1KYFA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 67
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyfA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyfA02
4PY5A 2D0BA 3VN5A 5IYCP 1QN7A 1KYFA 2A7BA 1B9KA 1KY6A 1OM9A 5CN1A 1QN6A 4RODB 3EIKA 1KYUA 1QNCA 1YTBA 1PCZA 3HS9A 1QN5A 1QN8A 1PZDA 2Z8UA 3ZY7A 3MNMA 1KY7A 3OC3C 3HS8A 1TBAB 3H1ZA 1QN3A 4B0AA 4ROCB 2MJ7A 1TGHA 4ROEB 1NGMA 2YMTA 4WZSD 1QNBA 1C9BB 1GYUA 2G30A 1NH2A 3OCIA 1KYDA 1JFIC 2D0CA 5IYDP 3ZHFA 5CN2A 1NVPA 1TBPA 1QNEA 2DWXA 1AISA 1QN4A 1QTSA 1QTPA 2DWYA 2VJ0A 4BCXA 1MP9A 1QNAA 1NA8A 3ASMA 1D3UA 1VTOA 1GYWA 1CDWA 1P4UA 1YTFA 1W80A 1R4XA 5IYBP 1VOLB 1QN9A 1IU1A 1VOKA 1GYVA 1RM1A 1E42A 2IV9A 2E9GA 2IV8A 1VTLE 2D0AA
chains in the Genus database with same CATH superfamily
5JPNC 3BQUD 2YD8A 2OPCA 5KJ4A 5EEWA 1T7YA 1A14L 1D6EB 3JWNE 3EH4B 2FGZA 1B88A 2DL2A 4DZBA 1RK1A 1SPDA 5KN5B 4LT7A 1XCTA 4GP4B 1YRKA 3GI9H 1BZEA 1CXKA 5FLUA 1BM3H 3WTWA 1EEUA 1BQLL 5CN1A 5EEUA 4JDEB 5INCA 1BZ7A 5ID0B 2G4GA 1K5NB 1BD2D 4NUQA 3BPCA 3P0VL 5JMOC 1JRHL 4OCSH 1DUZB 1HDMA 2WVVB 4DVRH 2VDMH 2X10A 1J9TA 1XCXA 2X38A 4JR9H 4OLXL 1CGSL 2I9TA 1XTLA 2BP8A 2NQDA 4WWKA 4CNIB 3FT2B 3MRDB 4YBHA 2H2PC 4QRSA 2YUXA 3TCXA 1AQDA 3WNKA 4G70B 5ETUB 3ZTNL 5JYLA 1IQWL 1TZ8A 5GGQL 1A4KB 1D5ZB 1WLHA 2ZE0A 5JLZA 1X4YA 5BRZB 2BVYA 1YQLA 3ZZLA 2BHZA 2XXCB 1FNHA 1ZY9A 3PNWB 4WFGE 4HS3A 1H8NA 2CE6A 5DRNB 4PRHA 5GGTA 1OAZH 3KXFB 3RJOA 3L45A 3NCFB 4JN1L 1S7UA 3QIWD 3D0AA 1LDPH 1VENA 3TX4A 2XWZA 1XZ0A 3LS5H 1RUKH 1WBXA 4ZTEA 3EJRA 3WL9A 2VUKA 3TO4A 3ARYA 5KBKA 1KFIA 4Y2OB 1E2VA 3N1QC 4CW1B 2ZPKL 1IRAY 2DQGL 4JO3H 5SX4H 2JKRM 5IFAL 1X3DA 2A0LD 2DQHH 4FQXA 3ARDA 3UYPB 3W5NA 4U1JB 3RZCC 2UXVA 3GS7A 1INQA 1UCTA 3CFJB 1T4KB 4EOWH 2WQWA 1H5BA 2Z6FA 2G75B 3QPQD 3UO1H 3L5HA 4LF3A 4OF3A 4XP1H 2Z7YA 1W0WA 4MD4A 3O4LE 2XQBH 4WSKA 3S8GB 2HFGH 1IBYA 4XR8C 2CO6A 2FATH 3ARFC 1HZLA 3V4VH 4D8PA 5D4QA 1OTSC 3HI1B 1UD5A 3TFKC 1RJZA 2NW2A 2UV3A 4X4YA 2W94A 2AP2A 5BXFB 2CHZA 3TURA 5IK3A 2P5EE 4AKPA 2MFNA 4M93B 1KB9J 5EG6C 3K4AA 3VDAA 1RUQH 4Y2DC 3EGSA 4MA1B 4RBPH 4WEUD 4U3SB 1VOKA 1PY0A 1SVZA 1GZHC 1QQDB 3P30L 1PKQE 5FECB 5EUOB 3BWAB 4XPFL 3QNXA 4U6XB 1I3VA 5KVFL 1AH1A 4Z7VA 4BUHA 4HXBL 5FYJD 2B2XH 2ESVA 3UJIL 3ZDYE 2E4FA 3VFNB 4DETA 1GIGH 2NY3B 5FS5A 1HCFX 4LE8A 3H9YA 3ZDXE 1JF1A 2C9SA 5E9AA 5SWSE 3TTYA 4AM0A 4AEFA 2C7FA 2C3HA 3GT6A 3IFPB 4RFOL 3EHBC 3HPJB 3U0TB 2H6UA 1PIFA 1SY6L 4X5XA 4D9QE 4YDZA 3SO5A 1AR1B 3CVDA 1ZOXA 4GINA 5D7IF 1ROCA 1ORQA 1BBDH 1QFHA 3QCTL 4P2AA 3ZO9A 5IP4A 4F8NA 1GRWA 3O4LA 2RFXB 3OKDB 4HK0A 4ZOAA 5E2VH 4NUMA 5C8JA 3ZRSA 5KW9L 1U3ZA 4AGOA 3RIFK 1LP9E 1NLBL 5FYKD 5JIMA 3MNWB 3B2PA 4WU7A 3D18A 5ADPH 2WYHA 3MA9L 1HHHB 3VVVA 4XNQA 1H3WM 1YNKL 4TQPA 5DLMH 3RZCA 3REVA 3SE9H 2OQJB 3UC0H 3O2VH 1L7IL 4K71B 3ABMB 2VDNB 4JL2A 3RWEA 3I9GL 1EAOA 3QDMB 3NCYS 5KOVC 2H5UA 3TYFA 2RBLA 1HSAA 3FCUB 3K2MC 4K5PA 2KH2B 2VR5A 3EYQD 4UINH 1PKQA 4K94H 5H8DA 3BMVA 3SDCB 3R1GL 5GSRA 4LL4A 1JZIA 5ANMB 2GK0A 3RNQB 4LL1A 3S0PA 3Q2VA 5LCVL 1ES0A 3B5GA 3ARFA 4FLOA 1QR1A 4LSPH 1MHHB 3S36X 2EXSA 4CGTA 3HG1D 2FLMA 1SFHA 5SWSA 3TNNA 3MLZH 2CXGA 4OV6F 1PY9A 1QSEA 1UZ6F 3VXTA 1FVCA 1TTCA 3TBVA 3ARSA 1WTGT 1GGCL 2WKLA 2ZWNA 3SE6A 4Y2DA 2BY0A 5HHNB 3WDHA 1ITCA 4AT6B 4AEIL 1BOGA 2KDYA 2B9AA 2R15A 4FP8H 4X5WA 3RJQB 1GZHA 2I25N 5EBLB 2FK9A 4WI5A 1NMBH 2DMGA 2VUOA 1MRFL 5JXEC 5L88H 5ILTH 2WN3A 3UEQA 1JZHA 2A9MH 1N67A 3SYQA 4MDRA 1BLIA 3D85A 3IF1A 2QVMA 4IU2B 4XPGL 1P6AB 4PJAF 3SQRA 3SZ6A 3V0DA 5CCGE 4MBOA 3GSNA 1PG7W 4WGKA 2GI7A 2ENQA 3BPOB 2IGLA 3NSFA 3Q8FA 1HOEA 4P8QA 5E1GA 2KZ1B 4WGWB 3BVVA 1RY7B 2HJKB 2QLYA 2J55A 1YN6A 2QQLL 1QSFE 3P4MA 1Z6JT 2CHDA 1Z9LA 4PJ5E 1N26A 4Y7MA 5EWIL 3HEIB 4RX4D 3CHQA 1MCLA 2CO4A 1OCWH 3PJNA 4R2GC 1KELH 2YPVL 4OLUL 3IDXH 2KI6A 4LESA 4FNRA 4I2XB 4XNZB 2HX8A 3QORD 5AAWC 4ORGA 4EAKA 1ID5I 1UJ3A 3KYMB 5I8CA 2DQCL 1AGFA 3VH8G 5CP3A 5TE7H 1TZGH 5EZLB 1KYFA 3DSNB 4PV9A 1NLDH 3LEYL 2XZZA 2PCYA 2Y7MA 4ANVA 2AV7B 1J10A 3TH2T 3QRGL 1XB3A 5BRQA 4FADA 1OZUA 1R47A 1ET8A 2ZJSH 1RZKL 3RPJA 4P2QE 3PF2A 1TZAA 5EEVA 2CRZA 1ADQA 1YMHA 1PYWB 2RQEA 3HB3B 2VABA 2OTWB 1UKSA 3UZVA 2VT0A 4D7BA 1A6ZA 4GG8A 3O6KL 1A6AA 1QRNE 1TBAB 5I15L 2CHNA 5DRXA 5GGVY 3MLPA 3G7TA 5B39B 5C08D 3OKYA 4O02H 5EEZA 1U3NA 4MB1A 1N8ZA 2VC2B 3CLEH 2R27A 4BM7A 1QSFA 5BZWA 4KZEL 1RCYA 4G5ZH 2CQVA 3B2UD 3WEXA 1XGQA 2P8MA 4MNHA 3DOIA 5EOTB 2CG9X 1ZT1A 3MU3A 4EIZC 5JXEA 3ULUL 3MV9E 2QV4A 3U7YL 4U1LA 4KFZC 3MQIA 4KK8D 3WFCL 1E4HA 5IHZA 4NQCA 3GMNA 3MV8D 2WJ7A 2ZFDB 4ORZC 3MLXH 1BIIA 3D5OF 4R84A 4G8FA 3QUXD 2V6HA 1R0AL 1X5ZA 4WWID 2HKFL 3BFWA 3SPHA 2TAAA 2V2TA 4JO2L 5AOLA 5HY9A 5CGTA 1JTOA 4K9EH 2XWEA 3N55A 1SLUA 5F3FA 1YY9C 1J9QA 5KTEH 5C3TA 3ZQWA 3KS0J 3PAUA 5DUBA 2HL8A 4B0MM 2DWYA 3B5TA 4LSVH 1MELA 3HG4A 4LCUA 5CD3B 2F7RA 1V3MA 3MLUL 1EXHA 2TRYA 4AZ8A 4Z7IA 5AAWA 3CLWA 3NSXA 3H85A 1T21B 2JQMA 4KDWA 2GK2A 4HU2A 3WKMH 3IRPX 3KEDA 1QRNA 3O6MH 5CEZE 2IBBA 2NY2B 2X2YA 2VDKH 2NY7H 2BINA 5MI0C 5AW9B 4NYLB 2P4AB 4B7LA 2F5AL 3N42B 2HT3D 4LAQH 5LDUA 3LQZA 4JPVH 5E6IA 4YHML 3KJ4B 4X9YA 5TDOB 2YRLA 3DMMB 3MV9A 4KXCA 3EYSL 4X99B 5IB5B 4U7MA 1N59A 4NS0A 4TLSA 2YMOA 3EDFA 3V10A 5JIIA 5KYWB 3GUTB 5L6YH 5BRZD 4XMLH 1BFOB 1O9WA 3SYAA 2ZICA 4FNUA 1A9BB 3CZSA 1DVYA 3KXFD 5L2JA 2R9HC 4FXTA 4XCNB 4H1LA 3WFHA 1SEQH 3SDDC 4AOFA 4PTTA 4ZAKA 1T1WA 4DUWA 1C1EL 3A6BH 4YFLI 3ES6B 1IQDB 5DF0A 1WSST 1U8HB 3ARGC 2IQAA 4M6NH 2P80A 3V6BR 3FQUA 1Z32X 4PGZA 2P46B 3QEUA 5DJ6B 5HBBA 2X4QA 3DX9B 1B2WL 5EU7C 2YKLH 3MNVA 1GZQA 2WLJA 1QI4A 3OHMB 4WFFD 4V1DE 3P9LB 4WKZB 1P5GX 2FDBP 1FL3A 4B9PA 4YBLB 3RU8H 4Z23A 5CN3A 1QR4A 4J28A 4HIHB 5IREA 4MD0A 4JFFE 2ZUSA 3K2KA 4MQTB 4AV4A 2R59A 4UDTA 3D07A 5C3LD 5EH1A 4GKLA 1DSFH 3GKZA 3QZPA 4LSTL 2KZKA 3MV7E 2EO1A 3AXLA 4ZMQA 2GT9B 4P07A 5IUSA 3S96A 4PGBA 5D7IE 2WZ5A 3A67H 2YRPA 3PWNA 1CJYA 3D6GA 3D12B 2R2BA 5T5FH 4YX2L 1NEZA 3N1FC 1FORL 3MODL 5DZNA 3M7OA 3BKJL 4IJ3C 3MRQB 2KQMA 5T5NG 4AYFA 5GRYA 1I85C 1LGVA 2CGRH 1OARL 43CAA 2XV2A 4L05A 5IB4B 1HL9A 2BSED 3WIHA 4JJOA 3RWFA 1RVFH 3QEGL 2OZ4A 5DJ0B 1QI5A 4M6MH 4ZPTA 4C8XA 3SODB 2A1WH 2AABH 5E2JA 4IBWA 2NY3D 4Y9CA 1ZTXH 4RA0C 5K1JA 3L7FB 1FPTL 3QG7L 4JG1L 5I1JH 3IEAA 2AK4E 3B9AA 3LPWA 3NJJA 1GYWA 2B7DT 3FFCA 4FHKA 3NFNB 3DV6A 2CRMA 4U1HB 1AR1D 1E65A 3DX8A 1G1KA 1CBJA 4JFFA 4QF1B 4MA8L 1TT6A 5H94B 4RETB 3WFEL 2V8LA 2DF3A 1AOZA 3HKZA 3BP4B 3MJ9A 1UZ6E 5KVDH 3ARGA 1BQ5A 4OCWH 5C07B 2H2SD 2X2HA 2QKIB 3MV7A 1KNOA 4KK5D 3QJVB 3UPCA 3EJYC 3FTGB 3N41F 1JFHA 5D7IA 1G7MB 2IBZY 3VM5A 2YXFA 1QW8A 3GZOA 4L3AA 5AVXB 5FAAA 1KZQA 1IC5L 2NY5L 4P5MB 1NINA 1XGRB 4HG4K 3QDMD 1KXVC 1W2KT 3HC4H 4L4VA 3C9NA 4M8VA 3DROB 3II3A 1NBCA 2ED8A 3BJLA 4NC1E 4JKNA 3WFBL 3SDCD 3QDJE 1QBLL 2X3AA 5DJZB 4JANB 4O00A 5TJWK 3RX7A 1U8IA 4PJAE 5IW3A 1BYNA 3KWWA 3SCMA 5C0JA 5I19L 2ZCHL 3GHEL 1WFNA 1AGBB 5DHDA 1RZJH 1N3CA 5D2LE 3D2UA 4GP5B 4MSWA 5CXPA 4B7IA 2XKNB 1H3TA 2AK4A 4KY1H 4E68A 2CIKB 3GGWB 1R46A 4HKXA 4JFEB 1JSYA 2H26A 1KV3A 3GHBL 4GS7C 4RMUA 1DVUA 4RAUA 1I85A 4CVXB 1DN0B 1G7QB 4L8SC 2EE9A 2GITA 4KRPC 3WS3B 4A68A 3EFDL 4UQ3B 4IM8A 3VW3H 2VZSA 3GTNA 5IB2B 1HQRA 3G5ZA 4MRBA 1FLRH 2P43B 5AZEH 3MCG1 4KXZI 2X05A 2NNFA 2PWFA 5LGHH 5HDLA 2QPFA 1MY7A 1U42A 1N4XL 4OQ1A 3ZKXC 4FCHA 4HOMA 4C57C 2L7JA 1I82A 4L3ED 5BV7L 1JI1A 4OLVH 2VQ1B 1DQLH 3TNMA 3NZUA 2FX8H 3FOMA 4YDVB 4CADB 5BPPA 4XO3A 4RESB 2ADFH 4U3CA 3HFFA 2YARA 3VFGL 3VO0A 1OW0C 1IC7L 2BIHA 3RX5A 4YXLL 4F7TA 4AITA 4EJZA 2EACA 4O9HL 1JWUB 3MO1A 2BHFA 5T3ZH 3CFEA 1XFPA 3H7BB 1WGVA 4PJAA 1X5XA 3ZZSA 1RURH 2AS5M 1WIUA 4EZKA 2Y7SA 1Y18A 3DHUA 1PG7X 5I24A 1EJ8A 1OO2A 2EO9A 1TQCB 3QPKA 3TH4T 2ITEA 1P6FA 2UYLA 4GKZB 3WG7B 3OAYK 4DKTA 3S37X 3P3YA 2PW2A 4JHBA 1EBAA 3D4VA 2E6PA 4NZRH 1LWRA 5MP6H 3OG4B 5JIHA 2BVOB 4FNQA 2A6JB 3W9DB 4B9JA 2W9EL 4JCLA 3TZVA 2XPGB 4ZFFB 5J1AB 5A1AA 1HSBB 1KXVA 3SDXB 1Z66A 2V8QA 4MB4A 4K4KA 5EA0L 1Q9OB 4HPOH 2X4PB 4Z1PA 2ZOLA 4N2HA 3ILQC 2UX6A 4BD4A 1NICA 4CSTA 3N04A 1H8OA 4HJJH 3HB3D 4PGCA 4JK0D 4HLEA 5SWZE 2EDHA 1JGUH 4H8QA 4O2CB 4PIRF 2XVKA 4ZMPA 4KVNH 3RA7L 2EE3A 4JO4H 5AL0A 2WYZA 1PAZA 5EO1A 2VLME 2YJQA 2ALAA 1NWPA 1M71A 2PCPA 1A14H 3ARQA 3T4YB 4PJ6A 3MXWL 1A6PA 3WXWL 3OXRA 3LRKA 2W1NA 2QZ5A 4L8SA 4LVHB 4N2GA 3QJFA 2JCCF 1BQLH 2A4ZA 2GG1A 3V0JA 5IW6A 5SX5K 1HX0A 1MQ8A 3P0VH 4ZUSA 1WFOA 1JRHH 3MREA 4IKJA 3UBXA 2BMKB 2X1QA 3PIQA 4PRDB 2DYRB 4OLXH 1CGSH 3E9UA 3QQ4A 3VGFA 3ZE2B 3MA7B 1DR9A 4YK4B 5C9JA 2H0JA 4J3OF 1EEZB 2GTWB 2WXIA 4LCYA 1VZGA 3ZTNH 3U30B 1XD0A 1U3HC 3V52L 3RWCA 2VZTA 1IQWH 1OW0A 4JN2B 5GGQH 2YAMA 5IUCA 4H25A 3RFZB 3MN8A 1AS6A 2A6DA 3GMMB 4PS4L 4XP4L 2WSPA 3NOIA 1MLCA 3VSQA 4HJTA 1QZ1A 1QRKA 3IKCB 3CSBA 3QVAA 4L8CB 5SWZA 4JN1H 2QADC 2EKJA 4RA3A 2CBPA 3GBDA 2B20A 2WNXA 3BHBA 3ZHLA 4NQSB 3CH1A 2Z31C 1J3MA 1BZOA 2ED6A 4PP1C 3GMQB 2RQ8A 3F7VB 4HWUA 4X7TB 5HD8C 3F84A 1LMIA 3L6FB 3KWVA 2FWLB 2ZPKH 5GJSL 2DQGH 3RZWA 2BK8A 4AYEC 5IFAH 3OPZL 1PD1A 1AO7B 3FZUC 3DMMD 1NIEA 2FUTA 4QUOA 2CDEB 4GW1A 5ITFA 4B27A 1UL7A 3IFOB 5EO9B 1A9EA 1MIML 4ZUUB 4WHYH 4DZBB 3CFDA 1HH9A 5IB1B 5IF0B 3IDGB 1KO9A 3MXVL 2GHZA 1R6VA 3LH2L 3CN2A 2NYYD 2PF6A 4OF7A 1CDWA 5C0BE 5CGYD 3SGEH 2WLNA 1CGTA 3D4CA 5ANME 2NX5E 4M7ZC 5J8OA 4PRPB 2I9TB 3VFPB 4C55A 1VSCA 2DMBA 5FCUL 5FUCC 3GBEA 4ZTOL 2G2PA 1HHGA 4UQEA 3WHXA 4A6YB 3GJEB 2Y7NA 4PJGE 4BA8A 2DQIL 2Y2TA 3QUMA 1RKRA 3QXWA 1MCEA 4HG4J 1FQ9C 3KWTA 1JNJA 1R3JB 3ZKSD 4DSYA 1FNEB 2ADIA 5IOKA 5KVFH 2FYVA 3HRZB 4AW4A 5B3JE 4IRSC 4PRHB 4HXBH 3M17A 3UJIH 4QXUL 5JDSB 2AQRA 3ECVA 4NN7B 4HIIB 1TFHA 5FX3A 4QRUA 5H35A 3N3EA 1DQQA 4RFEB 1T0NB 4RODB 1OP9A 3EIKA 4RFOH 5FUCE 5LKNA 1EEYA 4WVRA 4DEPC 1JPFB 2ICEA 1NCDL 1B3IA 2WNKA 4NENA 2VGLM 3O6FC 5E9DE 3QCTH 4FQXB 1E2WA 4L1LA 4ANWA 2W8CA 3GBNL 5F7UA 2Z31A 5KW9H 1X4XA 1I3RA 2CPCA 3K8KA 3L7EB 4JPIB 1GH7A 1NLBH 4TSCL 5C0BA 3UTSB 3V6FB 4DP0X 1EVUA 2NX5A 3BUYB 5AW5B 1W0WB 4I1NB 1YNKH 2X89D 3ARBB 1AD0A 2VDLH 4X4KA 2DMKA 5JPNB 1L7IH 3LIZA 4YE4L 4JZNA 3L4ZA 4MCYA 5C0RL 5K9KB 1JZJA 5F9CA 5GGUA 1C9BB 5B1BB 5F9JA 5IK3B 2WKGA 5I1GL 3PU7A 3R1GH 4BWWA 1T5XB 3K6IA 3TXAA 3QEHB 4F37F 4JGMA 5JR1L 4G7VL 4H44C 5LB1A 5LCVH 3BQVA 2X12A 4BGLA 5I71C 4HPHA 3GM0A 3MHZA 2YC1B 4M3HA 4UOQA 5AVTB 5C07D 4Z7VB 2CDFB 3DLQR 1GGCH 3EJCA 3L3HA 3NZ8A 4M3JA 1YQVL 4DN4L 4UYQA 3TA3D 1NDTA 4AEIH 2KZWA 1SUJA 5E9DA 2ALWA 1H3PL 3EG9A 4HVBA 5DXWA 5AVWB 5F6IC 3TCTA 4AM0B 1TCRB 3LSOB 5F6HI 1MRFH 3DUSB 3F01A 1ADWA 4OLEA 4XN1A 4X5XB 3TBCA 3UIYA 3IGKA 2Z3FA 4IRSA 4O2FB 1MQKL 3OHXC 2X4TA 3H2WA 2FUVA 1ORQB 4GG6E 5I6MA 3OKLA 1ZKAA 3DECA 1L5GB 4XPGH 4FS0A 3FB7A 4PMEA 5DZAA 1KTCA 4QRQB 4DZ8B 1A6VL 3GTVA 1YAZA 1HYSD 4XVUD 3O6FA 2QQLH 1KJ2L 4BFOA 3HFML 4PHXA 1EZUA 3OJ2C 5EWIH 3LKRB 3I50L 3K81A 3N1PC 4PP2A 2XYBA 3ECWA 4NBYB 2R0LL 4W70A 2GFBA 5EEXA 3F00A 5CLWA 4OLUH 2AI0L 2YPVH 1AE6L 2AXWA 4GP8B 3JUZA 4LDOB 3ROOB 2IJ0C 4TN9A 2X0UA 5D6CA 1TF4A 2D7MA 1B9KA 2D7OA 5IQLA 3RDTC 3PGCA 4ZMWA 2DQCH 4M1DL 5FC9A 3KBPA 4YEEA 2GK0B 3LEYH 1DUYA 4S1QL 4YGVA 3OLEA 4CMHB 1KWGA 2MH4A 4S0HA 3EOAA 2DRUA 3NQKA 3QRGH 2UZXA 4DOHE 3O0LA 1NCJA 1I7TA 2K6ZA 3RWIA 1QR1B 5HGDA 1UTDA 2FNBA 4B6ZA 2WBJA 5FDWA 2NCEA 2NCMA 5I82A 1RZKH 5D70L 3V0EA 3VXTB 2DIAA 4WWNA 3RAJL 1JN6B 4N24A 4QY8B 2V5TA 2WXLA 1ET5A 2IPKA 2ZNWA 2GSIB 3O6KH 4AW7A 4ACPA 3CFQA 1EXUB 4J3OC 2DYPB 5I15H 2RTTA 1ECYA 2ZUTA 3LZFL 3V5KB 4QRRA 2IDFA 1T5KA 2APTA 2H1LM 3OAYH 3NJNA 2IXQA 1L6XA 1T1ZA 3AZUA 3DBXB 4WNQB 4X80L 4KZEH 2JCCE 4PRIE 3ULUH 2AQPA 2Y3AA 3EHBB 3U7YH 1JF5A 1NGZA 1N3AA 5IW1A 4M7KL 3OHXA 3WFCH 2GBTA 5DK3A 4PS8A 4CAGA 3P4MB 1UURA 4P9HL 1R0AH 2HKFH 1A1NA 4KJQC 4AUUA 4ETQB 4JO2H 4N4YB 3EYVA 3PWUB 1RZQA 3TS8A 4WUUE 4W9GC 2HPOA 4KRLB 3T6VA 1KGYE 4R7XA 5FR3A 1BZDA 4IHOB 2PTVA 1E3XA 1AGFB 1O6SA 4HA1A 2OXGA 2EEDA 2A3TA 3F58L 3GM8A 4MVBC 2PYFB 3MLUH 1GS8A 3AWFA 2NWVA 4A2MA 4G7SB 2Z92A 1GKEA 1Y1DA 3JWDL 5I1DA 3RDTA 1HHKB 2V17L 5SX5H 4ZMZA 1YEFL 3UMTA 2OKMA 2XA8L 2VDQL 5I18H 2BHUA 1IU1A 3L5IA 4P5KB 5K1VA 4QNPE 1SVCP 2J8HA 3LV3A 3QHTC 3ZL1A 1SJMA 4JO8A 4HZ1A 4GIPD 4N5EC 3RIAF 1JNLL 1U8LA 4IOIA 1X44A 2VABB 3LKQA 1P5UC 5DGRA 2C7UA 3QDGA 4R97C 4W9EC 3M07A 2JCCA 1KYOJ 4GRWH 4APQA 3C12A 4WX8A 4PRIA 2PMZA 4K55A 5DRXB 4CFFA 2EADA 2YK1L 1PZSA 4KVCL 4KPHL 4N5UA 3EYSH 4GSDL 4UU9A 3AUVA 3F7RA 3CFCL 2LVCA 1U36A 2DKCA 1LE5A 1GSMA 4KX9A 2A6IA 2KPNA 2JKLA 1A6TB 2JF1A 3BH9A 1MY5A 1ZT1B 2B1AL 3VRLF 2Y72A 5B38G 4L9DA 2FZ3A 4GSRA 3U0WL 2OOXA 3GLDA 4XN4A 5D1XB 1CK0L 3ZK0A 4WUUA 5EBMA 3E2HC 3AVEA 3NN8B 2VN4A 1C1EH 2VXVL 2XWDA 2ZONA 4OUUB 5J6HB 3ETTA 1NOFA 3V0VB 3L3DB 4TUJA 4Q2ZA 5I2IA 1UOLA 4NO3A 5HY9B 5IJKC 1TLKA 2VCOA 4J6RL 1B2WH 5CSZA 1LWVA 3T8XA 3UP6A 5EO0B 4OQTH 2Z0FA 3MRHA 1F3DJ 1KG0B 2MWCA 4LCUB 4XH2A 1BQKA 2VH5L 3D8MA 4WJ5B 3Q44A 3RDJA 4FFZA 2DWSA 2ZOWA 1JIBA 2WYTA 3E8VA 1TITA 3HRPA 2H41A 3K5RA 3DVFA 3OGCA 3Q6FB 3APDA 3BX7C 4G9DA 3TM6A 3MUGA 4WRLA 2X1WL 4U05A 4YIQA 2V9JA 5CJQL 2ADYA 3JT0A 1LWHA 2W0FB 4PY7B 4LSTH 4WCYL 5BS0B 3BDXA 5I30L 2FSEA 2E9WA 2K78A 1AGEB 3JBG7 4PRPD 5IYDP 3NK4A 1W6LA 3MROA 4YX2H 1FORH 3MODH 1NVPA 3I85A 5AVZB 1OE2A 1TNMA 2ZWZA 3KLKA 2VR8A 5F9WC 4F8LA 2DV6A 3BKJH 3WENA 1G0XA 3GBML 4KO7A 4D0CA 2VLJB 1QA9A 1OARH 2ERJB 4L8BB 3IN0A 3GF8A 3FU5A 3IMRA 4JFEE 2ETWA 1P5UA 4OFDA 3QEGH 4YEFA 2B15A 4AE0A 3KD4A 3EGXA 1RFDL 3QIBC 5E1IA 2ITCA 3L3GA 4PRHD 1E43A 4JFTA 1YNTB 4BFJA 4OR1A 4UT6A 1SMDA 3QG7H 1NAMA 4JG1H 1PCXA 1DJSA 3CSYB 3T09A 2IQAB 1C8PA 4DGUA 7PCYA 3RP1A 5A3ID 3FQUB 1XCQB 2X4UB 2DQEL 2X4QB 4YNYA 1KGXA 2AF2A 3F04A 3MNVB 4FQXD 4KOCA 4X98A 3WLWC 1B90A 4MA8H 1WPCA 3WFEH 5DUML 3CQPA 3UOAB 3L16A 3VXMA 3ESVF 3QXDA 4N2CA 3FYIB 3UTSD 3FTSA 4G43A 1XR8A 1XBRA 4LLDA 3BXNB 1MFAL 1P4IL 5DC9B 2RMNA 3ARBD 2F1EA 1A3LL 4YSEA 1E8WA 2OMBA 3RHWF 4ELKB 1OALA 1IC5H 2NY5H 4JHZA 4C83A 1IILE 1V3LA 3CDFA 4ZT1A 5IJVA 2X70B 3AQXA 3VB9A 1BJ1J 1IAKA 1FGNL 4ZFGL 1F3DH 3WFBH 1QBLH 1MCJA 5IHWA 2XV0A 4M9OA 5LNGA 5EIIA 2NDFA 1F5WA 2ZCHH 3WNNA 4YAQB 5MI0B 3WFZA 43CAB 2FEEL 3C08L 4AYFB 2DM3A 2YD0A 2KL6A 2BOBB 2H2PD 1PQZA 2APBA 2J6EA 3KVQA 3LN5A 3GHBH 4UOJA 1A3ZA 3ARTA 1I1AC 2CBQA 2AKRA 2QPUA 4I88A 4E5XA 3H42L 3F2LA 1B4LA 4FFYL 2H6PA 3EFDH 3BP7B 2A6KA 5DMIL 3SKMA 3CZKA 3GBLA 1UG9A 4LEOB 3FFCB 3QIBA 3CX2A 5D4IA 4UIMA 3D9AL 4L1SA 4WSJA 3DX8B 5HVWA 3SDDB 2EXWD 4P3CL 1CG9B 5BV7H 1I4FA 2J8UB 1ZWIA 3VTTA 1EJ6A 3FK3A 3A6CL 1AG0A 2IAMC 3VFGH 2JMRA 2A9NL 1CB4A 1IC7H 4YXLH 4P3DA 3C75A 4O9HH 3S98A 1V5JA 1JZ5A 1KBPA 3RZCD 2OMYA 3I3EA 5KWYC 1OGAB 1ZGLP 1BFVL 4G6FB 4FF9A 1G0YR 2C8NA 1PU0A 3WNJA 1MEXL 2HB0A 1KBVA 1U8IB 2HCZX 4MJ6A 4AL8C 2W9EH 5AW2B 3ZTJG 2Y5TB 5DD0L 1OIOA 5GZNC 3K74B 2EDRA 1WBYA 4HHAA 1OTSD 3O45B 2WQRA 3FQNB 4XTRC 4ZSOE 3D2UB 2JK5B 4MSWB 1CO1A 3IU3B 5EA0H 1EV2E 4F3FA 1BJ1H 4ZMOA 1ZT7B 4HKXB 4Y2DD 1V7ML 2XZCL 2D31B 5JNYB 1MHPL 5E8EB 1AO7E 2C1PB 2ZUUA 4UTBL 3CWUA 4ZXBB 1F11A 3BPNC 3IVKA 1YDPA 2W0LA 3HMWL 1KBWA 2MCAA 4KQ3L 3RA7H 2GITB 1AXSB 2DYPD 3MOBL 1K6QL 1FFNA 3WHE1 3QWOA 1MHCB 5D71L 4RFNB 1DBML 1I1AA 3U1SL 3WXWH 4ONOA 2LU3A 3GSQB 4X9HA 5CEYA 4DCQA 1ZLWH 3EHBD 5HYSA 5C0AE 3NYKA 4Z7NF 2HX9A 4YHOL 3LCYA 3FOLA 5DJ8B 3OZ9L 3WLBA 1U3YA 2BS9A 1OSZB 3GSOA 5I8KL 2Q7YA 4YHLL 3OQ3B 5FO7A 3PE9A 1OK8A 2MZ8A 1USQA 3CFEB 2XX0A 3WEOA 5MEOA 4XBMA 1F6LL 4MA7L 4P57B 2IAMA 3RWGA 1NUNB 1Y18B 3V52H 4F9LC 5GS3A 4UYPA 4ZSOA 1IAOB 2UYLB 1FE8L 1IFHL 1L9SA 1UT2A 4H0LC 4PS4H 4XP4H 4XMZA 4L23A 2NZIA 2CUHA 3VRLE 4FNLL 3ZDZF 4F8TA 1HXMA 2G30A 3S35X 1DQDL 4DNLA 4HH8A 3BSZA 5KSBF 3R8BB 2G9KA 3TBSA 3IDYB 3B1UA 2HKAA 2ICWA 2K45A 1DVXA 1KULA 3HZVA 5GZNA 1CZ8L 4ACTA 3QW9A 5J3HC 5GJSH 1J86A 3FBKA 4FG6C 4RAVB 5FYJL 2D7NA 1AMYA 3LXCA 3UTSE 1NIBA 5C0AA 4Y2LA 1UASA 4G5AA 2PCPB 3FQTB 3OSKA 1GGIL 4RMTA 1MIMH 5D55A 4I0KA 1DQTA 3HI5L 3JWOL 5JXED 3MXVH 1OM3L 4OT1L 3LH2H 5DMJB 2NOEA 3FDWA 1UJTA 2AQ3A 3INUH 4DFIA 3GRGA 3OXSA 2E6JA 3KDMB 3TJHC 1DVQA 3DO7A 2F58L 3A22A 2Z4QA 3FQ1A 3ZKXB 1IEAA 3EO1A 1M5Q1 3UO8B 3FN0L 2QDVA 1JXKA 4ZTOH 5FYKL 4KK9C 3FT4A 4UT7L 2DQIH 5LG6A 1IMHC 1JERA 2UXFA 1XF3A 2FIKB 4KK6C 3BPLB 3RKDC 1NGXB 2D0BA 5JW5A 3HHMA 3TA4D 4HUNB 5D9SB 1A0QL 3P02A 4NEHB 1BMZA 3SO3B 4FXGC 2F53B 4FDWA 1FZKA 3HN3A 1CXHA 4Q7DA 4K3GA 4BQ9A 3QYMA 2G2RB 4QXUH 5D93C 5DHYB 3FQWA 3ZYZA 2HVJB 3PWPB 2LT9A 1AC0A 4NM4L 1KGIA 1AACA 2XG4A 3P11H 5E6SB 4KGLA 4E41E 1HOCB 3EFFB 3UROR 2V7NB 5BS0D 1X9UA 4R8WL 3WDJA 2G2NA 5CNHA 3H3BC 3SYPA 5DU7A 1NCDH 3KGUA 1AXIB 4PR5A 5CINL 5AN4A 4JPSA 3IAPA 2W38A 1PZCA 3B7SA 2CCWA 2H8PB 3GBNH 2VLJD 3UMNA 4LHUG 5KVGE 1N2RA 4TSCH 3AS3A 3K2IA 3FW6A 1HH9B 4U1MA 4MMYA 1X5JA 3QIUC 5FKAB 3IRZA 4N68A 5E2UH 3UC2A 3WMPA 4J23A 3T9WA 2QEJA 3LAFA 1XV8A 4JM2C 3D3VB 4I48B 5C0RH 4XXCC 5D7LA 4N90E 1M1XB 4MCZB 4UMSA 3PLYA 1RZFL 1MOEA 1KB5A 5I1GH 2R4SL 4UTCA 4L0ZA 1HHGB 2PUQT 3O0RL 3US1A 2JHNA 4XZUA 5JR1H 3WNMA 4G7VH 3QUMB 2CDGB 1F4AA 2L04A 1W91A 4FXKB 3EXJA 4G3YL 4JHAL 3C2SA 3BVUA 1SF3A 4E41A 3U46B 2VOTA 3BAYA 5DT1L 5LAXB 2BNQB 4DN4H 1YQVH 2WSKA 3AM8C 3M17B 2WAHA 4XBPB 1U3HB 2F5BL 2PWGA 3TN0A 2HFFA 1HCYA 1H3PH 1XEDA 4ZMYA 2XN2A 4G80A 4CBPA 4HCRA 4TF4A 5E94B 1LWYA 4HALA 1PZ5B 3KCPA 4PIBA 2GIMA 4XGZB 1KJMB 1EEYB 2Z8RA 3OR6B 2W9DL 1MQKH 3HHSA 2Y1AA 2QADB 3IDMB 5E8PA 4BQ6A 5IOPB 4OU3A 2R0WL 3DRQA 1CT8A 1HL4A 4LARL 4S1RL 1K5WA 5CZRA 2B1HL 1WISA 1PZBA 3SGKC 3CWAA 2BIIA 1AQMA 2KC0A 4PS3A 3F7YB 2DH2A 3B83A 1I3RB 1MWAL 4ZO7A 1A6VH 1R75A 3EH3B 3W3BA 5J9PA 4EJ1C 3QJXA 1KJ2H 2CXKA 3HFMH 4BQBA 2ZX6A 3MRNB 1OT1A 3DGGB 3I50H 1P1ZB 2FQEA 2GIYA 3L9EA 2R0LH 3IJ8A 1ZHKA 3ROLA 4DVBA 2BNUB 4X7FC 1R19A 3DTDA 2XIBA 1IBBA 2AI0H 3HZMA 1AE6H 4LCCC 3TEWA 3HVNA 2HP4A 4MCYB 3FFOA 1QYGL 4OJAA 1DJWA 5GGUB 5I1IL 4QHKJ 3QIUA 5A2AA 3FFCD 5IKCA 4M1DH 3OLIA 4QHUB 1ZPLA 4S1QH 3FF8A 2CNZA 4NZ8A 3SDDD 3KPNA 4XXCA 2A74C 4QO1B 2AQQA 1BQHB 3RE0A 2OTUB 5I74B 4DHLA 4FABL 5J13C 5D70H 1T0PB 1Q72L 1FZOA 3C5SA 3JV5A 3RAJH 5CEXA 3SE8L 5JXAL 2XV3A 3NZ8B 1KT2B 1AHKA 2NY6C 3QAZC 1U3JA 4QCIA 2X44D 3ECUA 3II2A 2OMWA 4NBXB 4TKWA 4ANXA 4QGYA 4F58L 1UXMA 2WYIA 5AVYB 1OGAD 4G8GE 4G6FD 1J88A 3WTTA 5A7EA 1ETZB 1T80A 3MPCA 4LOFA 3GXFA 3ABZA 3BFQG 3OMAB 5TFSH 3LZFH 3AM8A 4NHUA 4NN5C 4PGDA 3TO2B 1YQ2A 32C2A 4MRQA 5E2WL 4LP5A 4K73A 2YOAA 3BCFA 1F58L 4X80H 2XHIA 5D1XE 2WB1A 4LB8A 2RIKA 4Z7NE 5L8JB 1MW0A 4H8HA 1UWEL 2WAQA 4M7KH 4WI0A 4Y4KB 4AUJA 1S7RB 2GQHA 3D2UD 3CJJA 3MGTB 3VFUB 2YN3A 4XNDA 1AKJB 2DOCA 2ZXQA 2YRZA 2GJ6B 2DYSB 3A21A 2VWEE 5GRXG 3SGKA 1RULL 4ZXBD 4W4NA 3T0XA 5HYEA 4FYSA 4YFLF 5HJDA 3FC8A 3PHQB 5D6CB 4XPHH 2V9UA 2E7LC 2LR4A 1I31A 1GYCA 3FO0L 1FO0A 2L8AA 4M6OL 4NNPL 1RZ8B 2WWMC 2JI1A 3SDYL 1U93A 3T4NA 4Q6YA 4O51B 3F58H 1NIFA 3ZDZE 3TBTA 4LCCA 2UZXB 3LEXA 1FF5A 3RWIB 1SJEB 3SQBA 5HGDB 1BBJA 4U7KA 4BYHA 1NDGB 2BIOA 3D39B 5JA8B 3JWDH 4KJYA 5KSBE 5IVOA 3DDFA 2HLFD 2V17H 5A2LH 1YEFH 3KVDD 4G8GA 2OCFD 2VDQH 3LJ3A 4HS8L 1YPZE 1HEZB 5C6PB 4JFWA 1LK2A 2HH0L 1JNLH 1UD2A 5I71B 2QQKL 1LO0L 1PZ2A 2VLJE 3SBWA 4PU2A 2AXJA 1RV6X 1S3RA 2YK1H 3L95A 5IMKA 4KVCH 4KPHH 3EJYD 4GSDH 1R3KB 1S9YA 3WKQA 3CFCH 3AREC 4DP2X 2XRAL 4PJDF 4Q6IB 3GXMA 1EDQA 2EIDA 2EXTA 1HIML 1B0GB 4Q4EA 1SJHA 3WEBA 4LCWE 3FN9A 5E7BA 1IEBB 3U0WH 3QXVA 4JHUA 5L0QC 1Q38A 4I8DA 2FD6L 1CK0H 3OHXB 4JFDA 4PWKA 4ZMVA 4JGNA 3QQDB 3Q0HA 4H8WC 2Z8UA 2VXVH 3DJ9A 3WIAA 5D96C 4FN0A 4ILDA 3TPUB 1VFAB 4D0BB 3LX9A 4AK2A 4HH9A 3G08A 1S7XB 4MJIE 5EU5A 4J6RH 5JQ6L 2NY4B 3FAXA 4OCLC 3QS3A 5KSBA 3RNKB 2JJTC 1HC1A 3BESR 1DSYA 2GTZA 2DQMA 3E6FA 1UXWA 3EYOB 3MUZ1 4A2FA 4JHVA 1BVOA 3KWUA 3LH8A 5HVGB 1MN4A 2Q6WA 3UGXA 5HPMA 5JORA 2VH5H 2I7SA 1NCUA 3KGSA 4IIQC 2JE8A 1L9MA 1PCJX 3TEUA 3ZVVA 5A6IA 3U2JA 3O3EB 2E7LA 1GTFA 2CZNA 2ZYSA 2Q86B 3RIKA 4B9ZA 4L4TE 1UD3A 5CJQH 4MB3A 1GMIA 2AQ2A 4QOKB 4WCYH 1IBHA 4WNJA 3DX6B 3LV3B 4ZQTA 5I30H 2VW4A 1U8LB 5GISL 1U8PA 4GQ9L 4TVPD 4AY0A 3HZKB 4J3VA 1TEFA 1QNEA 5E0FA 2N7SA 2YGVA 4GRLC 2F74B 1NCCL 1BQUA 4PMFA 2FL5B 3H4HA 4ISVA 3GBMH 3N1MC 5CD5C 2BPBA 3GQFA 3KPOA 3NP3A 4UILL 3L9BA 2IOIA 1MF2H 4YDIL 4QRFA 1LE9B 2APVA 4OF8A 4ODHL 1VEOA 2VDNL 5EBWA 2VMJA 3LPFA 4FLHA 1RFDH 3EBAA 1X4ZA 3IH7A 5IBUG 4CVUA 4NP9A 4IBTA 4Z77B 3MRLB 5AALA 2DLHA 3AREA 5IYBP 4ZS6C 2O72A 5I6LA 1I75A 1MPAL 5K9OB 3RY4A 4KKLD 1N18A 4OAWA 3KLHC 1YN7B 2OMTA 3ZE1B 4UQBA 4M1GL 2FKFA 3BUDA 2IV9A 3IJ7A 1PVHA 3VXUB 3WO4C 1EHXA 5LWYH 2EVFA 2DQEH 4KNTA 3F7QA 3R18A 4PJEF 1A9VA 1HCVA 5BVJB 1F2QA 5DUMH 4L4TA 2X41A 3MRHB 3ILQD 2E27L 3K5SA 4ZTPL 5F96H 4XH2B 4U0RC 5DZVA 3OKEA 4OZGB 2V7HB 2CWRA 2CD0A 3BKCL 1HQ4A 2WWNA 1P4IH 1OGAE 4Q8BA 2AJYL 2K6YA 3LPGA 4A04A 3RVVC 1A3LH 4YIQB 1XBDA 3AGVA 5FWQA 5BNXD 2PYEE 3A24A 5INDB 4LOEA 3F83A 5F7WC 2DLFL 4Z78A 3D3VD 4IIQA 1FHGA 4G9FA 1FGNH 1JBJA 4ZFGH 5T1JA 5AAMC 4RMBA 3MROB 3HIZA 3QB7C 4AIOA 3RQ3A 3O8XC 1F1AA 3VCLA 2D8KA 3IGAB 1YA5A 2CCVA 1O0VA 1NANI 4A67A 1JV2A 2PP8A 4GMTL 1QA9B 4NRYA 3C08H 3ZMEA 5C0GB 4JFVA 3CC1A 4GEIA 5DHVH 4QPEA 1J5DA 4R97B 2OYMA 3M88A 4UQCA 1R9FA 1HU0A 2BNQD 4GRLA 3NJHA 4OLZL 1QHQA 3GSXB 2P9RA 1BMGA 1U3HD 4UOW1 3EGDB 5E2TL 5GSVB 3DBSA 1FL6A 5IY5B 2E6QA 4FERA 2APWA 1IM3B 4P5TA 3H42H 4FFYH 1KFAL 4N1CA 4DKAA 5GRVK 1T83C 5DMIH 3KLSA 1WCQA 4UAOC 2WTOA 4PBDA 5FO8A 4K5LA 4NQXA 2ZAHA 4WW1A 4PVBA 2P24B 2WLHA 1JNHB 1CFQA 3D9AH 4KU1A 4LLVB 4OLWL 4PJFB 2QADD 4ADIA 4YNYB 5F89B 1SLWA 4K3HA 4HIQA 4G6AD 3E2HB 2QGCA 4P3CH 5FK9B 5J1SC 2R0ZL 1EX0A 4R7DB 3D2TA 4LSUL 3VVWA 2PYEA 2V2XA 4JDTL 4Y1AA 5DS8A 1ZHNB 5CUSL 3A6CH 2YPLA 1P7QB 3NUKA 2WP3T 1SLVA 2A9NH 4NNYB 3STZA 4JZOB 3VI3B 4QHNB 3RPKA 3FZUD 3U7WL 4U0QB 2ZP9A 3QFJA 1JXJA 3EZJB 1Q0XH 2DI9A 1BFVH 1BVNP 3EKCA 3F65A 3T3PF 2NVMA 5KYUA 5FGCB 5I6XC 1P4UA 1J8SA 5IROC 2QVTA 1CD1B 4HWNA 3VFOB 5E08L 4DP5X 1FA4A 4MZIA 4QIRA 5BQDA 3K6DA 1Y6NR 4R90L 3TV8A 5F7KC 3Q8EA 5IQ9A 4AMXA 5FKPA 2EH7L 3D7PA 5DD0H 1R1CA 5CP7A 1SRDA 2NY0B 1I8MA 1BXUA 3FQRA 3NRPA 3M7FB 4KNUA 5AAMA 3QEQE 4X0KB 3O8XA 2VN5A 4BJLA 4JAMB 1V7MH 1FAKT 2XZCH 4N9GA 1MHPH 4FA6A 4MNGB 1SUHA 2X9YA 3MBWB 3C5JB 2E8ZA 4UTBH 1Z9OA 2GSGB 2YBGA 5F2FA 4E5XB 2W81C 1HESA 3CN3A 2M26A 3GSVA 1VHPA 3HMWH 2NOBA 2LAEA 4KQ3H 5A2FA 2SEBB 3MOBH 3D33A 3OC5A 1K6QH 5DJXA 3H2QA 4DH2A 1MIEL 4QKXB 4IRSD 2IALA 2C3VB 2NLJA 1DBMH 3FCGA 2FLBT 5M94B 1T22B 3ZE0B 3U1SH 1F97A 3AU0A 4OGYL 3G6JF 1PCZA 1P9MC 3VE0A 3DARA 1Z5LA 1E40A 2VLRE 1I4FB 3FPXA 4HUVB 1T83A 5FYLL 1KENL 1BZ9A 3P77A 4NO5A 5DMYA 4XMPL 5MENA 4L3FA 2Q0ZX 4XB7A 4WSGA 1G7LA 4YHOH 3O6FD 1T0MA 3FO9A 5FA4B 3MJ7A 3OZ9H 1AKJD 4OCRL 2EYRA 3OC3C 5I8KH 4YHLH 2GJ6D 5I17B 1U4FA 4OB5L 4PRAA 3VRIB 5E95B 2ZD0A 5I5JA 4LPYA 1MXDA 1OQXA 2DWDB 2ZKXA 4MA7H 2QPEB 5DI8A 3UJJL 3PXHA 3I6GB 3NRQA 2AC0A 4R3SA 3L4WA 3THML 4F57L 2F53E 1OB1A 1FE8H 1IFHH 3V5HB 4AGLA 4L3CB 2BP3A 3K0WA 3SBRA 1NPNA 1ZIAA 3QJQB 4EZLA 3O41A 3ALPA 4FNLH 3PWPE 3S36L 3NPSC 3R06B 2NXZB 1IT9L 1DQDH 3D39D 2FX9L 2WINA 2YAPA 25C8L 2DMCA 4P2YA 5IROA 2OCJA 1DE4B 2DWTA 2E7DA 1FC2D 5CHNB 3KE0A 3CVCA 3ESNA 4Y19E 1T3FB 4A63A 4RMVA 1TYRA 4PH8A 5IQNA 2WLIB 1CZ8H 3HR5A 3HC3L 2Z35A 4DP7X 1UZ8A 3IVKB 4XCEA 3JZ7A 1MHEA 4P4KC 5I75C 1T2JA 4X5PA 2J7LA 5CJOL 1PF3A 2VLRA 5JHLA 1B0WA 1UM6L 3ZKMC 5FYJH 3BH8A 1ZSHA 1Z3RA 3TVMB 1DO6A 4B5ZA 4OW6A 1GGIH 1I1AB 3UTTA 3P3UA 4MGXA 5CCHE 1QSZA 1SYVA 1BWWA 4D0DA 3HI5H 1B9ZA 1QG3A 4DCQB 1R24A 5HYQB 1WH0A 1OM3H 4OT1H 1ONQA 2OR8A 1BEXA 5DJ2A 4U6VL 1OKEA 3BIKB 3QO1A 2E8YA 2B5IC 4CSPA 4C47A 3FQXB 3MBEC 2OYKA 3RB5A 4ZO9A 3BGAA 3NEEA 4M29A 3FTVA 1A65A 1SDAB 2F58H 2H3KA 4PJDA 1NC4B 4MJJA 1VADB 2JH2A 3FN0H 5FYKH 3L4XA 3ZDWA 1SN0A 3HE7C 4PY5A 1IZKA 4UT7H 4MJ5A 3C6SB 2IAMB 1KIPB 5E4EB 2NY4D 2J3SA 2A9DA 2OI9B 1P0SE 2BX5A 1IGML 1A47A 3EH1A 4ZPVA 3S5ZA 3NPZB 4JNXA 3B7YA 1A0QH 1TKWA 5DEFB 1FVEA 3IPFA 4Y19A 4OI7A 5T1MB 4KKCC 1B4JL 2LU7A 5K1NA 4KAQL 4RDQG 1HXMB 1P84K 1NKRA 1QUPA 3NDYE 4QHLA 4U6YB 4RMQA 2WZ0A 4E0RA 3LRLA 3ZUNC 3MLVL 4OD2B 2H3NA 2KUTA 1I1YA 4OD1L 1KLFB 4QOKD 2ICWB 2O6EA 4R8WH 4ZUVA 5DS1A 1JCVA 1G6VK 4YHKL 2X4NB 3CFTA 4LFHG 4PJEE 1CTMA 2G3XA 4MBRA 5CINH 3HKFA 2BWQA 3CC5A 4J3WA 3QNYA 4JDZB 1N0LA 4HP5A 2V5RA 4FQQA 5DK2B 2EUWA 2VXUL 4OD3L 4TM9A 3LNIA 3OB0H 3BPNB 3GPSA 2YSTA 2QGDA 4NM8L 2VN3A 1AIZA 2ZOTA 4WZSD 4NQTA 2E4TA 3K1KC 5KUMA 1P4LA 2JQAA 1Q9UA 4WO4C 4HEME 1K4CA 2ZUXA 1I8KA 4JM4L 4Z7QF 5HI5C 1FGVL 1DVFB 1IEAB 3MCYA 3WOVA 3PL6A 4YVUA 1RZFH 3QG6A 4O02A 3U4EA 3NJLA 2R4SH 5AZ2L 3O0RH 3JWNG 1AFVL 1DANU 3ERXA 3CHPA 3LN4A 5AQ0A 1XF3B 3C6EA 4LCIL 5T3ZD 5DYOA 5AB1A 3GXTA 3NJVA 2W95A 3BD3A 3KPSA 4JHAH 5DZ9A 4YXHL 3ZZQA 2JB5L 2I69A 4Q89A 2C3WA 1OAJA 5JW5B 3C60C 1C16A 3UCRA 1SMAA 4KJQD 3X12B 2XZQL 5DT1H 3GRWL 4GI8A 3HE7A 1TZIB 5TE4L 2FHBA 1WITA 4TQHA 3FQWB 1YC8A 1R3IL 3I9AA 3ZTJH 3V2AR 1K8DA 5ALCH 2O6DA 3GMRA 2AMGA 4HAKA 2W9DH 3PWJA 2OCCB 2L7QA 1VCAA 1XF4A 1J8RA 4HU8A 2R0WH 4S1RH 4LARH 1RUML 2Y5QA 5I1CL 1HXYA 2FVNA 1QVOA 3V4PA 2R1YB 4JVUA 4NKOB 4E9WA 4N5ED 1MWAH 1J8HB 4UAHA 5IEKA 2OP4L 4M3KB 2GJ6E 4HEMA 4HC1L 4J27A 4WTWA 4L18A 3DHMA 4MMYB 4B96A 4A39A 1A2YB 2AEWA 4AG4L 4WTXA 4PCTA 1UH3A 3VQ2C 1SZNA 2WWKO 4Q0XL 1EDHA 3V7AG 1IM3D 3X1GA 1QYGH 4OY9A 4DERA 4V11A 4IOFC 3I0WA 3WYRA 5K9JL 3ME0A 1KB5B 1MPGA 2ZQKA 5DZJA 3LNGA 4QTHB 2O6PA 3G6AA 4JRXA 5KYYB 3QNZA 3IXTA 1UVQA 4OFYD 1TQUA 5F1OB 3CMOL 1S9WA 3UADA 4WO4A 1REIA 4TNVK 1D5MA 2XTJC 3VXMD 1EPFA 4GRWB 1JTTA 1H3VA 4FABH 1P7QD 1Q72H 3SE8H 1W6WA 5JXAH 1GGUA 1ICTA 1AGCB 2QHLA 2JJSC 4JQXC 1G9NH 1NBYB 2A83A 4UQIM 1TO5A 3X11A 2HFFB 4F93B 3PGFL 2Y6TE 3DV4A 4PREA 1WYJA 2MOGA 4F58H 4PUBL 3C60A 1MZYA 1ZTXE 3DI2B 3KCPB 5KG9A 4FXGB 2GJZB 4PFEA 5IR1B 1BX2A 1F0LA 1OAYL 2F68X 3HHSB 4BZ1A 4H5SB 5E2WH 5BUGA 3DRQB 3VFVB 4DJMA 1F58H 5DRZB 3N5AA 1G43A 1KJVB 4PVLA 1FNGA 1P4BL 4XRCA 2CLVB 1F86A 4E9QA 5IJBC 3KWXA 3FO1A 1OVZA 1TXKA 4UM8A 5KVDE 5J9PB 2WQUA 4YS4A 2K4WA 1I8UA 5JHAA 3CVBA 2HG5B 4IMKC 4NIYE 1S7QA 1EO5A 3DPTA 3K6OA 1KXHA 2WNGA 5JTWA 3V5DA 5J12B 1ZHKB 4G8EB 4GBXC 3CWGA 4UCFA 3ROLB 4DVBB 4UTAH 1RULH 4M8RA 3LXAA 1JDCA 3F62A 3PV6B 1QAWA 4XNMB 4DUXA 5DFAA 2O1AA 3KM1A 5F8QC 4C7PA 3FO0H 4M6OH 5J11B 1JPSL 3MZTA 4NNPH 1LO2H 3SDYH 3NIDE 4HIEA 5T1KB 2G5BA 3BMWA 4X6CA 1SJXA 4JM2B 3RL1A 2J2ZB 2EEFA 4FEIA 4NOBA 3DPDA 5DVPA 1YZZA 1DANT 5A7BA 4POUB 5IHLB 3C5SB 4HS8H 4E42B 3QQ9C 5D7SL 2KLSA 1P2CB 5DDHA 2MTPA 2HH0H 5CILL 4CUCA 4Z7WB 3TP4A 5CFAA 2H1PL 3WLWD 2X42A 3G6JA 2QQKH 1LO0H 1CFTA 4LL9A 1CVRA 4A7SA 1TPXC 5B7EA 5K69A 4KRNA 2GEEA 5KUKA 3VGHA 3ZYOA 4GW5A 5HYFA 1VKXB 2ZSWA 1D5BB 4RSYA 3D69B 4JQXA 4Z95L 1O9VA 1QLRB 4ODXB 1QATA 1Z0MA 2XRAH 5G5DB 3DUHA 1S5HA 3EIFA 3N9GL 1HIMH 3RTQC 4FMVA 3T71A 5JIDA 5BJTA 4J3UA 3T04D 4X5LA 3ILDA 4IK7A 4WI0B 1KB3A 2FD6H 2MPVA 3DYOA 1EXGA 1KBKA 4JFHE 3CZJA 3G5YA 2UZPA 5AW6B 3V0AC 5ES4B 4LBEA 3VXUE 3ZMNA 1X5LA 2OW7A 4CKVX 3N43B 3CHXA 1Z2KA 4A38A 4AKQA 4XT1C 1F02I 3NGBC 5T3ZE 4QXTB 3VH8B 4H13C 1IGIH 2PPFA 5JQ6H 1FNAA 1VACA 1BZQK 5GGTL 4JCMA 4Y0GA 1FO0B 3WU1A 4IMKA 2E46A 4OZGE 4QG5A 3TVMD 3EH5B 4TNWK 3ULVF 4OIIL 3ZKQD 5F7AA 2VSCA 2WUBH 4HX1A 1MREL 2C34A 3D25B 1I1AD 4GBXA 4FI6A 4WGVB 2ATPA 1QZNA 3WE1A 1TDQA 4GT7A 4JY4A 4OZ4B 1HHJA 1N9PA 1VA9A 3STBA 2BZ7A 4TQIA 2RAMA 1H6EA 2WN2A 4I3SL 4AGNA 1KTDA 3PQYE 4B41A 2DJ4A 1G7PB 5GISH 4GQ9H 1NC4D 3AG4B 4AV5A 5IMOB 2A74B 1YEKL 3GJFK 2DTSA 4XC3L 3U2IA 1NCCH 2WZAA 1PG7L 3MLWL 4XVTL 3EAYA 2IAMD 3M1BB 1JGEA 1YCSA 2BSCA 2WQXA 3J27A 5IMKB 1JV5B 1LEKB 3S37L 1WBZB 2YEZA 4UILH 4JY6B 4OCXL 3POCA 1JPEA 4YDIH 4NGHL 4NWUL 4ODHH 2VDNH 4LGPB 3CE1A 4IBLT 3N44F 2GCYA 4Y4FC 1C5BL 1R4XA 4ZMTA 4LVNC 4HWBA 1JZ2A 4UQ2B 1ETA1 4JFDB 3ULUF 1CBVL 4Z7QE 5T1DL 2HZHA 5E24E 5DJAB 3U1QA 5BW7C 1N5YH 1MPAH 3RTQA 4GQPH 1EFQA 1CIDA 2DKDA 3SOTA 4WXAA 5K9QG 4HCGA 4M1GH 5TK2A 1C12A 3AJ7A 3SJVE 4ADJA 5F70A 3ZIYA 2OMUB 1WG3A 4W9JC 1NEPA 5TGBA 4I4WB 2E27H 4ZTPH 2X1PA 1JUFA 5E4OA 4PS7A 3VI3E 3ZMRA 5F88B 4HUWA 3HUJF 1RLWA 3BKCH 1TCMA 5JUEL 3C8HA 2ZCZA 3MYZA 1A64A 4K8RC 4Q56A 3TH3T 2AJYH 4ELMB 3KL5A 3NJMA 1QNCA 1FJ1B 2CO7A 1R5VB 3CPUA 2F54E 3EYUL 1T5WA 2FR4A 4KJWC 1QBAA 4G42A 2DLFH 3MX0B 1BLNA 4H1LG 2XLLA 3GMOB 1U8PB 1DVFD 3KR3L 4FZEL 1U8QB 4PLOB 1ZXQA 1BJ8A 2RR3A 2VLLA 1ACCA 4PJ8A 2ATKA 2X4OA 4MMXC 3QA3A 3RVXC 3WDIA 2W60B 2ZKHL 4BH7A 2BSBA 4BIKA 4BSVA 2FWOA 3ZHDA 2P44B 4GMTH 1U58B 1WAPA 4XMUA 1DJGA 5L2KA 2XT1B 5TDNB 4PWGA 1GSKA 1SXCA 3I84A 1CL7L 5CO1A 5FO2A 2XPZA 3J2PA 1TQVA 4ONFL 4OLZH 4WWPA 1NBVL 2OA9A 1AP2A 1YYCA 2AJVL 2DKMA 4HZLB 5AW8B 5B22A 5E2TH 1BWMA 4P2OA 3IAQA 3SJVA 4LKCB 2QV2A 1PD6A 4AIZA 3VSTA 4Y4FA 3ZE0E 4FQ1L 3V6OC 3FRPB 4OLWH 5DVKA 2YZ1A 5MERA 4Y88A 4AXWA 5AVQB 3DOSB 1F6AA 3BAKA 3BAWA 3EBGA 1NEZG 2BVQA 4N3TA 4XB3A 5BW7A 1CPUA 1PEWA 2R0ZH 5D96B 1KLGA 2F54A 4LSUH 4ERSL 1JHTA 2YPKA 4JDTH 5H37A 1J8HD 5CUSH 1OGTA 1Q9WA 2PO6C 3BEVA 3ISYA 4LU5L 3WFDL 4AQ8C 3MKKA 5J3HD 4XO5A 5DJCA 3N40P 5KVFE 4FG6D 3RPIA 1FZMB 4JKWA 4LVOC 4A2DA 3F5WA 1D9KB 3LIUA 1FN4A 3U7WH 4HWEL 2Q7NA 3OZLA 3SPIA 4WU5B 4X8JA 5HP5A 1JK9A 3WGVB 5AW3B 4IIQB 4NAJA 3GB7A 4JRYA 4L1DA 5B1JC 5I1LA 5D7LD 3QR2A 4G9FB 1QTYT 1I7ZB 3O4OC 1UACL 5E08H 4J2XA 3GSNL 3ZIMA 1D5XB 5CBEA 1QLFA 1QSVA 1E4WL 4PWEA 2EH7H 5G4NA 2WCPA 3APFA 4BSWB 4NRYB 3TJHD 3CZLA 3MLRL 4DEUA 3HPLA 3OMNB 5C2UB 4OCYL 3LKPB 4NDMB 3TL5A 1EA9C 4MMXA 4GRLB 1G4RA 5F1KC 5JHDB 5LNDA 4JX0A 5ERWB 4KK6D 2GUOB 1PJWA 4JM0A 3VRJB 1ND0B 2JIXB 2XX1A 4M62L 5C7XL 1U2YA 1AS8A 4CL7A 2X28A 1UD6A 4AENB 2J44A 1GOFA 4U4IA 1OOAA 2XWCA 5E9NA 1PDKB 2XN1A 2A4EA 3NCEB 1MIEH 1M6OB 4MRCA 2W9LA 1E90A 1ETJA 3I02A 2QJDA 1QN8A 4ZJ9A 4Y5VC 1O6VA 4OGYH 4D9LH 1ADQL 4JRWA 5JHBA 4JFYB 4KMLB 3B6SB 1S7VB 1CGXA 2JJWA 1OHZA 4IDJL 4JBSA 4J8RA 4X7SL 5FYLH 1KENH 1SQMA 3H9HA 3MTRA 3ASNB 2FECI 4XMPH 3CU7A 2YPLB 3MUHL 3QUKB 4QXVA 3FT3A 1NGYB 3BGMB 3GHPA 3W39A 3WO4B 1BXAA 5AEAA 5SWQA 4OCRH 4LLQA 5F7EL 5HGAA 4PJ7F 2PW1A 2WVSA 2IPTL 3QFJB 4N2IA 5D2NE 5CJ5A 4L9LC 4U0RB 3UJJH 1JZ6A 1BA9A 5KYUB 2PO6A 4AQ8A 4LEBA 4AYBA 4FA7B 1VGKB 4X6DB 1GYUA 3THMH 3ET9F 4F57H 2NTFB 5EOCL 4OGZA 2Q87A 3ULVC 4Y16A 5D7JC 5T1KD 2JKXA 4JM2D 3BP5A 1MFEL 5B1JA 3SDAC 1IT9H 3FQRB 1OTTC 1A6WL 3GDBA 1XGPB 2CIIA 2FX9H 25C8H 4WJG3 1U92A 1ORSA 1E6JL 3D4ZA 4FMKA 4TNFA 3U9UB 1Z5YD 5GZOC 1IB5A 3BEWB 4D9RD 3HC3H 4YPGB 3IXAB 2PXYA 2VLKB 4WFEE 2V33A 5CJOH 1KBBA 1KXTB 1WWBX 1UM6H 4GQQA 4KTDH 2P5WB 2IALB 4XPAL 4DPCX 3FCTB 4HGWB 1H15A 2DLGA 2F7IA 3CCHA 3RUGB 2C4XA 1NPUA 4XI5D 3SEPA 1WICA 5D2NA 1M56B 2R56L 1BZ9B 4UAOB 4U6VH 2HXAA 1YAIA 3X17A 4CA4A 5MENB 2B4CL 2FUQA 1T0MB 2VZUA 1VZIA 3MUY1 5D1ZC 1DQJA 3VXNA 4IBSA 4Y9EA 4RZCA 1X7SA 2XBDA 1PMYA 4FTVB 5IJDC 3WKYA 5DI8B 2NW3A 4Z7OB 2UWEF 2BSSB 2EABA 4GAYA 2J73A 4GJTB 3UW2A 1IGMH 3V0HA 4XN9A 5HHMB 5EULV 2FJSA 1MG3C 3T2OA 4OV5B 1B4JH 4GW4B 4L9LA 5T33L 4KAQH 3KPPA 4JHWL 1CN4A 5IMMA 2D0HA 3LKNA 3MRCB 3ZX1A 4QWWC 2XXGA 3ULUE 3OKNB 1XGTA 3MLVH 4FQPA 4F15C 3NT0A 3DX3A 3GS4A 4X6FA 1DHKA 1AXTL 2X0VA 1V3JA 5EPMA 1JZGA 4YHKH 3T4AB 3PPSA 3E6HA 5CEZL 3TIEB 1UZ8B 3VFWA 1DBJL 3FB5B 3MCKB 4PWHA 1MHEB 1KJ2B 3GJFH 4XCEB 5GGSA 4HK3N 2BERA 3T3MB 4Y9BA 3IDIA 5D4JA 4NRXA 3O3DA 2VR6A 1TG8A 1XIWB 3M46A 1R33A 4PJIF 5TQ2L 3V7MA 1BW8A 5DK0A 3CZGA 2YH5A 5GZOA 2VXUH 4KO5A 4OD3H 4GKOA 4ZOEA 2Z93A 3MJ8A 3TJEL 4D0DB 4ZMNA 5FGBC 4NM8H 2NUTA 1NUFA 3QJUB 3MJGX 1R24B 3BW9B 2BSRA 4XO8A 5FO9A 1O5PA 3GMPA 4JFDD 3X1EA 4DF9A 2WOYA 1FV1A 1KLUA 4TTDD 4CC4C 2X09A 1ZHBA 4JM4H 1FGVH 4PJDB 3HR6A 5LBGA 3A0OA 4XB8A 4ZFQA 1ZS2A 2IWFA 1Y0LA 5AZ2H 3WIHL 2LTQC 2ROYA 2F8IA 1AFVH 2UXGA 3Q06A 1H8LA 2FH8A 1R17A 1KPRA 4F7CB 4LCIH 5DJYB 2GY5A 2DW5A 4EAIA 4ZPVB 3MGOA 4YXHH 1G6RB 2JB5H 4KV5E 3FRUA 4L4JA 4LK4A 1ZE3H 3V0FA 2XACC 3QULB 1TKWB 2HJLA 1C7SA 1T03H 4Y5YB 5FB8B 2XZQH 5C09E 3GRWH 4IS6B 2HUEA 3WUWA 2XYCA 4TLUA 3IWUA 1A3QA 2YAHA 3QC6X 3LNFA 5TE4H 3KEHA 4WI6A 4HD9A 1U6AL 5HJBA 1E5BA 4E0RB 1ZXKA 2FHFA 1R3IH 1CFVL 2ZUQB 4F7PA 4Y4HC 6TAAA 2WWMD 3T2NL 3GKWH 1U91A 2D3NA 4FL4C 5I16B 3GSWB 4PJXF 4JRFA 2BWDA 3HUJA 2DEYX 4P2RA 4MQXC 35C8H 4YH6A 5H2BB 4GMSL 1YMMA 3VGAC 3B9VA 3K91A 4PJCF 1N5AB 1RUMH 5IM7A 5I1CH 3P0GB 1VFBB 1AGDB 3CSFA 3QNYB 2VTFA 3UPRB 1LMKA 1PLBA 1U8KB 4FQQB 1NH6A 5LVEA 3CWSA 4PJHB 2CHXA 4PWIA 5ESAA 3MNZB 4HC1H 4KH9A 2P8LB 1P5DX 4P4KB 1PX4A 2Y2YA 3CPLB 3FU6A 3F8UB 4IOSD 4W68A 4XAWL 3RPBA 4AQZA 1UXLA 2DL9A 1I1CA 1QN6A 4PCSA 2DKUA 4AG4H 4HKJA 3M86A 1C5DA 1MNUL 4P4RB 3S8FB 1MJJA 4Q0XH 4HFWA 1A25A 4XC1L 4N3UA 5TDPA 1R3LA 3HCVA 4WUKH 3ATBA 1KIRA 2TSBA 5FV1L 3U36B 4DAGL 5K9JH 4TULL 2FHCA 3QG6B 3U4EB 2ZOKA 2VDQB 5IEHA 2BW5A 1XSZA 5C09A 3TCLB 2X9XA 2VDRB 3CUPA 4JMNA 3CMOH 3JZYA 4QHMA 3B2DC 2HMIC 3MRBB 2JB6B 2XDHA 3MBEB 5AB9A 4CC4A 2Y7QA 3FUNA 5AB0A 4HUMB 4RGNB 1WD9A 2XWBA 5ECJE 3HG2A 4ZW3A 1A4JB 2F1AA 1PIGA 3O81A 1IGTB 5K59F 4WHTB 1IAIL 3SY0B 1O5DT 2XQYK 1D9KD 4OVVA 2X2UA 3PGFH 4XO4A 1I53A 1IO4C 5FHAH 1QFWI 4QI3A 4PUBH 3AAZB 3GS0A 1RXLA 2K7PA 2X3CA 3P73B 4XP5L 4OQTA 4NQDB 1ZA3B 4G9FD 4S1SH 1NFDF 1IGCL 1XX9C 4J3TA 1TQSA 3VTMA 2D2CC 4Z7UF 3MFGB 5BOPA 5EU3A 4Y4HA 1FCCA 1JXGA 1KWKA 4LDCA 1QWUA 1VB9A 3V4PB 2BRRL 1F56A 1P4BH 1QPPA 2N0MA 5G55A 2C3GA 5MHSD 4W9LC 1QWNA 2XETA 1FBIH 1CXEA 4GRLD 2CHWA 2PP9A 1JGIA 1KPUB 1XZWA 4ENZA 5JZ7C 3WY1A 5JHDD 4AEHL 3JV4A 4FLQA 4Z9KB 4PTUB 1CLOL 2G3ZA 2JIXD 3F12A 3KLLA 1U0QA 3ETBF 3KBEA 9CGTA 3VXPA 2QSVA 4KDVA 1AD9A 3F7LA 5TK4A 4J1UA 2ZSVA 1G84A 4R26L 4HKZA 5D72L 3SE3C 1U8OA 1JPSH 2H32A 4JREC 4Z0XB 1HILB 4N8VA 5KYXB 3BIAX 3DGDA 3L48A 4JRXB 4OZHF 3TU6A 4NRZB 3SGDI 1WDAA 5B8CC 3MRRA 1DCEA 1S9WB 1SM3L 1T7XA 3CLFL 3D0LB 3DTUB 5ITBL 2CM5A 4LSRL 2ICCA 3IETB 4WO4B 4ZS6D 1AKPA 4W6YB 2ZXDA 3PXLA 1AC6A 4HK3J 4J4PC 1MAJA 3KLHD 3PJSA 4Y1AD 3B9KB 1CLCA 1WF5A 2K0RA 3HC2A 2YPLD 1HK6A 1N6QL 3AT9A 3BZEA 5D7SH 4Q9CA 4AQ1B 2AJZB 3GIVA 3Q3GA 1MW1A 2F19L 2GAZB 2ZP8A 5CILH 1ZD6A 2CNYA 2H1PH 4BKLB 4WAFA 4RRPA 1EAPA 2V9TA 3QFJD 4RMSA 4YC2C 3ZT5A 2NNAB 3Q1EA 3UAJD 1QEWB 5F9AC 4GNKB 5IVXE 2FKMX 4BRJA 4Z95H 2D3VA 3KYNB 4PW9A 5FOJA 2VRQA 2R2CA 1TIUA 5KBDA 3N9GH 2FBRA 1W8NA 4PJ7A 4G7RB 2PTTB 3ETSA 2VERA 3IU4L 3T0EC 3MAWA 4TVPL 4K5OA 4HIXL 3T0AA 2EDOA 1AZUA 2MHAA 5FFLA 4TQEL 4A6YH 5DGQA 5DSCA 2Y4SA 5E00A 2Q3XA 3T77B 3O8XD 1ZS8A 5B1AB 5EN2A 2D7QA 5HHQA 4B9IA 5DJDA 3K71A 3KNBB 2QTVA 3UTPE 1YJDH 3FO2B 1F2XK 4B9GA 1ODUA 4HUXA 4K7FA 5IWLC 1TR7A 1L0XA 4QMEA 4KNQA 4GRMA 4HIJB 5GGTH 1BPVA 1WC7B 2HUHA 4PJBF 3WIFA 1LK3L 2P5WD 4OIIH 1W72A 3KVPA 3N6YA 1MREH 3VD9A 1CC3A 5FM5O 4K7PL 4X6CB 4R4BB 3V6ZA 1Q94B 4JW3A 2OX5A 5J6SA 2WVUA 3BE1L 5HI4D 4H0IA 3JWNH 1V5SA 3SE3A 4NWTL 2GB2A 3VD4A 1RUAL 4N86A 1RJCA 4TYUA 3X3FL 3AS1A 4PY8J 5MEND 4I3SH 2HJFA 1UATA 3W0WE 2PABA 2X6UA 2KLRA 3FONB 3TIDB 4BH8A 5B8CA 4YR6B 2IWKA 1RJLA 3UACA 1YEKH 2XTJB 4J4PA 2WPGA 5DD5L 4FFWC 4APXA 3K72A 4PBVC 3FSAA 2FO4A 4FTVD 2EYTA 1PG7H 2XNAB 3MLWH 4PJIE 2X4RB 3CV5A 4XVTH 3WN5C 2VR3A 4W9KC 1W8OA 1ILUA 5HXMA 2J57A 2CLRA 4OCXH 3DO4A 3OKMB 4LP8A 2WO3B 1INDL 3H6JA 4NGHH 4NWUH 3OAUL 3DXAE 1TZHA 2BHYA 1OPOA 1C5BH 1ETB1 4OF0A 3D08A 3QGVA 1HE7A 2DS4A 4HAFA 3IK2A 3MMEB 3QWRA 2UWEA 4EMZA 2CCLA 4WI9A 1CBVH 1AAJA 3QUML 5T1DH 3DVNA 1HS6A 4CGUB 4EUPA 1I8AA 1BGXL 2Y6SC 2Z9TA 2BP0A 4MDJB 3T0EA 4JFUA 3MUJA 2GI0A 5C1MB 3QH3B 2F61A 4UQ9A 4O2EB 3GK8H 3G04A 1QP1A 5I0YA 5IJCC 1I1FB 3MRMA 1XIWD 2BIMA 1CLYL 4EI5C 4MJ4A 2WQSA 2DN7A 3VXRB 2CLZA 3UTTD 3W0WA 2JWYA 3A23A 1W15A 5LGJA 3AWGA 5IWLA 2AXGB 2KHAA 3HNVL 3L3JB 5JUEH 4MDIB 4MXQC 1GYAA 4OZIF 3EADA 4J3OG 3TBWB 4EXPX 4PJIA 3EYUH 2FBJL 4IBZA 3I74A 1KTDB 1L9NA 1M2VA 4PJXE 4AVKA 2A77L 1JDAA 3CGTA 3QJHA 3KR3H 1XXDC 2L3BA 4FZEH 4RIRB 3DTXB 4PW3A 1IM9A 1MI5B 3TEZA 2ZKHH 2WZPA 4UIKL 3O2DA 4XNYL 1JGEB 4AH2B 3DJRA 3P4NB 2C9AA 2MJ7A 3QXAB 1SHWA 1IKOP 3LIZL 4ODSL 5B38B 1CL7H 1TTFA 3BT2L 4NT6A 1U2CA 3J7HA 3GNML 1BEYL 1NBVH 5ICXB 1TPXB 2ED7A 3X13A 3WN5A 1T66C 3DIVA 2AJVH 4AQEA 2BNRE 5D1QC 2VITB 1KPVB 1OD7A 3DHJA 3GSRA 3FHQA 3RGVC 3S3SA 2EVJA 4R4ND 1JK8B 3ZHFA 1X9LA 1U8CB 4OKVB 3HN8A 2L0DA 4FQ1H 3NTCL 1UHVA 5C70A 1LWJA 1QTSA 4NOFA 1C12B 4KC3B 2NYZA 5JO5A 4HJSA 2O3OA 4PN6A 1TQBB 3OPUA 1ZLSL 3SPGA 3GD1C 4PG2A 5EOCJ 4PJXA 1O7SA 5LNEA 1THAA 3DWTA 2DZEA 4LEXL 1QBML 3NGBB 4LU5H 4I3RL 4PV8A 3JTSB 4P4KD 2HT4C 1NGQL 4PBXA 4PJCA 3ZKMD 5ENWA 1J05B 4HWEH 5MEPA 4LKXA 3P2DA 4EI5A 4LLYA 1SVBA 4X6DE 4RH4A 4G42B 3QQNA 2MKWA 3LVEA 5KJ7E 5DFVD 1JXFA 4OFVA 1UACH 4Z7UE 3GSNH 5K39A 3MLTB 2QMKA 2HLAB 1OSEA 2IADB 1E4WH 1WA2X 1J18A 3UTQA 4BSVB 3U79A 3JVGC 4LOUC 5A40E 5I28A 3EJJX 3MGAA 4HJ0C 3MBED 2BNRA 4M02A 3MLRH 4NHCL 2WXOA 1CDIA 3MRJA 2WANA 5L2KB 4RGND 1SXZA 4OCYH 2ZYRA 1L9OA 4FJ6A 3G5XA 1ID2A 1KIQA 2ARJA 4K07A 4ZI8A 3BWZA 1TSHA 2GVYA 3H53A 3HE7D 5I9QB 4G82A 3SPJA 2VLKE 1AP2B 2GEQA 5CP3H 1XSKA 2CRIA 2I24N 2MTAA 4M62H 4NPYB 5C7XH 5DQJB 2FWUA 3FU9A 1RZGA 2P5WE 3BZFB 2LLNA 2BVPB 2QLVA 4KKCD 1JNNL 1QN5A 2QREA 4NQDD 4G8IB 3RUGE 1A02N 4YDJA 5I1AB 4OZHE 1J8KA 2APSA 2FJFA 2XN9E 1N0XL 1JZ4A 1OE3A 5F0MB 2HKPA 2CKBA 1VESA 5D1QA 3UZQB 1QHOA 1ADQH 3RGVA 4Q9RL 1FH5L 4PM1A 4X7SH 4YO0B 5EIIG 1WQAA 4IDJH 2O6CA 5L7XH 3BIBX 3QDHA 4GO8A 4BINA 3W1ZA 3VXSB 4G11A 1NFDA 4GFXA 1S8DA 1JTPA 4A1RA 1BQSA 2GPZA 4I89A 2AJ3B 4Z7UA 5F7EH 3ZDYF 3C8KA 1TQTA 1TTUA 2AEIT 1FN4B 4OM0L 4KI5F 2IPTH 4URKA 4QTFA 5HGHA 4JRLA 1G7JA 4R5TA 4X8JB 1JK9B 3LZQA 3R4DA 3NFPB 3GB7B 4JRYB 5HHME 3RWDB 4E5XG 5LAPA 4UNVA 2ARJQ 1FSKC 5I1LB 1WP6A 5EF0A 1CE6A 2ZOOA 4NLAA 1WRFA 3NIFB 4H26B 1NKGA 3L5WB 4JRXD 1FI8C 4MHHI 4NKDB 3ZT6A 2RCSL 3C5ZC 3IJHA 3UG5A 2OJEB 4C56E 1ZT4B 1DBAL 1MFEH 4WO4D 2X4SB 1LYQA 5HI5D 1HT6A 1A6WH 3RWJB 5HVHC 1QEXA 2KERA 1LP9F 1XR9A 3B9KD 4I5BB 4S1DC 5GRJL 4YSUA 3DK0A 5FW7A 1E6JH 3WY2A 4G1MB 5HHOB 1Z3GL 4OZHA 4AGQA 3QCUL 5E99L 5CBAB 4G6ML 4HKBA 4EN3C 5C0CA 5IIEB 4M1CC 1EHKB 2EDQA 1UYWL 4EDWL 3HC0B 4PJBE 3U0PA 2FQDA 1PW3A 3ZHKA 3W11C 1CDGA 3HZYB 4XX5A 4XPAH 1WCBA 2NOLA 3WMQA 3DRTB 3TV3L 5IB3B 4YE0A 2NOZA 1EFXA 2ZX7A 2FX7L 4M48L 1S7WA 5LJYH 3BRDA 4G1EB 1U8JB 2R56H 4L48A 1H3UA 2CUMA 2OFQA 4Z3IA 1YEGL 4I0PC 3ARUA 3ISRA 3RRQA 4IMLB 1NJ9B 4W4OC 1NCGA 2ZWYA 4LLQB 1URZA 1IGYA 5HGAB 2UXTA 3TOPA 4X6EA 4I18B 5E8OB 4JZJC 4LSDA 5DWPA 4HPYH 3B1TA 3ZL4H 4H1LH 5KSUA 3HW7A 2DJSA 5EC2A 3N89A 1NCIA 3DPBA 5T33H 2P45B 4IEFA 4JHWH 5BZZA 3P4OB 3EOYG 5EZIL 3BP5B 1FYTB 1UQSA 4IOFD 1GA2A 4OZFA 2CIIB 5ALBL 1EIBA 5I1KL 1OOWA 4QRPB 4ZFZA 1U92B 1ZGLB 3HG3A 5HYSG 5B21A 2IO5A 2X7LB 2Y24A 4BE6A 5BQ7B 2A38A 1KOAA 5GS2D 4DPRA 1MWAB 1AXTH 3FB6A 2ZNXA 4HCIA 2WLMA 5AVVB 5CEZH 4U33A 1DBJH 2E3VA 2R2EB 2LLLA 2XTJD 1R5IA 4OLYL 4F2MA 3DX7A 1WA0X 4FFZL 4HJGB 5GRUL 4YHNB 5DWUL 4PJHE 5TQ2H 3TDHA 4K9JA 4ZUTA 3RTLA 4NQVA 4NO2A 3SY6A 4HBCL 3TO4C 1H15B 4EN3A 3G5VA 3NCJL 3TJEH 4Y8AA 1OZTG 1C4GA 3STLA 5B7FA 1N39A 3ARDC 1ACYL 3K6NA 3WNPA 3L1FA 4YL4A 1CFSA 3MRFA 2VXTL 4Y5VB 2C3XA 3CDZA 4KTGA 2MNJB 1NFIA 2F9BT 1DQJB 5ISZE 2GBUA 2IFGA 1LEGB 4H8UA 4Y8DC 3WIHH 2XY1A 1G9ML 3S3BB 4XVOA 4I0PA 5F7BA 1S7TB 2WXFA 3H9SA 4W4OA 4JFQA 1Y6MR 2Z7WA 3HS0C 2DB8A 4IKKA 4WV1A 5LBVA 3SKNA 3SN6N 3VXRD 4UT6L 2EIZA 3ML8A 4BFKA 2JXMB 1TVHB 2WOBA 1NAML 4JZJA 1C08B 4MB5A 3BN3B 1E50A 1U6AH 2YD1A 4FG4A 4ANKA 3HTLX 1CFVH 3TBYA 3PJLA 3T1FA 3MRPB 4JUTA 3FCBA 1RJYA 3T2NH 3IM1A 1UXSA 2W07B 1UCBL 1DDHA 2WXGA 3BO8A 4ZZKA 2W92A 4GI6A 5D7JB 1BVZA 4FOMA 4Q4IA 3E6HB 3SDAB 4MZ2A 4GMSH 4RQQB 1SF5A 4N2DA 1MI5D 2CJ3A 4OZIA 4TTGA 4MZ3A 1I7UA 5F1NA 3QQ9D 4L37B 5DTFB 2EUVA 5C2BL 5FOBB 2UZIL 4KBPA 4G7YL 1FL5A 3NIGF 2Z93B 1CICB 1E9OA 1IIIA 1S7SB 4L8DB 5DD3L 4KH2A 3GMLB 4XAWH 4TPRL 3ZLQC 3B3IB 3K3QA 3A4FA 3J8F7 5L9DL 1L0QA 1JWMA 5J6GB 4XC1H 3LNHA 3FB8B 1TTAA 3NCCB 4F7EB 2XWTB 2OMZA 3FCSB 1S5IL 4DAGH 4QYOA 5DMGC 1CGWA 4TULH 1GOGA 2VISB 3N44B 4BQCA 2NZ1A 5JPMB 3VGDA 2ITFA 2R23B 1OLLA 3REWA 2EE6A 4ODUA 2XJKA 2UX7A 2Q76A 3JV6A 4UQDA 5EC1A 2NQCA 3F6IA 1GVIA 2AVFA 4RRPM 5HYJE 4ZNEE 5ABDE 3BKML 2P3YA 1KZYA 3FRUB 5D1ZB 3S8WA 1CR9L 2HJLB 4FJZA 1Z1WA 1ODAA 2GABA 4FJYA 1S9VA 2YWZA 3E0GA 1OV8A 1BF5A 3WUWB 3RI5K 4FKKA 1MW3A 3QPXL 1U95A 1IAIH 1YEDA 1M05B 1ZLUK 3HS0A 2EDEA 4IU3A 1J48A 3BVNB 4EO5A 2AHIA 3WD5L 2N01B 4KI5C 3VXQB 4B9YA 1M4KA 5KSVB 4XP5H 1T1YB 1JYVA 3U4BL 1F1GA 1GW6A 2WB7A 1VEPA 3G6DL 4NKMB 4P2RB 1IGCH 3M8OL 4OGAC 1YMMB 2ITDB 2J20A 4O58L 4LHUB 5IM7B 1J12A 4JFXB 4Y5XA 4LHJB 1IL1A 4XWGL 4AJVA 4UWQB 1J0ZA 5IVZB 4EPSA 5J56B 2BRRH 1WIOA 4XN2A 4AGMA 1FFPB 3F05A 4WI8A 1QX1A 2HTKC 4F1SA 5C0EB 5L2KD 1UEYA 3GSUA 3S4SA 2TSAA 3Q2CA 4HWZA 5KANG 3EAKA 3ESUF 2EIKB 4KI5E 2ZF8A 5AW4B 4AEHH 2IG2L 3N40F 2G9HB 4BZYA 5C0DA 1CLOH 1Q8MA 3ESOA 2YN5A 4JLRB 5HYJA 5TDPB 1FFTB 2B3IA 2HN7B 1RMFL 4WKXA 1KIRB 4R26H 1CE1L 2YXVA 5D72H 1ZHLA 2I9LB 2YD2A 3O3BA 4KMTH 4KHTL 5E8NB 1JPGB 2FCBA 5I66B 2QRDA 1JWSB 5B4MC 2UY6A 2HVKA 1G0DA 3LOWA 5EU6B 1XF1A 1FZJB 2V9QA 4LLAA 3QUYC 2FYYA 3CLFH 4NPKA 1SM3H 1TVBA 5ITBH 1SOQA 3OX8A 2B16A 4LSRH 3I75A 2OJ1A 2EO7A 3I6KB 1E9QA 4QR7A 1UJ3C 1TLMA 1A7RH 3ZO0A 3VXSD 4NZUL 1UA7A 2ADJB 2LTQB 2P5EA 4U1IA 4BE5A 1N6QH 5IYCP 4JG0L 1N3NB 2F19H 2OMXA 2FJHA 4JKLA 3JYCA 4W9FC 3ZJAA 2AERT 3D30A 3NJIA 4ODVH</