JF9 A;  4HF8 A;  5AX8 A;  3T32 A;  1ASB A;  2R0T A;  1OHW A;  4E3Q A;  1GC2 A;  5E4Z A;  1YJY A;  1ARH A;  2QLR A;  2VGU A;  3COG A;  4F5H A;  2HP2 A;  1ASD A;  4A0R A;  1CQ7 A;  3DU4 A;  1QIR A;  1LC8 A;  3PIU A;  5C6U A;  2VGS A;  1AIB A;  1V72 A;  1MLZ A;  2QB3 A;  4P7Y A;  1G7X A;  1ASC A;  1JS3 A;  1W23 A;  3LWS A;  2FNI A;  4Y0D A;  1C4K A;  4WP0 A;  2YRI A;  2W7K A;  3EI5 A;  2ZY3 A;  2GMU A;  4IXO A;  1TAT A;  5F8V A;  2W7E A;  4BHD A;  4MQR A;  1X28 A;  3HQT A;  3A9X A;  1B8G A;  1M4N A;  3N4X A;  1OAT A;  1BJN A;  1UU2 A;  1H0C A;  4ZLV A;  2WK7 A;  4Q31 A;  3MKJ A;  3MAD A;  3BCA A;  4WXG A;  3WGB A;  4U2H A;  2JJF A;  3TCM A;  3EIA A;  1X29 A;  3QPG A;  3II0 A;  1AHG A;  4O6Z A;  4OTL A;  3WCO A;  4BA5 A;  2FKI A;  3DRD A;  1YNU A;  3TFT A;  2Z1Y A;  2OGE A;  4UHN A;  3P1T A;  3IHJ A;  2CH2 A;  1BQA A;  1I43 A;  3EIB A;  3VP6 A;  1D7R A;  4LC3 A;  3PGY A;  2HUU A;  4F5L A;  2Z61 A;  3GET A;  2BWP A;  2QMA A;  3LY1 A;  4IW7 A;  3HDO A;  4LW4 A;  4EB7 A;  2AAT A;  3ATH A;  3WY7 A;  3VK4 A;  4IY7 A;  2EYQ A;  2JG2 A;  2AY6 A;  2BIG A;  4W91 A;  1ZOD A;  1AMS A;  4F5K A;  4MKK A;  1WKH A;  4TN4 A;  2OAT A;  2VMY A;  1ASE A;  4WYE A;  1KKJ A;  4J8L A;  1GD9 A;  3NU8 A;  1IX8 A;  4GE9 A;  2DGL A;  1DJ9 A;  4W8I A;  1J04 A;  2WK8 A;  4WYD A;  2W8J A;  3RBL A;  1C7O A;  3NNK A;  4ZWM A;  1AHX A;  4ADD A;  4UOY A;  2DKB A;  3A9Z A;  4ZSW A;  1AJR A;  2ZY4 A;  3NDN A;  2QBT A;  3NU7 A;  4Q75 A;  3ZRR A;  3HT4 A;  5G2Q A;  1KKP A;  3BC8 A;  4H51 A;  2D64 A;  4WXB A;  1SZS A;  2D65 A;  5G4I A;  4CBS A;  2Z67 A;  2D5Y A;  4FL0 A;  4R5F A;  3RQ1 A;  2TPL A;  2AY8 A;  2YKX A;  3DR4 A;  4AO9 A;  1B5P A;  2WKA A;  3HBX A;  4A6R A;  4K05 A;  4ATP A;  1CS1 A;  1EJI A;  2D7Y A;  5M46 A;  1X2A A;  1N31 A;  1AHE A;  3AEP A;  1DJU A;  4ZM3 A;  4JEW A;  5BJ4 A;  3IF2 A;  2X5D A;  4W1X A;  1IX7 A;  5EIG B;  1G7W A;  3ECD A;  3BWO A;  4WYC A;  2GSA A;  2EGY A;  3VAX A;  5M49 A;  1Y4I A;  1RV3 A;  1CQ8 A;  1D7S A;  3N4R A;  1B5O A;  2Z9U A;  3BWN C;  5DX5 A;  1PG8 A;  1W7M A;  3AEM A;  3VK3 A;  1CL1 A;  4N0W A;  3FVX A;  5LH9 A;  3NUI A;  4XJM A;  2Z9X A;  2C81 A;  2Z9V A;  4JE5 D;  1IUG A;  2BYJ A;  4XJP A;  3BCB A;  1M0Q A;  2PB0 A;  1V2F A;  4UHO A;  3ZRP A;  2VYC A;  5DJ1 A;  4UHM A;  4LW2 A;  1H1C A;  2OGA A;  4WXF A;  2FYF A;  4BA4 A;  1GEW A;  3RCH A;  1M0O A;  2DOU A;  5HXX A;  2O1B A;  2CFB A;  4A72 A;  1O4S A;  3ELE A;  1ORD A;  1O61 A;  1IX6 A;  1PMO A;  2QB2 A;  2C0R A;  3UAK A;  2Z9W A;  1MDZ A;  2VMN A;  3FZ6 A;  4Q6R A;  3H14 A;  3UE8 A;  3W1I A;  5M4D A;  1ZC9 A;  1LC7 A;  3KGW A;  3F9T A;  2W7I A;  1DKA A;  2CJD A;  4OBU A;  4XAU A;  3VK2 A;  1BW0 A;  1IAX A;  4B98 A;  1QIS A;  4OMA A;  3ZZJ A;  3TFU A;  2D7Z A;  1V2E A;  3FQA A;  3RUY A;  2V1P A;  1VEF A;  1U08 A;  4M2K A;  2W8U A;  3A2B A;  2YCN A;  1W3U A;  3FQ8 A;  1AY4 A;  5M4B A;  5TF5 A;  1GEY A;  1PMM A;  1W7N A;  2VGT A;  4A00 A;  4K2I A;  3FTB A;  2W8V A;  3OKS A;  4F5G A;  3AOW A;  1C0N A;  4F4E A;  3E2Y A;  3PDX A;  4XEW A;  3B1E A;  2E7I A;  1WYV A;  4WYF A;  2X5F A;  4BQ0 A;  1IBJ A;  4IYO B;  4J5U A;  4A0H A;  5KTB A;  4DGT A;  3WX9 A;  4M2M A;  4WB0 A;  2D63 A;  4KXK A;  4PFN A;  1LS3 A;  2C7T A;  3K7Y A;  1M0P A;  3FKD A;  2VMR A;  1WYU A;  3I5T A;  2ZP7 A;  1CL2 A;  4GSA A;  3WKR A;  3N75 A;  3AEN A;  4JEX A;  2R5C A;  4F5J A;  1J32 A;  3NUB A;  1ASN A;  2EPJ A;  3QGU A;  1CQ6 A;  1YIZ A;  2BI9 A;  1C7N A;  3NTJ A;  4AZK A;  3MC6 A;  1D7V A;  3AEL A;  3G7Q A;  3M5U A;  4RKD A;  2FNU A;  3N0L A;  2YRR A;  2V0Y A;  2ZJG A;  4XQ2 A;  1AIA A;  2W7F A;  1GDE A;  2VGW A;  4UQV A;  4ZDL A;  1BJO A;  3MBB A;  3K28 A;  1S07 A;  4KYO A;  4EB5 A;  1GCK A;  1Z7D A;  3DYD A;  3MAF B;  1UU0 A;  1SVV A;  1Z3Z A;  1KL1 A;  1BS0 A;  2FN6 A;  1QGN A;  2BI1 A;  2ZSL A;  1QJ5 A;  3E77 A;  4W1W A;  4JEZ A;  4AO4 A;  2VMS A;  3GZC A;  3PJ0 A;  2BWO A;  2HP1 A;  4ADC A;  1JG8 A;  1TOK A;  1UKJ A;  4ZDO A;  1TOJ A;  1ARG A;  2AEU A;  3B46 A;  3MEB A;  3WCN A;  1N8P A;  3E2F A;  3QI6 A;  3AV7 A;  1AHF A;  1ASA A;  1TAS A;  2BHX A;  1P3W A;  2ZSM A;  1LKC A;  4JEV A;  2VMU A;  4JEY A;  2AY5 A;  2R5E A;  4LNM A;  4OYT A;  2ZC0 A;  3N4S A;  1ARI A;  3QBO A;  4R2N A;  1WYT B;  4ITG A;  2OKJ A;  1LC5 A;  3AOV A;  4AOA A;  5D5S A;  2YCT A;  3ELP A;  2ZY5 A;  1TOE A;  1ELQ A;  2VIB A;  5J8Q A;  2BIE A;  1SZU A;  2CB1 A;  1GEX A;  1S08 A;  2G6W A;  3D6K A;  4H63 Q;  1LW4 A;  1MGV A;  5G09 A;  2VMX A;  2VGZ A;  2YKV A;  4GDY A;  3TAT A;  1ECX A;  2YKY A;  3WZF A;  2CY8 A;  4CBR A;  3AEJ C;  2W7G A;  1B9I A;  3W1J A;  4RIT A;  4LNJ A;  1E5F A;  3VOM A;  3H9X A;  2HZP A;  2W7D A;  3ZZK A;  1RVY A;  4TV7 A;  4RKC A;  2BWN A;  5DB5 A;  1AKC A;  2AY1 A;  1KAF A;  2CJH A;  1AAM A;  1OXP A;  3A9Y A;  2DGK A;  1RV4 A;  3LVL B;  2W8W A;  4EFF A;  3ASB A;  3TQX A;  5D95 A;  3E2Z B;  5FT4 A;  5E3K A;  1M32 A;  3CAI A;  4E1O A;  2WK9 A;  3FQ7 A;  1C7G A;  1GC4 A;  2W8T A;  4RAE A;  1M6S A;  1AKA A;  4A0F A;  4ZM4 A;  3PD6 A;  1FC4 A;  3FD0 A;  1MLY A;  1CZC A;  1AJS B;  1AKB A;  3E6G A;  3I16 A;  1BJW A;  2O7C A;  4RLG A;  2X3L A;  3EI9 A;  4K2M A;  3EZS A;  1DGD A;  4WD2 A;  4E3R A;  2Q7W A;  1GC3 A;  1PFF A;  3B1D A;  3LV2 A;  4EMY A;  4WLJ A;  4ADE A;  3RBF A;  2QSR A;  3L44 A;  3KE3 A;  1YJS A;  3GZD C;  3LVM A;  2VMO A;  2AY3 A;  4WBT A;  4OC9 A;  4R8D A;  3AEM C;  2JJE A;  2YKU A;  3GJU A;  1YOO A;  4RM1 A;  1ZOB A;  4XK1 A;  1WYV B;  1DTY A;  5EIG A;  3WKS A;  2GMS A;  4DQ6 A;  1UU1 A;  3FRK A;  5EFS A;  2EH6 A;  2OQX A;  5EQC A;  3QN6 A;  2OKK A;  4W1V A;  1QIT A;  4ATQ A;  3FVS A;  1B4X A;  2AY4 A;  1FG3 A;  1WYU B;  3JU7 A;  2PB2 A;  2W7L A;  3PAA A;  3Q8N A;  1ASF A;  1I29 A;  2E54 A;  3AEN B;  2R5C B; 
#chains in the Genus database with same CATH homology
 1FG7 A;  3EUC A;  3FZ8 A;  3GWP A;  1YJZ A;  4GRX A;  2ORD A;  1M0N A;  2G7J A;  2CTZ A;  3BS8 A;  4OT8 A;  2X8U A;  2EO5 A;  3DR7 A;  4ZSY A;  3DOD A;  3QM2 A;  1BKG A;  4WYA A;  3LVJ A;  3HLM A;  1I48 A;  2D66 A;  3BV0 A;  3R4T A;  4A0G A;  1BJO B;  2BYL A;  3PA9 A;  1IVR A;  4GEB A;  4MGR A;  4OCA A;  5EUD A;  3FZ7 A;  4ZAH A;  2VMT A;  1O69 A;  3W1H A;  1OHV A;  3RI6 A;  4MQQ A;  5LHA A;  2BI2 A;  3ZRQ A;  1E5E A;  3B8X A;  4PFF A;  1KMJ A;  1ARS A;  4OBV A;  3KKI A;  3PDB A;  3HL2 A;  3E9K A;  4ZDP A;  1TPL A;  1CJ0 A;  1XI9 A;  1SPA A;  4JF1 A;  4Y0H A;  2WB6 A;  3F0H A;  2O0R A;  4W5K A;  1LW5 A;  3CQ5 A;  2CIN A;  3P6K A;  3ISL A;  3EI7 A;  5FT6 A;  1VJO A;  1M7Y A;  2QA3 A;  3G8M A;  2BKW A;  3LG0 A;  1GC0 A;  2VMW A;  3MC6 C;  1AX4 A;  5HHY A;  2HOR A;  4IYO A;  3NX3 A;  2JJG A;  1OHY A;  2CST A;  1RVU A;  2GB3 A;  3BB8 A;  3I4J A;  4A6T A;  3R9A A;  1ASM A;  1DGE A;  3CQ6 A;  1DJE A;  4DBC A;  4CXR A;  2NMP A;  5K8B A;  2VGV A;  3JZL A;  4WYG A;  2VI8 A;  3FFH A;  2EZ1 A;  1VP4 A;  1YAA A;  4ZAS A;  1TOG A;  5E5I A;  3MAU A;  2E7U A;  2JJH A;  5G2P A;  1CZE A;  1G4V A;  2CH1 A;  4MSO A;  1BJ4 A;  3DZZ A;  3USF A;  4F5M A;  4I8A A;  5I92 A;  2YHK A;  4ZWV A;  3QHX A;  2PO3 A;  4RIZ A;  2XBN A;  5BJ3 A;  8AAT A;  2ZUK A;  3JTX A;  3MAF A;  4ADB A;  3BCX A;  4XJO A;  4K2B A;  4U1T A;  1D7U A;  5EUN A;  3AEJ A;  3FVU A;  1D2F A;  4ISY A;  1I41 A;  2CJG A;  4KAM A;  1QJ3 A;  5G4J A;  3GBX A;  4WLH A;  4JE5 A;  1IAY A;  2VMV A;  3PD6 B;  2VMP A;  4F5F A;  1EG5 A;  3BN1 A;  3NYU A;  2Z20 A;  2Z1Z A;  4IXS A;  1XEY A;  4PIW A;  3FSL A;  1JS6 A;  4JF0 A;  1BT4 A;  3FFR A;  4ITX A;  4Y0I A;  1AY5 A;  4B9B A;  3OP7 A;  4MQP A;  5FT8 A;  3KGX A;  4HVK A;  2HUI A;  4LNL A;  5EAV A;  3RCH B;  3AAT A;  2W7M A;  3WGC A;  2BI3 A;  1S09 A;  1TOI A;  1O62 A;  1WST A;  1B9H A;  4RJ0 A;  4L0O A;  3BWN A;  1WYT A;  1AIC A;  4GE4 A;  3LVK A;  5FT5 A;  3JW9 A;  3PPL A;  1KMK A;  3GR9 A;  5EUE A;  2W7J A;  4AZJ A;  3NYS A;  1N2T A;  4M2J A;  1LK9 A;  3EI8 A;  3H7F A;  4P3M A;  1W7L A;  2RFV A;  2E7J A;  1G4X A;  3B1C A;  3L8A A;  4CXQ A;  2A1V A;  1TAR A;  4NOG A;  1KL2 A;  2HOX A;  3K40 A;  2W7H A;  3NYT A;  4E77 A;  2F8J A;  2VIA A;  3ASA A;  3N7N A;  1MDX A;  2BI5 A;  1YIY A;  1ASL A;  3JWA A;  5HDM A;  2R2N A;  4IX8 A;  2DKJ A;  1BQD A;  1ART A;  1EQB A;  2AY2 A;  4A6U A;  1AMQ A;  2ZYJ A;  4AH3 A;  4PVF A;  3GZD A;  3GSB A;  3NRA A;  4FFC A;  2HOZ A;  4N0B A;  2YCP A;  3F6T A;  2AEV A;  2EZ2 A;  4CVQ A;  3G0T A;  1C9C A;  4F5I A;  3JWB A;  1GBN A;  3CBF A;  1S06 A;  1SZK A;  2AY9 A;  1ASG A;  4Q76 A;  4TMR A;  1OXO A;  2C44 A;  2VI9 A;  2HUF A;  3A8U X;  2VLF A;  1MAP A;  3UWC A;  3E2Z A;  4XJL A;  4RJY A;  3EZ1 A;  2DR1 A;  4WB0 B;  5JAY A;  5IWQ A;  2CAN A;  1S0A A;  2JGT A;  3AEO A;  1AY8 A;  1SFF A;  1AMR A;  1IJI A;  3FDB A;  2VMZ A;  3FDD A;  2FQ6 A;  3HMU A;  3FCR A;  1T3I A;  2KFP A;  2BIA A;  1AJS A;  4MY5 A;  4EU1 A;  1V2D A;  1WKG A;  3WLX A;  2FM1 A;  3DXV A;  7AAT A;  1DFO A;  1QZ9 A;  3EI6 A;  2YOB A;  2HOY A;  4GE7 A;  2D61 A;  5G0A A;  4QGR A;  1AAW A;  3CQ4 A;  3HVY A;  2AY7 A;  4IXZ A;  5EAA A;  4MKJ A;  3PDB B;  9AAT A;  2VLH A;  2DGM A;  2XH1 A;  1ELU A;  2JIS A;  2GQN A;  2VMQ A;  1SF2 A;  5DJ9 A;  1AHY A;  3N5M A;  5F9S A;  1MDO A;  1X0M A;  4BMK A;  1AMA A;  3DXW A;  3ACZ A;  4R5Z A;  2ZY2 A;  1MAQ A;  3DC1 A;  1JF9 A;  4HF8 A;  5AX8 A;  3T32 A;  1ASB A;  2R0T A;  1OHW A;  4E3Q A;  1GC2 A;  5E4Z A;  1YJY A;  1ARH A;  2QLR A;  2VGU A;  3COG A;  4F5H A;  2HP2 A;  1ASD A;  4A0R A;  1CQ7 A;  3DU4 A;  1QIR A;  1LC8 A;  3PIU A;  5C6U A;  2VGS A;  1AIB A;  1V72 A;  1MLZ A;  2QB3 A;  4P7Y A;  1G7X A;  1ASC A;  1JS3 A;  1W23 A;  3LWS A;  2FNI A;  4Y0D A;  1C4K A;  4WP0 A;  2YRI A;  2W7K A;  3EI5 A;  2ZY3 A;  2GMU A;  4IXO A;  1TAT A;  5F8V A;  2W7E A;  4BHD A;  4MQR A;  1X28 A;  3HQT A;  3A9X A;  1B8G A;  1M4N A;  3N4X A;  1OAT A;  1BJN A;  1UU2 A;  1H0C A;  4ZLV A;  2WK7 A;  4Q31 A;  3MKJ A;  3MAD A;  3BCA A;  4WXG A;  3WGB A;  4U2H A;  2JJF A;  3TCM A;  3EIA A;  1X29 A;  3QPG A;  3II0 A;  1AHG A;  4O6Z A;  4OTL A;  3WCO A;  4BA5 A;  2FKI A;  3DRD A;  1YNU A;  3TFT A;  2Z1Y A;  2OGE A;  4UHN A;  3P1T A;  3IHJ A;  2CH2 A;  1BQA A;  1I43 A;  3EIB A;  3VP6 A;  1D7R A;  4LC3 A;  3PGY A;  2HUU A;  4F5L A;  2Z61 A;  3GET A;  2BWP A;  2QMA A;  3LY1 A;  4IW7 A;  3HDO A;  4LW4 A;  4EB7 A;  2AAT A;  3ATH A;  3WY7 A;  3VK4 A;  4IY7 A;  2EYQ A;  2JG2 A;  2AY6 A;  2BIG A;  4W91 A;  1ZOD A;  1AMS A;  4F5K A;  4MKK A;  1WKH A;  4TN4 A;  2OAT A;  2VMY A;  1ASE A;  4WYE A;  1KKJ A;  4J8L A;  1GD9 A;  3NU8 A;  1IX8 A;  4GE9 A;  2DGL A;  1DJ9 A;  4W8I A;  1J04 A;  2WK8 A;  4WYD A;  2W8J A;  3RBL A;  1C7O A;  3NNK A;  4ZWM A;  1AHX A;  4ADD A;  4UOY A;  2DKB A;  3A9Z A;  4ZSW A;  1AJR A;  2ZY4 A;  3NDN A;  2QBT A;  3NU7 A;  4Q75 A;  3ZRR A;  3HT4 A;  5G2Q A;  1KKP A;  3BC8 A;  4H51 A;  2D64 A;  4WXB A;  1SZS A;  2D65 A;  5G4I A;  4CBS A;  2Z67 A;  2D5Y A;  4FL0 A;  4R5F A;  3RQ1 A;  2TPL A;  2AY8 A;  2YKX A;  3DR4 A;  4AO9 A;  1B5P A;  2WKA A;  3HBX A;  4A6R A;  4K05 A;  4ATP A;  1CS1 A;  1EJI A;  2D7Y A;  5M46 A;  1X2A A;  1N31 A;  1AHE A;  3AEP A;  1DJU A;  4ZM3 A;  4JEW A;  5BJ4 A;  3IF2 A;  2X5D A;  4W1X A;  1IX7 A;  5EIG B;  1G7W A;  3ECD A;  3BWO A;  4WYC A;  2GSA A;  2EGY A;  3VAX A;  5M49 A;  1Y4I A;  1RV3 A;  1CQ8 A;  1D7S A;  3N4R A;  1B5O A;  2Z9U A;  3BWN C;  5DX5 A;  1PG8 A;  1W7M A;  3AEM A;  3VK3 A;  1CL1 A;  4N0W A;  3FVX A;  5LH9 A;  3NUI A;  4XJM A;  2Z9X A;  2C81 A;  2Z9V A;  4JE5 D;  1IUG A;  2BYJ A;  4XJP A;  3BCB A;  1M0Q A;  2PB0 A;  1V2F A;  4UHO A;  3ZRP A;  2VYC A;  5DJ1 A;  4UHM A;  4LW2 A;  1H1C A;  2OGA A;  4WXF A;  2FYF A;  4BA4 A;  1GEW A;  3RCH A;  1M0O A;  2DOU A;  5HXX A;  2O1B A;  2CFB A;  4A72 A;  1O4S A;  3ELE A;  1ORD A;  1O61 A;  1IX6 A;  1PMO A;  2QB2 A;  2C0R A;  3UAK A;  2Z9W A;  1MDZ A;  2VMN A;  3FZ6 A;  4Q6R A;  3H14 A;  3UE8 A;  3W1I A;  5M4D A;  1ZC9 A;  1LC7 A;  3KGW A;  3F9T A;  2W7I A;  1DKA A;  2CJD A;  4OBU A;  4XAU A;  3VK2 A;  1BW0 A;  1IAX A;  4B98 A;  1QIS A;  4OMA A;  3ZZJ A;  3TFU A;  2D7Z A;  1V2E A;  3FQA A;  3RUY A;  2V1P A;  1VEF A;  1U08 A;  4M2K A;  2W8U A;  3A2B A;  2YCN A;  1W3U A;  3FQ8 A;  1AY4 A;  5M4B A;  5TF5 A;  1GEY A;  1PMM A;  1W7N A;  2VGT A;  4A00 A;  4K2I A;  3FTB A;  2W8V A;  3OKS A;  4F5G A;  3AOW A;  1C0N A;  4F4E A;  3E2Y A;  3PDX A;  4XEW A;  3B1E A;  2E7I A;  1WYV A;  4WYF A;  2X5F A;  4BQ0 A;  1IBJ A;  4IYO B;  4J5U A;  4A0H A;  5KTB A;  4DGT A;  3WX9 A;  4M2M A;  4WB0 A;  2D63 A;  4KXK A;  4PFN A;  1LS3 A;  2C7T A;  3K7Y A;  1M0P A;  3FKD A;  2VMR A;  1WYU A;  3I5T A;  2ZP7 A;  1CL2 A;  4GSA A;  3WKR A;  3N75 A;  3AEN A;  4JEX A;  2R5C A;  4F5J A;  1J32 A;  3NUB A;  1ASN A;  2EPJ A;  3QGU A;  1CQ6 A;  1YIZ A;  2BI9 A;  1C7N A;  3NTJ A;  4AZK A;  3MC6 A;  1D7V A;  3AEL A;  3G7Q A;  3M5U A;  4RKD A;  2FNU A;  3N0L A;  2YRR A;  2V0Y A;  2ZJG A;  4XQ2 A;  1AIA A;  2W7F A;  1GDE A;  2VGW A;  4UQV A;  4ZDL A;  1BJO A;  3MBB A;  3K28 A;  1S07 A;  4KYO A;  4EB5 A;  1GCK A;  1Z7D A;  3DYD A;  3MAF B;  1UU0 A;  1SVV A;  1Z3Z A;  1KL1 A;  1BS0 A;  2FN6 A;  1QGN A;  2BI1 A;  2ZSL A;  1QJ5 A;  3E77 A;  4W1W A;  4JEZ A;  4AO4 A;  2VMS A;  3GZC A;  3PJ0 A;  2BWO A;  2HP1 A;  4ADC A;  1JG8 A;  1TOK A;  1UKJ A;  4ZDO A;  1TOJ A;  1ARG A;  2AEU A;  3B46 A;  3MEB A;  3WCN A;  1N8P A;  3E2F A;  3QI6 A;  3AV7 A;  1AHF A;  1ASA A;  1TAS A;  2BHX A;  1P3W A;  2ZSM A;  1LKC A;  4JEV A;  2VMU A;  4JEY A;  2AY5 A;  2R5E A;  4LNM A;  4OYT A;  2ZC0 A;  3N4S A;  1ARI A;  3QBO A;  4R2N A;  1WYT B;  4ITG A;  2OKJ A;  1LC5 A;  3AOV A;  4AOA A;  5D5S A;  2YCT A;  3ELP A;  2ZY5 A;  1TOE A;  1ELQ A;  2VIB A;  5J8Q A;  2BIE A;  1SZU A;  2CB1 A;  1GEX A;  1S08 A;  2G6W A;  3D6K A;  4H63 Q;  1LW4 A;  1MGV A;  5G09 A;  2VMX A;  2VGZ A;  2YKV A;  4GDY A;  3TAT A;  1ECX A;  2YKY A;  3WZF A;  2CY8 A;  4CBR A;  3AEJ C;  2W7G A;  1B9I A;  3W1J A;  4RIT A;  4LNJ A;  1E5F A;  3VOM A;  3H9X A;  2HZP A;  2W7D A;  3ZZK A;  1RVY A;  4TV7 A;  4RKC A;  2BWN A;  5DB5 A;  1AKC A;  2AY1 A;  2CJH A;  1AAM A;  1OXP A;  3A9Y A;  2DGK A;  1RV4 A;  3LVL B;  2W8W A;  4EFF A;  3ASB A;  3TQX A;  5D95 A;  3E2Z B;  5FT4 A;  5E3K A;  1M32 A;  3CAI A;  4E1O A;  2WK9 A;  3FQ7 A;  1C7G A;  1GC4 A;  2W8T A;  4RAE A;  1M6S A;  1AKA A;  4A0F A;  4ZM4 A;  3PD6 A;  1FC4 A;  3FD0 A;  1MLY A;  1CZC A;  1AJS B;  1AKB A;  3E6G A;  3I16 A;  1BJW A;  2O7C A;  4RLG A;  2X3L A;  3EI9 A;  4K2M A;  3EZS A;  1DGD A;  4WD2 A;  4E3R A;  2Q7W A;  1GC3 A;  1PFF A;  3B1D A;  3LV2 A;  4EMY A;  4WLJ A;  4ADE A;  3RBF A;  2QSR A;  3L44 A;  3KE3 A;  1YJS A;  3GZD C;  3LVM A;  2VMO A;  2AY3 A;  4WBT A;  4OC9 A;  4R8D A;  3AEM C;  2JJE A;  2YKU A;  3GJU A;  1YOO A;  4RM1 A;  1ZOB A;  4XK1 A;  1WYV B;  1DTY A;  5EIG A;  3WKS A;  2GMS A;  4DQ6 A;  1UU1 A;  3FRK A;  5EFS A;  2EH6 A;  2OQX A;  5EQC A;  3QN6 A;  2OKK A;  4W1V A;  1QIT A;  4ATQ A;  3FVS A;  1B4X A;  2AY4 A;  1FG3 A;  1WYU B;  3JU7 A;  2PB2 A;  2W7L A;  3PAA A;  3Q8N A;  1ASF A;  1I29 A;  2E54 A;  3AEN B;  2R5C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...