1C9BB

Crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
180
structure length
180
Chain Sequence
GSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADMLP TATA-BOX DNA CONTAINING IIB RECOGNITION ELEMENT
publication title Structural basis of preinitiation complex assembly on human pol II promoters.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 38
structure length 180
sequence length 180
chains with identical sequence F, J, N, R
ec nomenclature
pdb deposition date 1999-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1c9bB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1c9bB02
1NGMA 1JFIC 4B0AA 2D0AA 1QN3A 1QNBA 1AISA 2IV8A 1YTBA 2G30A 4PY5A 1PCZA 1QN8A 1QN6A 2VJ0A 1VTOA 4WZSD 1QNAA 5IYBP 1KY6A 1KY7A 1KYUA 1YTFA 1PZDA 1QN7A 1VOKA 1QN5A 5IYDP 4RODB 3HS9A 3OC3C 1QNCA 3ASMA 1NH2A 1VTLE 1QN9A 1NVPA 4ROEB 1QN4A 3HS8A 2IV9A 1W80A 3OCIA 5IYCP 3VN5A 1B9KA 1CDWA 1QTSA 1R4XA 1D3UA 2D0CA 2MJ7A 1KYFA 2Z8UA 1KYDA 1QNEA 2D0BA 1TGHA 1RM1A 1C9BB 1VOLB 1QTPA 1TBPA 1MP9A 3H1ZA 4ROCB 1TBAB 3EIKA 1E42A
chains in the Genus database with same CATH superfamily
2JHJA 1M3QA 3EAYA 5KL0A 1QN3A 1EBMA 4HJHA 4WXAA 3ENCA 4IL8A 1Q9UA 2DKCA 4EAGA 2VJ0A 4CFFA 1K35A 4TPSA 1KY6A 1KY7A 5HSHA 5JMVD 1YTFA 2FGTA 2QLVA 1PCJX 2EHBD 3ASMA 2F7LA 3F10A 1YQLA 4EAIA 2LAEA 2ZFDB 3VN5A 3OSMA 1VKLA 1LXTA 5JN5A 2D0CA 2MJ7A 1KYFA 2H4LX 4D7QA 3CVTA 1TGHA 1VOLB 2Y8QA 3H1ZA 4ROCB 1N3CA 1QN4A 3OGDA 2HL8A 1NGMA 2DKDA 2JPIA 3DPUA 3RSMA 3D4VA 1AISA 1T6AA 2OOXA 2QREA 1PCZA 1LWYA 1PCMX 4C7PA 1PZDA 1QN7A 1VOKA 4WX8A 3OSTA 4RODB 1P5DX 3D7QA 3OC3C 2NOHA 1YQKA 2OOYA 1QN9A 3NA5A 2YH5A 2FUVA 1K2YX 1XSZA 4I8OA 4QG5A 1R4XA 3ENOC 3F0ZA 3I0XA 1D3UA 3CWTA 1M5Q1 5BMPA 1QTPA 2DKAA 1P5GX 1UT4A 1TBAB 1WQAA 4MRQA 3I0WA 3KRMA 1C47A 2HKPA 5EPCA 2NOZA 3TE5A 1YQMA 2V92A 2IV8A 2G30A 4PY5A 3CWUA 2O3OA 1QN8A 3PDKA 1VTOA 1TUOA 2QRDA 2R5XA 2JOIA 1KYUA 5BMNA 4EJYA 1HU0A 5IYDP 3SNSA 1DIZA 2HL9A 3HS9A 1QNCA 4EJZA 2V8QA 1JDYA 3OLPA 2XHIA 2HZSA 3I3WA 3IH7A 1LWVA 1FN7A 2JHNA 3HS8A 1W80A 2PWWA 3CWAA 1B9KA 1CDWA 1WJWA 2I5WA 2Z8UA 1QNEA 2NOIA 2D0BA 2NWVA 2MZ8A 2Z0FA 2NOFA 1TBPA 4Q11A 1MP9A 4EAJA 1QN5A 1E42A 3KTUA 2NVMA 2FKFA 4DULA 4BJUA 4D7RA 2Y8LA 2D0AA 4B0AA 1JFIC 3UW2A 3CW7A 1PVSA 3OSEA 1QNBA 1YTBA 2QR1A 1KO9A 4EAKA 1LWWA 1KFQA 3C04A 2H5AX 1QN6A 4WZSD 3RPJA 3BKQX 5IYBP 3OH6A 1M3HA 1QNAA 2QRCA 3OH9A 2NOBA 1MPGA 1NH2A 3DPTA 4EALA 1VTLE 1NVPA 4ROEB 1V5SA 2IV9A 2V9JA 1YQRA 3OCIA 5IYCP 1N3AA 2NOLA 1J3MA 3T4NA 3CVSA 1QTSA 1C4GA 3N89A 3PMGA 3CWSA 2YA3A 5F9CA 1KYDA 2HZMA 1N39A 2NOEA 1RM1A 1C9BB 1UL7A 3TDHA 1KFIA 3ULXA 2NLVA 1UT7A 2FKMX 1EUVA 5AN4A 3EIKA
chains in the Genus database with same CATH topology
1M3QA 1QN3A 1EBMA 2VJ0A 4TPSA 1KY6A 1KY7A 1YTFA 2FGTA 3ASMA 3F10A 1YQLA 2LAEA 3VN5A 3OSMA 2D0CA 2MJ7A 1KYFA 1TGHA 1VOLB 3H1ZA 4ROCB 1N3CA 1QN4A 1NGMA 3DPUA 1AISA 1PCZA 1LWYA 1PZDA 1QN7A 1VOKA 3OSTA 4RODB 3OC3C 2NOHA 1YQKA 1QN9A 2YH5A 4I8OA 1R4XA 3F0ZA 3I0XA 1D3UA 1QTPA 1UT4A 1TBAB 3I0WA 3KRMA 2NOZA 1YQMA 2IV8A 2G30A 4PY5A 2O3OA 1QN8A 1VTOA 2JOIA 1KYUA 4EJYA 1HU0A 5IYDP 3SNSA 3HS9A 1QNCA 4EJZA 2XHIA 2HZSA 3IH7A 1LWVA 1FN7A 3HS8A 1W80A 1B9KA 1CDWA 2I5WA 2Z8UA 1QNEA 2NOIA 2D0BA 2MZ8A 2NOFA 1TBPA 4Q11A 1MP9A 1QN5A 1E42A 3KTUA 4DULA 1JFIC 4B0AA 2D0AA 1QNBA 1YTBA 1KO9A 1LWWA 1QN6A 4WZSD 3RPJA 1QNAA 5IYBP 1M3HA 2NOBA 1NH2A 3DPTA 1VTLE 1NVPA 4ROEB 2IV9A 1YQRA 3OCIA 5IYCP 1N3AA 2NOLA 1QTSA 3N89A 2NOEA 1N39A 1KYDA 2HZMA 1RM1A 1C9BB 3ULXA 1UT7A 5AN4A 3EIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM A;  1JFI C;  4B0A A;  2D0A A;  1QN3 A;  1QNB A;  1AIS A;  2IV8 A;  1YTB A;  2G30 A;  4PY5 A;  1PCZ A;  1QN8 A;  1QN6 A;  2VJ0 A;  1VTO A;  4WZS D;  1QNA A;  5IYB P;  1KY6 A;  1KY7 A;  1KYU A;  1YTF A;  1PZD A;  1QN7 A;  1VOK A;  1QN5 A;  5IYD P;  4ROD B;  3HS9 A;  3OC3 C;  1QNC A;  3ASM A;  1NH2 A;  1VTL E;  1QN9 A;  1NVP A;  4ROE B;  1QN4 A;  3HS8 A;  2IV9 A;  1W80 A;  3OCI A;  5IYC P;  3VN5 A;  1B9K A;  1CDW A;  1QTS A;  1R4X A;  1D3U A;  2D0C A;  2MJ7 A;  1KYF A;  2Z8U A;  1KYD A;  1QNE A;  2D0B A;  1TGH A;  1RM1 A;  1C9B B;  1VOL B;  1QTP A;  1TBP A;  1MP9 A;  3H1Z A;  4ROC B;  1TBA B;  3EIK A;  1E42 A; 
#chains in the Genus database with same CATH topology
 2JHJ A;  1M3Q A;  3EAY A;  5KL0 A;  1QN3 A;  1EBM A;  4HJH A;  4WXA A;  3ENC A;  4IL8 A;  1Q9U A;  2DKC A;  4EAG A;  2VJ0 A;  4CFF A;  1K35 A;  4TPS A;  1KY6 A;  1KY7 A;  5HSH A;  5JMV D;  1YTF A;  2FGT A;  2QLV A;  1PCJ X;  2EHB D;  3ASM A;  2F7L A;  3F10 A;  1YQL A;  4EAI A;  2LAE A;  2ZFD B;  3VN5 A;  3OSM A;  1VKL A;  1LXT A;  5JN5 A;  2D0C A;  2MJ7 A;  1KYF A;  2H4L X;  4D7Q A;  3CVT A;  1TGH A;  1VOL B;  2Y8Q A;  3H1Z A;  4ROC B;  1N3C A;  1QN4 A;  3OGD A;  2HL8 A;  1NGM A;  2DKD A;  2JPI A;  3DPU A;  3RSM A;  3D4V A;  1AIS A;  1T6A A;  2OOX A;  2QRE A;  1PCZ A;  1LWY A;  1PCM X;  4C7P A;  1PZD A;  1QN7 A;  1VOK A;  4WX8 A;  3OST A;  4ROD B;  1P5D X;  3D7Q A;  3OC3 C;  2NOH A;  1YQK A;  2OOY A;  1QN9 A;  3NA5 A;  2YH5 A;  2FUV A;  1K2Y X;  1XSZ A;  4I8O A;  4QG5 A;  1R4X A;  3ENO C;  3F0Z A;  3I0X A;  1D3U A;  3CWT A;  1M5Q 1;  5BMP A;  1QTP A;  2DKA A;  1P5G X;  1UT4 A;  1TBA B;  1WQA A;  4MRQ A;  3I0W A;  3KRM A;  1C47 A;  2HKP A;  5EPC A;  2NOZ A;  3TE5 A;  1YQM A;  2V92 A;  2IV8 A;  2G30 A;  4PY5 A;  3CWU A;  2O3O A;  1QN8 A;  3PDK A;  1VTO A;  1TUO A;  2QRD A;  2R5X A;  2JOI A;  1KYU A;  5BMN A;  4EJY A;  1HU0 A;  5IYD P;  3SNS A;  1DIZ A;  2HL9 A;  3HS9 A;  1QNC A;  4EJZ A;  2V8Q A;  1JDY A;  3OLP A;  2XHI A;  2HZS A;  3I3W A;  3IH7 A;  1LWV A;  1FN7 A;  2JHN A;  3HS8 A;  1W80 A;  2PWW A;  3CWA A;  1B9K A;  1CDW A;  1WJW A;  2I5W A;  2Z8U A;  1QNE A;  2NOI A;  2D0B A;  2NWV A;  2MZ8 A;  2Z0F A;  2NOF A;  1TBP A;  4Q11 A;  1MP9 A;  4EAJ A;  1QN5 A;  1E42 A;  3KTU A;  2NVM A;  2FKF A;  4DUL A;  4BJU A;  4D7R A;  2Y8L A;  2D0A A;  4B0A A;  1JFI C;  3UW2 A;  3CW7 A;  1PVS A;  3OSE A;  1QNB A;  1YTB A;  2QR1 A;  1KO9 A;  4EAK A;  1LWW A;  1KFQ A;  3C04 A;  2H5A X;  1QN6 A;  4WZS D;  3RPJ A;  3BKQ X;  5IYB P;  3OH6 A;  1M3H A;  1QNA A;  2QRC A;  3OH9 A;  2NOB A;  1MPG A;  1NH2 A;  3DPT A;  4EAL A;  1VTL E;  1NVP A;  4ROE B;  1V5S A;  2IV9 A;  2V9J A;  1YQR A;  3OCI A;  5IYC P;  1N3A A;  2NOL A;  1J3M A;  3T4N A;  3CVS A;  1QTS A;  1C4G A;  3N89 A;  3PMG A;  3CWS A;  2YA3 A;  5F9C A;  1KYD A;  2HZM A;  1N39 A;  2NOE A;  1RM1 A;  1C9B B;  1UL7 A;  3TDH A;  1KFI A;  3ULX A;  2NLV A;  1UT7 A;  2FKM X;  1EUV A;  5AN4 A;  3EIK A; 
#chains in the Genus database with same CATH homology
 1M3Q A;  1QN3 A;  1EBM A;  2VJ0 A;  4TPS A;  1KY6 A;  1KY7 A;  1YTF A;  2FGT A;  3ASM A;  3F10 A;  1YQL A;  2LAE A;  3VN5 A;  3OSM A;  2D0C A;  2MJ7 A;  1KYF A;  1TGH A;  1VOL B;  3H1Z A;  4ROC B;  1N3C A;  1QN4 A;  1NGM A;  3DPU A;  1AIS A;  1PCZ A;  1LWY A;  1PZD A;  1QN7 A;  1VOK A;  3OST A;  4ROD B;  3OC3 C;  2NOH A;  1YQK A;  1QN9 A;  2YH5 A;  4I8O A;  1R4X A;  3F0Z A;  3I0X A;  1D3U A;  1QTP A;  1UT4 A;  1TBA B;  3I0W A;  3KRM A;  2NOZ A;  1YQM A;  2IV8 A;  2G30 A;  4PY5 A;  2O3O A;  1QN8 A;  1VTO A;  2JOI A;  1KYU A;  4EJY A;  1HU0 A;  5IYD P;  3SNS A;  3HS9 A;  1QNC A;  4EJZ A;  2XHI A;  2HZS A;  3IH7 A;  1LWV A;  1FN7 A;  3HS8 A;  1W80 A;  1B9K A;  1CDW A;  2I5W A;  2Z8U A;  1QNE A;  2NOI A;  2D0B A;  2MZ8 A;  2NOF A;  1TBP A;  4Q11 A;  1MP9 A;  1QN5 A;  1E42 A;  3KTU A;  4DUL A;  1JFI C;  4B0A A;  2D0A A;  1QNB A;  1YTB A;  1KO9 A;  1LWW A;  1QN6 A;  4WZS D;  3RPJ A;  1QNA A;  5IYB P;  1M3H A;  2NOB A;  1NH2 A;  3DPT A;  1VTL E;  1NVP A;  4ROE B;  2IV9 A;  1YQR A;  3OCI A;  5IYC P;  1N3A A;  2NOL A;  1QTS A;  3N89 A;  2NOE A;  1N39 A;  1KYD A;  2HZM A;  1RM1 A;  1C9B B;  3ULX A;  1UT7 A;  5AN4 A;  3EIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...