1C9BB

Crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords ADMLP TATA-BOX DNA CONTAINING IIB RECOGNITION ELEMENT
publication title Structural basis of preinitiation complex assembly on human pol II promoters.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 180
sequence length 180
chains with identical sequence F, J, N, R
ec nomenclature
pdb deposition date 1999-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1c9bB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1c9bB02
3EIKA 5IYCP 1QN6A 2MJ7A 1QN4A 2D0BA 1VTLE 2D0AA 1TGHA 1KY6A 3OC3C 1B9KA 4B0AA 1NGMA 1QN8A 3VN5A 1C9BB 1YTBA 1D3UA 1VOLB 1QNCA 5IYDP 1QN7A 1QTPA 1TBPA 1VOKA 4ROCB 1PZDA 4RODB 1QNBA 1QN9A 1QNAA 2Z8UA 1NH2A 3ASMA 1CDWA 3HS8A 1E42A 1QTSA 2IV9A 1PCZA 2G30A 4WZSD 1MP9A 2D0CA 2IV8A 4ROEB 1VTOA 1QN5A 3H1ZA 1KY7A 1W80A 1KYDA 1KYFA 1NVPA 1QN3A 4PY5A 1QNEA 3HS9A 1TBAB 3OCIA 5IYBP 1AISA 1KYUA 2VJ0A 1YTFA 1RM1A 1R4XA 1JFIC
chains in the Genus database with same CATH superfamily
3EIKA 2XHIA 1QN4A 2D0BA 4QG5A 3RSMA 3D4VA 1TGHA 4EJYA 5BMPA 3OC3C 1B9KA 1NGMA 4DULA 3VN5A 2NOIA 3KTUA 4D7QA 1C4GA 1WJWA 2NOBA 3N89A 3DPTA 1VOKA 4ROCB 1YQMA 1QN9A 5HSHA 3OSTA 1CDWA 1E42A 1QTSA 2FUVA 3TE5A 1PCZA 2I5WA 3OSMA 3H1ZA 1KY7A 1KYDA 1KYFA 2JHNA 1LWWA 2HL8A 2DKDA 2JOIA 5AN4A 2OOYA 2OOXA 1N3AA 3OLPA 1XSZA 3PMGA 2LAEA 1P5DX 1N39A 2VJ0A 1RM1A 1R4XA 2NLVA 2H4LX 1JFIC 2NOEA 1T6AA 3T4NA 1VTLE 2D0AA 1YQKA 1QN8A 2R5XA 2QLVA 3ENCA 4WX8A 1QN7A 2DKCA 2JHJA 4RODB 1WQAA 1M5Q1 1K35A 2Z8UA 3EAYA 3ASMA 2Z0FA 3C04A 1YQRA 2NWVA 2HL9A 1EBMA 3CVTA 2NOLA 2G30A 3I0WA 1Q9UA 2D0CA 2YH5A 1VTOA 3CWAA 3OSEA 4PY5A 2MZ8A 1N3CA 1QNEA 1LWVA 2NOZA 1UT7A 3HS9A 2HKPA 1LXTA 2QR1A 1PCMX 1KFQA 3OH9A 1YTFA 2DKAA 1M3HA 1VKLA 5IYCP 2H5AX 2V8QA 3CWTA 1QN6A 2NVMA 5JN5A 4HJHA 3OH6A 3ENOC 5JMVD 1FN7A 4C7PA 1YTBA 2Y8LA 4EAGA 1HU0A 2JPIA 1VOLB 3RPJA 4EAJA 2YA3A 1UT4A 1QTPA 1TBPA 2ZFDB 3CVSA 3IH7A 1QNBA 1QNAA 1UL7A 4EAIA 2IV9A 1M3QA 3F10A 5KL0A 2Y8QA 4WZSD 1MP9A 1EUVA 4ROEB 4EJZA 2NOFA 3D7QA 1NVPA 2F7LA 4Q11A 3OGDA 2QREA 3OCIA 5BMNA 2NOHA 1AISA 4EALA 4IL8A 2EHBD 2HZMA 1V5SA 1NH2A 3NA5A 3UW2A 2MJ7A 1YQLA 1KY6A 4B0AA 3CWUA 1MPGA 3I0XA 3F0ZA 1P5GX 3KRMA 1PCJX 1C9BB 2QRDA 2QRCA 1D3UA 1QNCA 5IYDP 2FGTA 4CFFA 2FKMX 1PZDA 2O3OA 3ULXA 3DPUA 3CW7A 5EPCA 1J3MA 1LWYA 4TPSA 3HS8A 1TUOA 2HZSA 1JDYA 5F9CA 3TDHA 2IV8A 4D7RA 2PWWA 1KFIA 1QN3A 1PVSA 1KO9A 1W80A 3BKQX 3SNSA 4EAKA 3I3WA 1K2YX 2V9JA 1TBAB 3PDKA 2V92A 5IYBP 3CWSA 4MRQA 1C47A 1DIZA 1KYUA 4I8OA 2FKFA 4WXAA 4BJUA 1QN5A
chains in the Genus database with same CATH topology
3EIKA 2XHIA 1QN4A 2D0BA 1TGHA 4EJYA 3OC3C 1B9KA 1NGMA 4DULA 3VN5A 2NOIA 3KTUA 2NOBA 3N89A 3DPTA 1VOKA 4ROCB 1YQMA 1QN9A 3OSTA 1CDWA 1E42A 1QTSA 2I5WA 1PCZA 3OSMA 3H1ZA 1KY7A 1KYDA 1KYFA 1LWWA 2JOIA 5AN4A 1N3AA 2LAEA 1N39A 2VJ0A 1RM1A 1R4XA 1JFIC 2NOEA 1VTLE 2D0AA 1YQKA 1QN8A 1QN7A 4RODB 2Z8UA 1EBMA 3ASMA 1YQRA 2NOLA 2G30A 3I0WA 2D0CA 1VTOA 2YH5A 4PY5A 2MZ8A 1N3CA 1QNEA 1LWVA 2NOZA 1UT7A 3HS9A 1YTFA 1M3HA 5IYCP 1QN6A 1FN7A 1YTBA 1HU0A 1VOLB 3RPJA 1UT4A 1QTPA 1TBPA 3IH7A 1QNBA 1QNAA 1M3QA 2IV9A 3F10A 4WZSD 1MP9A 4ROEB 4EJZA 2NOFA 1NVPA 4Q11A 3OCIA 2NOHA 1AISA 2HZMA 1NH2A 2MJ7A 1YQLA 1KY6A 4B0AA 3I0XA 3F0ZA 3KRMA 1C9BB 1D3UA 1QNCA 5IYDP 2FGTA 1PZDA 2O3OA 3ULXA 3DPUA 1LWYA 4TPSA 3HS8A 2HZSA 2IV8A 1QN3A 1W80A 1KO9A 3SNSA 1TBAB 5IYBP 1KYUA 4I8OA 1QN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIK A;  5IYC P;  1QN6 A;  2MJ7 A;  1QN4 A;  2D0B A;  1VTL E;  2D0A A;  1TGH A;  1KY6 A;  3OC3 C;  1B9K A;  4B0A A;  1NGM A;  1QN8 A;  3VN5 A;  1C9B B;  1YTB A;  1D3U A;  1VOL B;  1QNC A;  5IYD P;  1QN7 A;  1QTP A;  1TBP A;  1VOK A;  4ROC B;  1PZD A;  4ROD B;  1QNB A;  1QN9 A;  1QNA A;  2Z8U A;  1NH2 A;  3ASM A;  1CDW A;  3HS8 A;  1E42 A;  1QTS A;  2IV9 A;  1PCZ A;  2G30 A;  4WZS D;  1MP9 A;  2D0C A;  2IV8 A;  4ROE B;  1VTO A;  1QN5 A;  3H1Z A;  1KY7 A;  1W80 A;  1KYD A;  1KYF A;  1NVP A;  1QN3 A;  4PY5 A;  1QNE A;  3HS9 A;  1TBA B;  3OCI A;  5IYB P;  1AIS A;  1KYU A;  2VJ0 A;  1YTF A;  1RM1 A;  1R4X A;  1JFI C; 
#chains in the Genus database with same CATH topology
 3EIK A;  2XHI A;  1QN4 A;  2D0B A;  4QG5 A;  3RSM A;  3D4V A;  1TGH A;  4EJY A;  5BMP A;  3OC3 C;  1B9K A;  1NGM A;  4DUL A;  3VN5 A;  2NOI A;  3KTU A;  4D7Q A;  1C4G A;  1WJW A;  2NOB A;  3N89 A;  3DPT A;  1VOK A;  4ROC B;  1YQM A;  1QN9 A;  5HSH A;  3OST A;  1CDW A;  1E42 A;  1QTS A;  2FUV A;  3TE5 A;  1PCZ A;  2I5W A;  3OSM A;  3H1Z A;  1KY7 A;  1KYD A;  1KYF A;  2JHN A;  1LWW A;  2HL8 A;  2DKD A;  2JOI A;  5AN4 A;  2OOY A;  2OOX A;  1N3A A;  3OLP A;  1XSZ A;  3PMG A;  2LAE A;  1P5D X;  1N39 A;  2VJ0 A;  1RM1 A;  1R4X A;  2NLV A;  2H4L X;  1JFI C;  2NOE A;  1T6A A;  3T4N A;  1VTL E;  2D0A A;  1YQK A;  1QN8 A;  2R5X A;  2QLV A;  3ENC A;  4WX8 A;  1QN7 A;  2DKC A;  2JHJ A;  4ROD B;  1WQA A;  1M5Q 1;  1K35 A;  2Z8U A;  3EAY A;  3ASM A;  2Z0F A;  3C04 A;  1YQR A;  2NWV A;  2HL9 A;  1EBM A;  3CVT A;  2NOL A;  2G30 A;  3I0W A;  1Q9U A;  2D0C A;  2YH5 A;  1VTO A;  3CWA A;  3OSE A;  4PY5 A;  2MZ8 A;  1N3C A;  1QNE A;  1LWV A;  2NOZ A;  1UT7 A;  3HS9 A;  2HKP A;  1LXT A;  2QR1 A;  1PCM X;  1KFQ A;  3OH9 A;  1YTF A;  2DKA A;  1M3H A;  1VKL A;  5IYC P;  2H5A X;  2V8Q A;  3CWT A;  1QN6 A;  2NVM A;  5JN5 A;  4HJH A;  3OH6 A;  3ENO C;  5JMV D;  1FN7 A;  4C7P A;  1YTB A;  2Y8L A;  4EAG A;  1HU0 A;  2JPI A;  1VOL B;  3RPJ A;  4EAJ A;  2YA3 A;  1UT4 A;  1QTP A;  1TBP A;  2ZFD B;  3CVS A;  3IH7 A;  1QNB A;  1QNA A;  1UL7 A;  4EAI A;  2IV9 A;  1M3Q A;  3F10 A;  5KL0 A;  2Y8Q A;  4WZS D;  1MP9 A;  1EUV A;  4ROE B;  4EJZ A;  2NOF A;  3D7Q A;  1NVP A;  2F7L A;  4Q11 A;  3OGD A;  2QRE A;  3OCI A;  5BMN A;  2NOH A;  1AIS A;  4EAL A;  4IL8 A;  2EHB D;  2HZM A;  1V5S A;  1NH2 A;  3NA5 A;  3UW2 A;  2MJ7 A;  1YQL A;  1KY6 A;  4B0A A;  3CWU A;  1MPG A;  3I0X A;  3F0Z A;  1P5G X;  3KRM A;  1PCJ X;  1C9B B;  2QRD A;  2QRC A;  1D3U A;  1QNC A;  5IYD P;  2FGT A;  4CFF A;  2FKM X;  1PZD A;  2O3O A;  3ULX A;  3DPU A;  3CW7 A;  5EPC A;  1J3M A;  1LWY A;  4TPS A;  3HS8 A;  1TUO A;  2HZS A;  1JDY A;  5F9C A;  3TDH A;  2IV8 A;  4D7R A;  2PWW A;  1KFI A;  1QN3 A;  1PVS A;  1KO9 A;  1W80 A;  3BKQ X;  3SNS A;  4EAK A;  3I3W A;  1K2Y X;  2V9J A;  1TBA B;  3PDK A;  2V92 A;  5IYB P;  3CWS A;  4MRQ A;  1C47 A;  1DIZ A;  1KYU A;  4I8O A;  2FKF A;  4WXA A;  4BJU A;  1QN5 A; 
#chains in the Genus database with same CATH homology
 3EIK A;  2XHI A;  1QN4 A;  2D0B A;  1TGH A;  4EJY A;  3OC3 C;  1B9K A;  1NGM A;  4DUL A;  3VN5 A;  2NOI A;  3KTU A;  2NOB A;  3N89 A;  3DPT A;  1VOK A;  4ROC B;  1YQM A;  1QN9 A;  3OST A;  1CDW A;  1E42 A;  1QTS A;  2I5W A;  1PCZ A;  3OSM A;  3H1Z A;  1KY7 A;  1KYD A;  1KYF A;  1LWW A;  2JOI A;  5AN4 A;  1N3A A;  2LAE A;  1N39 A;  2VJ0 A;  1RM1 A;  1R4X A;  1JFI C;  2NOE A;  1VTL E;  2D0A A;  1YQK A;  1QN8 A;  1QN7 A;  4ROD B;  2Z8U A;  1EBM A;  3ASM A;  1YQR A;  2NOL A;  2G30 A;  3I0W A;  2D0C A;  1VTO A;  2YH5 A;  4PY5 A;  2MZ8 A;  1N3C A;  1QNE A;  1LWV A;  2NOZ A;  1UT7 A;  3HS9 A;  1YTF A;  1M3H A;  5IYC P;  1QN6 A;  1FN7 A;  1YTB A;  1HU0 A;  1VOL B;  3RPJ A;  1UT4 A;  1QTP A;  1TBP A;  3IH7 A;  1QNB A;  1QNA A;  1M3Q A;  2IV9 A;  3F10 A;  4WZS D;  1MP9 A;  4ROE B;  4EJZ A;  2NOF A;  1NVP A;  4Q11 A;  3OCI A;  2NOH A;  1AIS A;  2HZM A;  1NH2 A;  2MJ7 A;  1YQL A;  1KY6 A;  4B0A A;  3I0X A;  3F0Z A;  3KRM A;  1C9B B;  1D3U A;  1QNC A;  5IYD P;  2FGT A;  1PZD A;  2O3O A;  3ULX A;  3DPU A;  1LWY A;  4TPS A;  3HS8 A;  2HZS A;  2IV8 A;  1QN3 A;  1W80 A;  1KO9 A;  3SNS A;  1TBA B;  5IYB P;  1KYU A;  4I8O A;  1QN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...