1KYFA

Ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
total genus 67
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1kyfA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1kyfA02
1QNBA 2E9GA 1GYWA 5CN2A 2VJ0A 2YMTA 1QN4A 1NA8A 1R4XA 3H1ZA 1KY7A 2Z8UA 3OCIA 2G30A 3ZHFA 2MJ7A 2D0BA 3EIKA 4ROEB 1QN8A 1TBPA 1QN5A 1IU1A 1QN9A 3OC3C 1KYDA 1QN6A 1KY6A 3HS9A 1P4UA 1TBAB 4BCXA 1D3UA 1AISA 1RM1A 1JFIC 1QNEA 1YTBA 1KYFA 5CN1A 1PCZA 1YTFA 2D0CA 1QN7A 1E42A 3HS8A 1B9KA 2DWYA 2A7BA 3ASMA 2DWXA 5IYDP 5IYBP 4WZSD 1VOKA 1QTSA 4B0AA 1VOLB 2IV8A 2IV9A 1VTOA 1CDWA 3MNMA 1PZDA 3ZY7A 4PY5A 1VTLE 1QNAA 4ROCB 1QTPA 1QN3A 1C9BB 1GYVA 1NGMA 1MP9A 1NH2A 1KYUA 1W80A 1OM9A 2D0AA 3VN5A 1TGHA 1NVPA 1QNCA 5IYCP 4RODB 1GYUA
chains in the Genus database with same CATH superfamily
4AQ8A 3WNPA 3RDTD 5ETUA 1NKRA 3ZE0E 3WCYA 4K8RD 4IIQA 4EXPX 2HCZX 3CUPB 1U3HC 3QCVL 5DVOA 4QHUB 3KG5A 3EDJA 3VGBA 1MQKH 2YA1A 3PAZA 3QUYA 2WLLB 1J0KA 1CG9A 5AVSB 5T3XH 4NJ9H 1CTMA 4QWWC 1UXSB 4P4KB 1G7IA 5T3XE 4KZDL 2FX7H 2MRYA 3CQQA 3OKOB 1A6AA 2E8YA 4ZS7L 3WFZA 2XUWA 4R4FL 1SQ2N 4M43H 3RVUC 2CBMA 4ESKA 5HYSA 2PWDA 3IMVA 3D50A 3QRGL 3T3PF 3ZGHA 3FT2B 1U8JA 3Q1SH 1DQDH 4AIOA 3OKMB 2KQNA 4EI6A 1UJ3A 2SEBA 4D9QD 4XMLL 3E80A 3QXWA 5DD5L 3NGBB 3C8KB 2FJGB 3DXAE 3KH4A 4YHYC 4OFQA 5EBLA 4JQVC 5C0FB 2OMBA 2J73A 5DJ2A 1WBZA 4O02A 4AH2A 3AY2A 5HGHB 1FAIL 4QHKJ 3GZPA 4DERA 3S96A 2VCOA 3HC2A 3IDIB 2Z8WC 4CAGA 1SYVA 2Z31C 3MLXL 4NC0B 4KUZL 2EDRA 3UTSD 1QPKA 4MQSB 5C92A 2OAAA 1KIRB 5ELIA 3WJLA 4JPIB 4ETQA 5J6GB 1SM3H 1U42A 4JY6B 2X70A 4M1DH 2RCSH 4ZO7A 3ARFD 1TQCB 1A7RH 1BQ5A 2AKRB 1ORQA 2BIMA 1MVUA 1RHFA 2M2DA 3P02A 3VD0A 2EDLA 3H3KA 4WWKC 4I9WD 2XYBA 4PJEA 5D5MF 1D7FA 3WAKA 5FIEA 1C8PA 4ZUUB 4KZ0A 4RH4A 4XBPA 5IW6B 2D3NA 4JKLA 1QI4A 3BN3B 2KERA 2J71A 3CFEB 1DANU 4HLZG 5DYOB 3GBEA 1ASQA 4YBLB 5FHBL 1NCJA 4AQAB 5JUEL 4HWUA 4GBXA 2HVJA 4G6FD 3FOMA 5D6CA 2UXGA 3GJFK 1DBBL 3B9VA 3TZVA 2FO1A 4CSPA 3UZEC 5ISZA 3VFPB 1AS7A 4OZHB 5BW7A 2IH9A 4PJ9B 2VAAA 4MNQE 2ICWB 2OJEA 1OGTB 3EO1B 2PW2A 1OAJA 2O6CA 4I0PA 4LKCB 4U6VL 5C0AA 3IDYB 5ADOL 2FATL 5JNYA 5GJSH 5HDBB 2YKLH 4PRIE 4WKZA 3L45A 4PVNA 1VGEH 3DUUB 4HXAL 2EXSA 3SCMD 3D08A 3UAJD 4LLVB 3LN9A 2IOIA 3BAWA 3FB5A 4IEFA 2WCSA 3LKSA 2WIMA 5ICUA 1WP6A 4PREA 3RJDA 1NM9A 4MD4B 4ZAKD 4CUCA 1IGYB 2J5LB 2P28B 3U9UA 4RFEB 5CZXC 3M17B 4NWUL 2UXFA 2N0KA 1K2DB 5BMFH 3A21A 4J5VA 3MNWA 2OMWB 2JQZA 4POYA 1K5NA 4Q7DA 3U4BL 4PJ7A 4Y4HC 1JGLL 5JXED 4ZFZA 4WHTA 3S3CB 4R6UA 2ZOOA 1GGIL 2JCCE 1SDDB 2DZEA 2HN7A 3RNKB 3OR6B 2DL2A 1Z9SB 1E9QA 2AQSA 3FMGL 5F3FA 4IL8A 4XMXA 4KU1A 4E5XA 1AE6L 1ZGLP 1F3JA 5HGBA 3K6SA 3QG7H 4PJCB 4I3RL 1U8PA 2G4EA 1HEJC 5F9AC 1RZJC 1E4XH 5LBSH 1UD4A 1IAKA 4JRYD 4EIZC 4F8NA 4GG6B 4L48A 12E8L 3CAFA 1KENH 3D33A 2WKOA 4WV1A 2NX5D 2H8PB 5D4JA 1D9KB 4JMNA 4UT7L 2GIXA 3VGDA 1XB3A 1U8MB 2OSLB 4PRDB 5FYJD 4QYOB 3WIIH 1USQA 3DO7A 1WAEA 2VR6A 4LMQI 1J5DA 1I9JH 4OGYH 4TRPL 3RB5A 3WFHB 1LE9B 4APQA 1YY9C 3O2DA 3TBWA 3O6ML 1HKLH 2BY2A 8PAZA 2CLZA 3MAWA 3BXNA 4K5LA 1NC4D 3VD3A 3ULVF 4ZXBD 3V0HA 3ZT5A 4YDKH 3PWPE 3CD4A 5KJ4A 4YSSA 2CRIA 3NJIA 3U4KA 2ARJQ 5IVXF 3WHXB 1D6VH 7FABH 5IR1A 3J2PA 3J8F7 2JXMB 2IV8A 4LL4A 3CBKB 4UV4L 2FK9A 4F33A 4M3HA 2DWEA 4DETA 4DN4H 3LN5A 3KM2A 1JGDA 1YEKL 3W5MA 4UYPA 1G6RA 3BUQA 5J0BA 2I9TB 3BAXA 5FM5O 2KPWA 3FRUA 3WUWB 5DQJA 4YSRA 3TWYA 2FLMA 4BM7A 3BFWA 1AZNA 3PHOA 3L4VA 4NN6C 3DOHA 3V6FA 3RURA 2FIKB 4Y1TA 1IT9L 2CSPA 3PDGA 4EZKA 4BD4A 2GAZB 1YEIH 4GW4B 5DWPA 5L7XL 5FHAH 1EDYA 4K8RC 4LP4A 3L3DB 3NCCB 4TV3A 1BWMA 2FLBT 2R56H 1O5PA 2QMJA 5DUPL 2TRYA 4JM2A 1F4XH 1B2WH 1DVFA 4JKPL 4LHUA 2V2WA 3RFRA 1BHGA 4DVBA 1WAAE 2XN2A 4F2FA 4ODXA 1NBYA 4H26B 4BA0A 2G5RA 2IXQB 2JJTC 2RFXA 4NQDE 3QAZB 2HJKB 5B3JE 4NWTL 1LNUB 2J5WA 1MFDL 5KVFE 4UQEA 3MFGB 4X8JB 1OAKH 5HGAB 5IB4A 3ULUD 5AB0A 5IVXA 4UCFA 1D6EA 1MJ8H 2OMZA 2VGLM 1DVZA 4OIFA 3MJ9L 4P2RA 3KPMA 4QYAA 1B0RA 3MJ8A 1ZHNB 3G08A 3A6CL 1Z5YD 5I1HL 3ESMA 2TSAA 1WUZA 2OXGA 2ID5A 4B53A 3U4EB 3QUYD 4XGZA 3I02B 3NCEB 3RY6A 2WLKA 4U1SA 2HL8A 1PLAA 4K7FB 5EUOE 3RWHB 4HIJB 5JIHA 5KSAA 1Y6NR 3TEZA 3SQOH 1IU1A 4RAVB 1PZ5B 2H41A 1F90L 3CVCA 1VKXB 5D7LB 5J56B 3F84A 5LWYH 1TPXB 4HUVB 1XX9C 3E9TA 4N0YL 4F8OA 2HH0L 2ZWYA 2EADA 1UADC 4RMTA 4ZOBA 1ZLEA 3ARFC 1C08A 3NFSH 4RQQB 2QPSA 3D52A 1UA3A 3ZDXF 4HOZA 1MIEL 3QUMH 1CFSB 4YFLF 5EA0L 1JGVH 1D5MA 3PWUA 2WBJB 2P80A 4PHZA 3NFPB 2H5AX 3ME0A 4L0YA 3D3VB 2VN6A 4KKPA 1B4JL 1V8HA 3ULAB 4U1NA 3O6LH 4RBPK 1YPZA 4KHXH 4G7VL 4JKKA 1SZNA 2GPZA 3VI4A 2J2ZA 3DRQB 3CN4A 4N2FA 1QFOA 1QUPA 2GFBA 1A9EB 3PG2A 4H8QA 4M6NL 2WTOA 4FXGB 2VJ8A 3VU1A 4YJZL 2PN5A 4IRJB 4NZDA 3ETBJ 3OV6A 3T3PB 4K9EL 4PWHA 4ZPVB 5CILL 1WRFA 4NZFA 2R0WL 7PCYA 1A5FL 5HVWA 1RIHL 5EORL 3POHA 1MEXL 2X6UA 4HKBB 2DQEH 2NUPA 5GGRA 3SCMC 2PW1A 3UAJC 2OW7A 4Z77A 3C5JB 5I75B 4GP4B 3SQRA 4JRXA 3TZVD 2HVKA 1IGJB 5J89A 4J27A 1AIFB 1P9MA 3JTTA 2BS8A 5ISZD 4MQ7B 4ZAKC 3WXWL 3GSNB 3NPZB 5C09D 1Z5LA 1UYWL 2ITCB 2QDWA 3LRMA 3H85A 4WW2B 1SJXA 4L8CA 2QLVB 4I0PD 5C0AD 4KKBD 3TO4C 1HCVA 2HL9A 4FCAA 2AVFA 5MEPA 4PBXA 1IGIH 3DGDA 1HH9A 3GSQB 4OZHE 3RZWA 4JG1L 3V0VA 1ZVHA 4AGQA 3LHPH 1U95A 3FUMA 3BH4A 5CMAB 3PRZA 2R27A 1AYOA 1DSYA 1XAUA 4KUCD 1EAQA 2HJFB 4OZGA 3JWDC 5HDBE 4OGXL 3ARWA 4QRUB 3MMEB 3D9AL 2ZP8A 2GTZB 1RUPL 3QCUL 5AAWC 4J3VA 1KJ3H 1KYOJ 5I9QB 1Z6JT 5EPMB 5I1GL 4YHPB 5HHOB 2ZUTA 4BUGA 4LLMA 1O5DT 3ROLA 3BW9A 3D05A 1Q1JH 2COQA 5DUJA 4NQTA 1NMCB 4KKCD 4BFJA 2BC4A 3JV4A 4X5XB 5DUBA 1IGMH 4UIKH 5HDWA 3IJEB 3FS9A 2IJ0C 3AM8A 5E0QA 1XF2B 3KVPA 2LQRA 1E5ZA 2HTLD 2WSPA 5HYIA 2V5SA 3CQPA 3IDMB 4UU9B 5AVXB 2GHWB 3FQRA 5C0EA 5ICYA 1HFUA 5E0FA 1INEH 3HS9A 5E8OA 5IT2L 3P69A 1IILE 4ZXBC 1AOHA 3Q13A 5F7WC 4HEPG 2V7NB 5JW4R 5DVKA 3MLUL 4JY4B 3ZHKA 3MRIB 5E2JA 3EAKA 1OWWA 1NCOA 4KKNA 3I6LE 2IAMB 2Z3FA 4PJCE 3AT9A 1C12A 2E4TA 4BGDA 2F7IA 4GRWF 1REIA 3BQUC 3OZ9L 3VXSB 5JORB 2R29A 1A25A 3LZOA 1FH2A 4GG6E 1DQJA 2KS0A 3HS0C 4L9LB 2XQYK 5ACLA 4APQD 1QNZL 3Q6FA 2Q2LA 1U4EA 3T3MF 3VXPB 4RIRB 2BY1A 4WNSA 3RGVA 3ZUNC 4ELMF 1NICA 3MRNB 4B60A 2D7MA 3C9NA 1T1XB 2B1HH 4YDIL 5EBGA 3K6NA 1MG2C 4ZD3L 3DJRA 4KOBA 3L3HA 2DQCL 5DO2D 3R06B 5AKSA 4NHCH 4ZQKB 1G6VK 1DR9A 3TT1L 5IEHA 3SYPA 4N2HA 2YQBA 4UQAA 1ETZB 1AGDA 1DDHB 2X42A 2G2NA 3N9GL 5HHQA 4R26H 3WEAA 2P24A 4NNYA 3ARZA 3CPLB 3TEXA 1DUZB 4L1BA 3MOBH 2CJUH 4LQ1A 3SGJA 2QQQA 2AEOA 3KBHE 3MRBA 4OUUA 5H94A 1ONQB 1H5BB 4ZT1A 1BXUA 2NYKA 4AQ8C 4KVNL 3EOYG 3RGBA 3LNFA 3CH1B 3DO4A 3BZEB 1A6PA 1E7UA 5JMVD 4EIBA 4YDLB 2Z7WA 5EUKA 3MLPA 2FWUA 3HA0A 1QSVA 3ARBD 1NAML 3BO8B 5F9OH 1DLHA 4IDLA 3QUYC 1DVFD 4LHUD 1N3NA 4MB4A 3RZCA 2F5BL 4OD3L 4WFEE 5D2LF 2ARJB 4RISH 3RWDA 1FH5L 3T8XB 1ORSB 5J4MA 3OB0H 3D0LA 1AGCB 4JFQB 2PCFB 1R3HA 3LYRA 1RJLA 4URTB 1UB5A 3PJSA 4JG5A 4QJ3B 2PF6A 5DJCA 1BW8A 4PRHB 4P2RD 5CP7A 5CWSB 4J6RH 5D2NA 4A7TA 1JNLL 2ZX9A 5E6IA 1UJ3C 4UQCA 1KMGA 2HSIA 1JHKL 1DEDA 1FL6B 1EUVA 3LPFA 1CURA 2DDQH 3O45A 2GW5A 4RFOH 1KLGB 3P1VA 5KSAD 5IV2B 2VDLL 4PD4J 2D7TH 4NQXB 3KE0A 4KQ3H 1XF5B 5DJ8A 3AGVA 4UF7C 5DFVD 2QV4A 3MODL 2AJSH 4HQQL 1VLXA 4FMKA 2BJMH 2KT6A 4MMXB 4YPGB 1VZGA 5AVZB 4A2MA 3P0GB 5K9QI 2B1OA 5IHLB 2I07A 5D7LE 1Y18B 1INDH 1FO0A 4GW5A 1A7OL 5I18H 3S4SA 1R47A 4R0LC 4PRBB 1EFXB 2YN3A 3T08A 4MJJA 1BIIB 5DEFA 2GK0A 4DQAA 2BVPB 1HESA 4YK4C 1RU9L 3OKEB 2AITA 2P80D 2QADD 1G7QB 4V1DA 2YD6A 1YMMD 4XNBA 2EXWC 4GBXC 3H4HA 5BRQA 3TZVC 3PJLA 4HKZB 2MIZA 2R59A 4XO9A 4YXHL 5KS9F 5E6SB 1BQUA 5BW7C 1QO3B 2ADFL 4Z0XA 2YQ3A 3BVTA 3ZYOA 4HMCA 3E0GA 4AG4L 4I0PC 4KKBC 2AJUH 4PB9H 4GI6A 3FN0H 3GO1H 1LL1A 5ESVA 2JKLA 2V33A 4Y2DC 1A9BA 3R1GL 3T3PE 3WHE0 3ZDXB 3X2QB 2P5WA 3RNQB 2YFNA 1KCRL 1ZT4A 2ZOKA 3A4DA 3U4AA 2P7TB 1E4WL 3QDGB 5EZIH 2AEWA 2UZXA 3QO1A 2F7LA 1X5ZA 1K72A 2J7LA 4PS4H 4R8WL 1MNUH 3MJGX 3MREA 4XCCL 1IM3B 2IBGA 5HYSG 2XVGA 1YMHB 1IBDA 3MN8A 3QPXL 3AUVA 4WNQB 3B3IA 1T6BX 4BINA 3QZPA 4FZ8H 2CKBA 1TTBA 2V5MA 2O6FA 1KIUA 4AMWA 5CCGE 4FYQA 2NT0A 2HXAA 2PXYC 2HTLC 1YNKL 1RHHB 2WZ5A 5FM4A 1FZMB 4ODWB 5E51A 4MAUH 3F65A 1HI6B 3VRIA 4ABQA 1JJUA 3FTGA 5AENA 4K71B 5AVTB 2EIKB 3ZYZA 1F4AA 1FYTE 2DICA 1IBGL 1UC6A 5TFSH 4HXBH 1AGBB 4NP4H 1ZV2A 2NY5L 3MTRA 3BP4B 1AHWA 1GOFA 3C09C 4I18B 5GSRB 5C7XL 2YSSA 4NNPH 2E47A 4WV1C 4HK3N 2H2SC 4I1PA 4BFNA 3IPEA 4OFPA 5C08A 5HHOE 3KYKH 4JVUA 3FF8A 5FKAB 3WFBL 1HSAB 3KTUA 1YYML 1UHVA 3HG1A 2G5BB 2XWTA 2IPKB 5C8JB 1Q9LB 3LZQA 5AW3B 4AEIL 4APQC 4ZOCA 5FLUA 3Q01A 3LB6D 3ZW3A 4HLEA 1R3LB 2GT9B 4L37A 3UEQA 1ZLWH 2WSKA 2ENJA 2VXQL 4Z7QF 4DP5X 1DEEA 5HYJB 3FTYA 1YRKA 3W2DL 5KOMC 5I16A 2CIIB 3DMMA 3G5VA 1KCUL 1UWGL 1QBML 4KK9C 4CMMA 3DX7A 3WLBB 2OS7A 4KI5E 4PGDA 4XNYH 3G5XB 1N64L 3VXSE 1N3AA 5IYDP 3FTUA 1ADQL 3AT0A 3RGVD 1CYXA 4Q14A 4X6DF 1J5CA 1KPVA 4QPEA 4G2AA 1OZUA 2NTFB 1IC7H 5DRXA 3NIDF 4IMLB 3STBA 1F4WH 4M7KH 2F7OA 4JRFA 3UO1L 1R5WB 1DIZA 4JM2C 1YEGL 4I3SH 3O3UN 4EF3A 3SOTA 5F6HJ 3S7GA 1DVFC 3ZK0A 3IDGB 3ZKXB 1NIEA 3ZDZF 2DKDA 2IH1A 1BX2B 3AMLA 4GRWB 1OVZA 3KPTA 3UYOD 5ICXA 3H6JA 1V5JA 1X4ZA 1CL7H 4UTAH 1I1YB 2K9FB 3ZL1A 2ESVB 3CCHB 3MFFB 4RVBA 2AQPA 4JO3H 2Q5BA 2O4EA 3NDZE 1N6QH 3ARRA 5LUMA 4TM9A 3VFSA 1VADA 3WENA 4ELMB 3T8VA 5DD3H 1A4AA 4AQEB 4DP6X 1BEYH 5EIIA 3RZCD 5BUGA 4YDNA 4LHJB 1I7ZB 3RY6C 2M83A 4UUJA 2WXJA 3RAJH 5KSAC 5IF0B 2CU9A 1QSEA 4QHMB 2BWIA 1AKPA 2AEPL 4CVZA 4O2CA 3WJJA 4WEBH 5LGKA 4Q6KA 2YPKB 4HLZH 1KXVA 4JPKH 1NUGA 5GS0L 2AXHA 2G60H 4FQCH 1QN4A 1X6NA 2UYLA 3C04A 5CLXA 2FEEI 5IIEB 4JNXA 2NNXA 4HBQA 2CJSA 5E6ID 3Q2VA 4OT1L 2F7RA 3AXLB 2R0LH 4PRHE 4GUPB 3KMDA 1CPUA 1N12A 3OF6A 1HZHL 1N0LB 2OK0H 1MH5A 3QIBA 3OMNB 3F6IA 3CDZB 2VMEA 5ITBL 1GHFL 4RA3A 3S36H 2VSDA 4OFDA 4BCXA 4ES9A 5JPNB 3NESA 1D3UA 3U2JA 1FNFA 5D2LB 1I3VA 3VGGA 3EOTH 3O0RL 4LEOB 3VH8A 4JVWA 3DYPA 3KCPB 1KBVA 2ATPA 4QHPA 2N0MA 5TPWH 1G5GA 1U8HA 1U8OA 3IVKA 4RZCB 4JL2A 1WTLA 1H6EA 1MFMA 2XWBB 3CU7A 5IWLC 2ERJB 1AJ7H 1KEGL 5KVDH 2JJWA 1MW2A 4I7ZC 4KAQH 4U0RC 4WHDA 4IK6A 4LHUG 2DH2A 5DK3A 3LPGA 4PJAF 4V1DD 1Y07A 3FHAA 2HJLA 1WD9A 4HT1H 4ZUSB 1P5UB 2P3YA 2PPAA 5G55A 4M03A 1P9MC 3F58L 4FFYH 4PS7A 1YYLL 1GSMA 3HKZA 4GSQA 1PY0A 4I2XA 3BPOC 1F58L 3LSOB 2XJKA 3KRMA 3ORJA 2HFGL 4N8VB 2FR4B 4Q0XH 1TVBB 5F3BA 3JWNC 4C83B 1TTFA 1VFOA 3QDJB 2DN7A 3NTCH 4HUXA 5FCUH 2XQ0A 3HC4L 1A4JA 1SY6L 4KV5F 3EJJX 3HUJA 3HFML 4G71B 2G3NA 4K94L 1OQOA 4TVSa 1XF4B 2DQFA 2W07B 1Q0XL 5KVFL 4AVIA 3UC2A 3VCLB 1UA6H 4XCNB 3MNZB 2HT2D 3X14B 2DQGH 2BOLA 2J21A 2A6KA 3O4LB 1G7PB 3HCVA 1GYAA 4AM0Q 4BFFA 5KYWB 4CJ1A 3AITA 3ZDXE 2H6UA 4I87A 5J9PA 1MCQA 5EU5A 2CDFA 3B2DC 1CD0A 3WFCH 1R9FA 2I9LB 1NBZA 3HNSH 1V7NH 2NXYD 4DNLA 4GSUA 3HI6H 3HPLB 4Y16B 2V2TA 4GRLD 3N1GC 4E9SA 2VLRB 3QFGA 2AV7B 3QIUB 2HRLA 4FQ1L 4XVTL 5I8OL 1OHQA 1QNBA 4FQHB 5HHPA 5CEZH 4LARH 4MASA 1UZ6F 1A6UL 5AYUL 1CFTA 2YMTA 2MPAH 2C9XA 5CEZE 2R4RH 1D5BA 5GHWH 2FB4H 3L5XL 4H8WH 5JIQA 3NRPA 2XA8L 3C6EA 5KYXA 3LB6C 1QHOA 1KV7A 2A6DA 4X0KB 3BSZL 4AKQA 5BCAA 5CBAA 1GOGA 4AQZA 3Q8AA 5DURD 3NK4A 3PY9A 2GEQA 4UM8B 4MCMA 1RL1A 2X4RB 4UDUA 2ZCKL 5C08D 3V0JA 4LXFA 2NZ9D 3CN1A 1SOKA 5DS8A 3HNTL 3HG1D 1PD1A 5ECJE 3SQBA 3ZIMA 3VFGL 4BQBA 3GS4A 2GJ6B 5K9KB 1Z3GL 4JKWA 3WNNA 2BVEA 3EDKA 4A04A 2ED9A 4HEME 4XO8A 2P46B 4DAGH 1BJMA 1R24B 3RGVC 1TR7A 4UQBA 3FCUB 1YAZA 4JO4L 4K3DL 4LLYA 3BEWB 1L7TH 3JUYA 4LBEA 2WINB 1TVHA 3OHMB 5E4OA 2J55A 4JGMA 4PJ8A 2CDGA 3D25A 5C0IA 1J0IA 4TVUA 5AG8A 3MRCA 2WXHA 5E00A 3IU4L 3Q44A 4JN2A 2Q7YA 1DL7L 3K0WA 4RFNB 1T7XA 3JWNG 4IKNA 3ARYA 4XCFL 2CQVA 2EJ1A 4MX7B 1V3MA 5DD6B 4DP2X 3AREB 4CC0A 1F11A 1XSOA 3WV0A 2EHBD 1QSFA 1WH0A 2AI0L 5CJ8A 1C5CH 2GHZA 4LVHC 2GTWB 2BSBA 3GHEH 3H56A 2MZ8A 1LO2L 1ZXKA 1UVQB 1ZEAH 4MJ4A 4PV8A 1F0LA 3QQDA 1JHLH 4I77L 1M1SA 4W9HC 1O9WA 2IMMA 5EOCL 4CU6A 4EAKA 3AQDA 5I66B 5JQIB 3O6KL 2B1AL 4HOWA 2B4CL 3VNYA 4N4YB 3JT0A 5AB2A 1TYEB 4X50A 2WXLA 2HPOA 1S7UB 4H40A 2VLJA 4BE6A 2A9NL 4XN2A 3BPCB 3UTTA 4IOIB 4QXTA 4NQSA 5AUMB 3OAZH 3X1GA 3GK8H 3IBOA 4AYFA 4OI8A 2VITB 3QWOA 5HYFA 1R3JA 4KRNA 1D7CA 1J8HB 2QHLA 4UWQB 3RX8A 5IJDC 2Z7UA 4DKEL 1WE5A 4GRWE 2D0AA 1QKZL 4MD5A 5D2NC 3V5KB 1FL5B 3R19A 4M8QA 4NZ8A 4X6DB 1XF3B 1OCWH 4J28A 1FL3A 1WCBB 4NO0B 4F7PA 4P3CH 2ESVE 4NFDA 2MNWA 3NIDB 1WZ1H 2XG4A 1DSWA 5ESAB 4ELME 4OD1L 1QSED 4LCYB 15C8L 4Z0BH 3U36A 1JIBA 3O3EB 1PZSA 1MPGA 3F12A 5E03A 5BV7B 4PRAA 1NCIA 1CLYL 5E9AA 5C0BB 1N59A 4EAGA 3A22A 3NCFB 4HJGA 3SBWA 3CFKA 2H26A 5DZAA 4KHTL 2P8PB 5EO0B 1FVCB 2OXHB 3FSWA 1XB6A 3LV3A 3L17A 2FEDD 2M8XA 4AL8L 3L3OB 3PABB 4E0RB 3VG0L 1JZGA 1PIFA 3NZUA 1E4HA 1GPOH 1LJMA 4WRLA 2HFTA 2ADJA 4LBAA 1NDMB 3LPPA 3RHWK 4Z3EA 4X80L 3SYQA 1J05A 2Q3AA 3OF6D 2ENSA 4PTTA 3V4PB 4ZI8A 1NCUA 3QIBD 3S37X 4KGLA 4AXWB 1WIUA 3KL5A 3V6ZA 3A6OA 3EYVB 1ZIAA 1HCFX 2OI9C 4HS3A 1P4IH 5CINL 5I0YA 5DZJA 4AITA 3O9WA 3BOVA 5CIPB 3QJQB 3NSXA 3V0GA 2G3XA 4JG0H 4LCIH 1FRGH 2FBJH 3BZFB 4U6YB 1CF1A 4GG8A 3LN4B 2J1WA 4WFGE 2C26A 3V6BR 1ZS8B 1QR1B 2DQHL 3PGFL 2XPGA 2Q76A 1KXHA 4K07A 1CU4L 1WFOA 1XEDA 2ILLA 4FHKA 2BIIA 4AGPA 1NDGB 3B5GA 1G4RA 1IM9A 4WI8A 5E6UB 3TM6A 32C2B 1M7IB 1LQSR 3GMRB 3UDWA 3IJ8A 2WHVA 1PX8A 2F19H 1VA9A 4LCCA 3LS4L 1ET5A 1OTTC 3KPOB 4TS6A 4FNSA 5KN5B 4JDEB 3EJUA 3V4VL 4FADA 5HI4D 1I8UA 4Y9EA 2HT2C 3K4DA 3SJVA 3KWWB 2IIJA 3IPBA 3QEQA 1ED3A 1XSJA 4I9WE 3MLSH 3WKML 4LQFL 3DROB 2VQ4A 3F7YA 1W0WB 2ORBL 1P1ZB 3HJ0A 3SE6A 1SMAA 3ARGB 4JR9H 3LIZL 2YZ8A 2E7LC 2I24N 5MENB 1QUNA 1PZDA 2NXYC 2Z92B 5JW4N 3HB3D 4IS6A 2QKSA 2EVFA 5DZPA 2ZD0A 5DXWA 2A9DA 1THAA 3BCFA 1RIVL 3QDJE 2C9AA 2R1XB 4PJXA 3RU8H 3DTDA 4KZEL 4XPGL 5EBMB 3SY0A 5C86A 3ML8A 3EH2A 1M05B 4TL5A 4XXDA 1A1NB 4HWZB 3GLZA 3IDXH 1TTGA 1VFMA 1AHWC 2QQKH 1OGSA 3HZMA 4HA1A 1W0VB 5IW1A 1LYQA 4WQOA 1UURA 4OZIA 1FFPA 3A6BL 1RZ7H 3NSCA 1E7VA 2K7PA 1ESOA 5AYTA 3NH7H 4FJYA 4NZRH 3QUXA 4D8PA 1FE8L 4POUB 3P77A 2WO3B 2EACA 2DWDA 4LLDA 1MW0A 3K5RA 4P5KB 2Z6FA 5DHXB 3H54A 5IVOA 3UTZA 3NZSA 4UT9H 4YE0A 1UD5A 3EFOB 3DIFB 1SFHA 2ZUQC 4L3EB 4GS7B 2XXCB 3MUGB 4L8BB 5ESQB 3ZMRA 4W9FC 1ZLUH 2RR3A 2W81C 1U58B 2YARA 3GI9L 1TQTA 4CN6A 3QHZH 1JWMA 4E9VA 3HMWH 4R7LA 5C07A 3C87A 1BWWA 4B0MB 3NPSB 1YNTA 1TBAB 5C0RL 1YLBB 3DMMC 4RRPA 2NLJA 3SDAB 2ADGA 2AEIT 2K8QA 4AIXA 3ZDWA 1HILB 4H88L 3L3KB 1IL1B 5FYJH 5EU7E 1QNEA 2X28A 3UW2A 5DQDL 2BCKA 1U21A 2GCYA 1T1YB 3P0YL 2GJ6E 3WELA 1XTLA 3MRQB 1K4DB 4PJ8D 2PYEB 3GPSA 2E75C 4BFIB 5JMOC 4R7NA 2WIIA 4ZDHA 3SGEI 2XRAL 4QRQA 3QRLA 3EH1A 5ABDE 3QVAA 2E7DA 4XWGL 4Y5YB 3VWJB 2FWLB 4OQ1A 4R7DB 1LK2A 1KTDA 1X7QB 1J87A 3P2BA 3UBHA 3NP3A 1TO5A 3PDOA 3GSNL 4I3GA 1MRFH 4N2AA 1JV2A 3A47A 4ZS6D 4A38A 4WHYH 5GRXG 3F10A 2A38A 1OP3K 5FB8B 3QEHB 5K39A 1J5IA 3GRBA 4KKRA 2NY7L 2IDQA 5A2BA 1EZSA 3QHFL 5IB3B 4ROCB 3MCLL 4RRPM 1VPOL 2VLJD 3GMQA 4U1GB 2IWFA 5E1HB 3UTTD 4NBZB 5L2KD 4P5SA 2Z0FA 3Q2CA 2WQ8A 4FNLH 5JW3L 3WJJC 3FULA 3TEUA 1MLCB 1HL5A 3FONA 2DQIH 1BYPA 2XHNA 4YHLL 4FS0A 4XNQA 2ZYHA 4MYPA 4BJUA 2FEDC 1MHEB 5IJBC 1EJOL 4LCVA 3ULUH 5IK3B 2VW4A 1J8HE 2FWOB 4FL4C 2GJJA 2BWQA 2ZXDA 5KSBA 3ULUE 4AZ8B 4WXAA 4X4ME 1G1OA 2OFQA 4QO1A 3VACA 5KUKA 3X12A 2X2HA 3QIBC 2NUTA 1MHPH 1CLZL 4BZ1A 5HJBA 1TJGL 4OI7A 5BUAA 2VDMB 4EDXA 3OCIA 5FKPB 3IAGC 2C1OA 4XN8A 4EI5A 5IMMA 1B4LA 4XNZC 4QD2E 3DKHA 4ZX3A 4N90E 1CGTA 2DEXX 3V0IA 1B0WA 1PLBA 2KPNA 4MA8L 4HGMA 5EEYA 2X4NB 2WUBH 4G8IA 2NOZA 4GJTB 4OIIH 3WOVA 1SHMA 2ZYIA 4ZMXA 3FW6A 5T8IA 4TQPA 3CQFA 1KCKA 5HI3D 3MRJA 5DEZA 1P69B 1F6FB 3O9WD 4GI8A 2QHRH 2OSWA 3WIHA 2F1EA 1TTCA 3H7BB 1AQDB 2EH8H 5I1KL 5CIPH 3TNMB 1R17A 4J3OH 5F1NA 1B88A 1H6UA 3V2AR 1FORH 1FPTL 2G4GA 1K4CB 3QJFB 3QZWA 4NQCB 3FFCB 3PQYA 1IM9D 1FVDA 2X2JA 4ORGA 1H8OA 3K2UL 3UPAA 2CNYA 1PZ2A 2E6QA 2VLKB 3VSUA 5K5YA 1D5XA 4K7PH 4IOFD 2VWEC 3HB3C 3DX8B 4LNVA 1BM7A 3S34H 2OZ4L 3FQXA 3FUDA 2J20A 1DVYA 1G7MA 3QEUA 4JPVH 4MMYA 1MCRA 1M3JA 5EIIG 4D0BA 1MZYA 3VG9C 4OJYA 4WAFA 1I9RL 3VRJA 4OCXH 3SJVD 3CIQA 5T5FL 4JE4B 3CDGA 2IBZY 1HHGA 3QEQD 5CJBA 1NFDF 1IVTA 1NSNL 3HI5H 3IFLL 1HQ4B 1S7QA 3VDCA 2JHNA 3Q06A 3P11H 4PSRA 1EQWA 1KYAA 4Z7AA 2Y3NA 4Z7VB 5IFHH 4FQ2L 2ZYSA 5LBGA 4PYGA 3VXMA 3ULVL 3MROA 3SNSA 3QYNA 2P52A 5LCVA 3SYCA 3RA7L 3IMWA 1SPDA 4F7CB 1ZHLB 3FC8A 4TKWA 4M02A 5C09E 2OR9H 2L04A 2WZPA 2FGWL 1L9NA 5MENE 2GY5A 5L4MA 2VNCA 1JF5A 2HLEB 4DEPB 4X7CC 5C0AE 3UJIH 2DKMA 4J3UA 4YOKA 5FGCB 1USZA 4YSQA 3BPLB 3MOAL 4QTIL 5FK9A 2Y07H 2ITDB 3PIQB 3QIWB 4LVOB 4YMPA 2VO5A 3U25A 3PV6B 2Q6WA 1Z9MA 2A9AA 1UQSB 3VFNB 3VH8G 4XN4A 2YAPA 1SYSB 5DD0L 3A23A 3LMJH 4F24A 3UZVA 3QUHA 5E5RB 1X5AA 5SX4I 1NGPL 3G5YB 5T1DH 4P23C 4XN9A 2QSCH 3SE8H 4MJHA 2HUEA 3E6HB 3WEXA 3GMNA 4NPYA 2FD6H 4YAQB 5I8KH 4L23A 3QUXD 4W9DC 4S0SD 4Y5XC 2X6CA 5ICZA 3MCKB 2CBOA 5DJZA 1TZGL 5T3ZL 2C3WA 1N6VA 2A0LD 1XBRA 3CFDA 4H0LC 1AMXA 1JK9A 2QVKA 3L1OL 5EMYA 3TH2T 3FH8A 3UG5A 5ID1B 2B9AA 1F86A 1CT8A 4JMXA 4NO3A 4YZWA 3SOBL 4PJ8C 5JYMA 4D7RA 1MIML 5C07D 5CN3A 2R51A 4QXGH 4WCYH 2YPLB 3QCTH 4L3EE 1BZ7A 3W9DA 4O51B 2Z4QA 4BKLA 3CSTA 2NOFA 3T0EA 2W60B 2EDKA 3QJVB 4M5YL 5D7JB 5EULV 2AAAA 1KTKE 4QHLA 4B9GA 2BY0A 1MG3C 2R8SL 3BH9A 3ELQA 3FYEB 1EV2E 3VI3B 1BAWA 1R34A 4FTVA 2X7LB 1JPSH 1AVAA 1NBVH 3O2DH 4ANVA 5L9DL 1EO8H 5CGYD 2FZ3A 4R96A 4WO4B 2ZOLA 4ZS6C 4P2OC 3GM8A 3ARQA 2Y7NA 1J12A 3BWZA 3FU3A 3KPPA 4G9DA 4L1SA 4HHAB 4LSTH 3KBEA 3VQLA 3I3WA 5HHNB 2X9ZA 3IGFA 5CCKH 2PYEE 3IU3A 2CJ3A 1IV8A 3IJ7A 5GGQH 5C2BH 3K1KC 2VXVL 3GMMA 1VTOA 2Y7OA 2CDEB 5SWSB 3IFOA 3GZOA 1AKJA 2DYRB 1I8KA 4FQQB 4U7SA 3K3QA 1QA9B 1IIKA 5GRYA 2W8CA 4YHKH 4OF8A 1VAHA 1XSKA 4PWFA 5A2FA 1SNRA 2ZCLL 5DVLA 2DLHA 2H0FA 2YPVA 5JPMA 5JIPA 4FG0A 1HEHC 1KIPA 1X44A 3U6RA 4J1UB 5JLZB 5LXVA 3TIDA 1QRNB 2JLPA 3C6SB 4U3SB 4HUKB 4LAJH 4MMZA 1PLGH 2HKHH 4HS6A 2AQQA 1NPJA 2HKFL 5BZDB 3VDBA 1Q9WB 5K33A 5HY9A 4YHMH 2VLLA 5JO5B 3VNZA 3LH8A 1KBBA 3PWLA 5GIRB 2D31B 1FV1A 2DD8L 1CGSL 1E90A 4GP5B 3WD5L 2CK0H 1N7ML 3US1A 4FG2A 4K23H 5C6PB 1CBVL 3DPUA 5FYLE 1TTAA 4GKSA 5E8NA 3IDNA 2CKNA 4ZZFA 1TU2A 2C3HA 5HI3C 4OM0H 4A7GA 3TCLA 4KO6A 5ANMA 1EGJA 3VXOA 3O9WC 3DX1A 4DK6A 2NOLA 1G9MC 2BP8A 3SPVA 1P7KA 3QI9C 4RMQA 4BFBD 3BWUC 2VDMH 2YAQA 4BH7A 3FTVA 3UC0L 4OIAA 4NQEB 4FZEL 2Z0UA 4C7PA 1HHKB 2ZT9C 1CFVL 4WDIB 2ZWLT 2JK5B 3I9GL 4PJHA 3TBVA 1BBJB 4JM4L 3GMPB 3IYLW 3P9MA 4IOFC 3W9EA 3X17A 2D7OA 3DGGA 3C5SB 4M3KB 4OFIA 4F80A 4G83A 1CXKA 1BP3B 3KPRD 5AALA 4LCCC 3FT3B 3IJHA 3OH6A 2ZG1A 3L3GB 4XNUH 3BP7A 1NCAL 4JFOA 5JHBA 3IXAA 4OV6F 1INQA 3AAZB 3EG9B 1UZ8A 2FJHA 2YD7A 2VRAA 4GKNA 5B38A 3G9VA 2ICEA 4MCZA 2IBBA 3WN5A 5KJ7E 3DARA 1DLFH 2Q9OA 4HH9A 2YGNA 4DF9A 3CFQA 5TE7L 2VDRL 1YMME 3CV5A 3PQYD 1V7ML 4HIIB 1S4IA 3MLTA 4JHUA 1Q72L 1A7QL 2DH3A 3HIZA 4RWYL 1KJ2B 4ADJA 1I75A 4NQCE 4QJ4B 1LO0H 4PJFF 3FFCE 5KVEH 4MXVF 1RFDH 4N2IA 2WVUA 3WJMB 2UWEA 3UO8B 4QRRA 3OKLB 4HGWA 2F58H 2OYLA 5KVEE 1F6LL 3MA7B 1ACCA 3CLFH 5EC1B 1OB1B 2R0KL 4O5LL 4N6QA 5AEAA 3INOA 3CK0H 5JQ6L 4Q74A 5ERWA 4N2DA 5I15H 4N28A 4JVPA 4X5WA 4WSJA 4WGKA 5E2WH 5I8CB 4Z7UA 5I1DA 1BMGA 3VXMD 2BRRH 3SPHA 3LZFL 3HC3H 5LVEA 1UB6A 3O3DB 4GEJA 4AW4A 5J13C 4QRFA 1JL8A 2CZNA 4Z7VE 1AXTL 5D4HA 2F54B 1OAZH 5T1MA 3J07A 3QUXC 2WZPD 4IOSA 2WGXA 2WMPB 5FA3B 2XV6B 1YY8B 1MCPH 1BFOB 2WVVA 4ZZKA 2J25A 4OUOA 4KVCH 3S37L 3NIFF 2VDKB 4GXVH 1I7TA 2A0LC 3CFBA 1IC4H 1A6TA 3PP3K 2MMXA 4G8EB 4ONGL 2EIZA 2ROXA 2V5RA 5DRZA 2Q8BL 2YUZA 2WNWA 3BRDA 1ZVSA 2H3NA 2L7UA 2X4PA 3BQVA 1FVEB 5FGCE 5AOMA 4QCIB 3RPKA 5TK2A 1S3KL 5FO9B 3CVSA 2C9VA 1UA7A 4JE0A 3UMNA 4F7KA 4GKOA 4MJIB 4KPHH 4KQ4L 1TSHA 3KYMA 4YX2H 4GY4A 5C0JA 3I9PA 2WXPA 1JV5A 4HG4J 2MCPL 5JDSB 4G80A 1IBFA 4EJ1C 3EJQA 3FRPB 3QNYB 4XB7A 2X4SB 3ALPA 4XMPH 3EHBD 3GSVA 1UWXH 3G04A 2HX9A 2V4LA 2AXFB 3JSSA 1HTYA 5DMKA 2P5EA 4J3SA 3CMGA 1TZ8A 3SDXF 1AP2A 3QNXA 4IBLT 1QBLH 4FABH 2GB2A 1IMHC 4IGBA 1RUAH 3HC0A 3EYFA 2YH5A 3DVNA 5D6DA 2QGEA 1YNLL 3OZKA 1BBDH 4MNHB 4BQ9A 3MRMA 3GC3A 2AMGA 4NRZA 3ZE2E 1A7BA 1BOGB 1XCQB 2CM5A 4QEGA 5J6SA 2YEZB 3T0ED 2EYRA 3UIYA 4C4BA 1HH6B 2D9CA 1U8NA 2IQAA 3UBGA 2E6PA 3I6KA 4J3TA 5FA4B 3UEZA 1MCJA 5DTFB 1AZBA 3QR1A 1AGFA 2NTSP 3JZYA 3UMTA 1R0AH 3CMOL 4FTVD 1V3KA 5JHDA 2NY4B 2CRZA 5ACZA 1ZPLA 1L5GB 2DWYA 2IGFH 3BJLA 2VR9A 4F92B 1SXAA 1EO7A 4LRIA 3WY4A 2W94A 4JO8A 1LEKA 5T1LA 3VI3E 5GS2D 2AJVL 1DJGA 4MGXA 1IC5H 1XCTA 2Z35A 1RVFH 4QF1A 3EGXA 2HFFB 2DEYX 2EEXA 2WLIB 5LLIC 2JCWA 4Y5VB 3ENCA 4PP1D 5DF0A 1MJUH 5KAQF 1TXKA 3FDWA 4OZ4B 4ZTPH 4YN3A 2GABA 4CW1A 5DK0B 4RDQG 5CGTA 3RTLA 3EGDA 1SJHB 3E6FB 1AKJD 3BISA 1OF2A 4ENED 4QRSA 3RWCB 3NSDA 3V5HA 3KPLA 35C8H 4ZOEA 5EO1B 3TFBA 1UM4H 2R0ZL 1PZAA 3UG3A 5SWSE 4JFEB 4W9LC 1N6UA 2CXGA 2Y2YA 1M3HA 3LZRA 1URIA 2E7HA 3JYCA 1XT5A 3ZUCA 3EYUL 4GPVA 4P46B 3QUZC 2YC1A 1P84J 3HZYB 3NJHA 4RRPG 3BVWA 2XN9B 3MRLB 4DUWA 4MDIA 1PX4A 1ACZA 1QRNE 4LLWB 4PM1A 1S78C 4EI5C 1MFBH 5IHZB 3WNOA 5GGUB 1G9NL 3ES6B 3DX4A 5D1XB 5HHMB 1S8DB 2DBJA 3MXVL 4K3EL 4N87A 3KAAA 4NUMA 4OGZA 5L0QB 2EVGA 2E9GA 1DCLA 4Y4KA 3QH3B 4JO2H 1LO5A 1J0JA 5C9JA 4JN1H 1EDHA 4OM1H 1QWHA 2Y7MA 1KY7A 3TYGH 4FLHA 1GS7A 3NN8A 1M5Q1 1KCSH 3NA9H 4TYUA 2FT7A 2CCWA 1JPST 2QVMA 4DQOL 5BVPH 1EMTL 4JEGB 4QY8B 1ZLDA 3SDDB 3ECBA 1KO9A 4P9HC 4PY8J 4RA0C 3OHXB 4XP4H 1A14H 2ICCA 4E36A 1IEBA 5L88H 4G8FA 2NXZC 3HAEB 1RQ5A 2AABH 2CCVA 3TV3H 5I1EH 2CO6B 1II4E 5K9OB 3FTWA 4AGMA 1ZGLA 2DKAA 1LP9F 1R5IA 2WXOA 4WGWB 4ODVL 3T6QC 3HRZA 5TF1H 2Y3AA 4NQEE 1OAQH 4LVNB 2ZKWA 1RZKH 1M71A 2WP3O 4NT6A 3C75A 1YN7A 1UWYA 4DGYL 1NGWA 1H19A 3QK0A 1F4YL 3BP6A 1TFPA 1FAKT 4Z7WA 3BH8A 3BI9X 4NCDA 5DR5H 5IMKB 1SXCA 1JXFA 2CBPA 4IRZH 2Q8AL 1GCFA 3E8UL 4AI7A 4Z6AT 5IQ9B 2BHYA 2VLMD 1E2ZA 1U8QA 3H9SB 4MZ2A 3PJNA 3GIZH 3B9DA 2ATKA 3PGDA 4XB8A 2VL5B 1TF4A 1BVKB 5GZNA 1CK0H 3P3RA 3ZTDC 4X4YB 4M5ZL 2E6JA 1KJ2H 3GSUB 4QRRD 3T77A 2X3CA 1SN5A 1A21A 3FFDB 3QNZA 2F6AA 1W16A 3QJZA 1IC1A 3U2SA 1MRCH 3DGCR 3I74A 5DT1H 2CA3A 3VD4A 4IU2A 1QTPA 2YD0A 3U0TB 2PWWA 1F2XK 2K4AA 2DMGA 3KNBA 2IDCA 3O2VH 4HIHB 4G59C 1FSKC 2X4TB 3BUBA 4UINL 3WFEL 2Q1EA 4TQIA 1FQ9C 1D5RA 5JOPD 3HZVB 3SPCA 2NR6A 2XZCL 4IOSD 4M61A 4N8PA 1UOKA 5AVUB 2EDBA 1TEYA 2VDPB 4H0HB 3OTTA 2J1XA 4DVRL 2CKBH 1RY7B 1QNCA 3KL0A 5BV7L 1H15A 3EHBC 4QRPB 2FKMX 4M1GL 5TH2A 3KVQA 3ZTNL 3H7LA 4PJFB 2AVGA 1ROCA 2F54E 2K0RA 1GZQA 3HOGA 2A9MH 4YHYB 5I17A 5D55A 3D4YA 4NUGH 2ENPA 2NY2B 2UZIL 3B6SB 3ZDYF 2PPCA 5E8DL 5GGRY 3SDCB 4ANXA 4DZ8B 4J23A 1JWSB 1EK3A 4X4KA 3HHSA 2AJZB 4XAWL 5DJXA 1X5MA 3QZWG 4AENB 2UZYA 1NLDH 2B59B 1KGWA 1LEIA 2VL4A 3II1A 3TNNA 1HU0A 3FXIC 1ZJAA 3STLA 1I8IA 5F44A 4NRXB 5I19L 3T0EC 3BDXA 3LH2H 4MJIE 1JZ2A 4MCYB 4H1LA 3MRGB 4XP6H 3V8CA 1T7YA 1KDJA 3CFJB 1BQRA 4QHNA 1T03L 4CMHB 2AW2A 2IOOA 4ZMVA 2P5ED 1P4UA 3CZSA 5LGHH 4JFYB 4L18A 3NIFB 4XZUB 4IGBD 4IRSA 1EHLL 4IBWA 1XEUA 3H55A 4U1KB 1RJYA 3LZPA 5HI5D 5SWQA 1N2RA 1OPGH 4DW2H 2C3XA 4FD0A 4KJYA 4NN5C 4R90L 1X4XA 5KG9A 4NZUH 1FFNA 2BSSA 4RGND 5L8LB 3ESPA 4DESA 4U1JA 1C16A 3U30C 5CHNA 3APNA 4PP1C 1O0VA 2FHFA 3P0VL 3KLLA 2AXGB 2WYTA 1MCOH 3MRKA 5I0DA 4UIMB 2A83A 2JELL 4ENEC 5JHDD 3SY0B 2ZYRA 4KC3B 5F9WB 2YWYA 3I2CH 4A6YA 1J5OH 2DF3A 1PW3A 5I6LA 2VIRB 4L8SA 2P8LA 3T6WA 3LNDA 1DQDL 1OAXL 3HNVH 3UYRH 3D39A 4R7VA 5JPMC 1XL4A 4ODUA 3C5ZA 4GXUN 2E5EA 1X5KA 1IFHH 5FS5A 2FLRT 1DSFL 1S7RA 5HJ3A 3SGDI 4GNKB 5CZKA 1SOXA 3KJ6L 1VFBA 2R69L 3QEGL 4MMZC 4YL4A 1NCWH 4Z5RA 3U6XS 4JB9H 4Y4HB 4L4JA 4AJVA 1UT4A 4OCNC 5IBUG 1VTLE 2XI9A 3LQAC 2Y1ZA 3U9WA 4KDWA 1EBMA 1FP5A 4XCYA 2XJLA 1PCMX 1T21A 3AFLA 4X5QA 2XKUA 1S7VA 4Y0GA 1UH2A 1DQVA 2AGJL 3ESOA 3QYCA 3QARA 4HJTA 3SKUD 2X4OA 1HS6A 4AIZA 2QEJA 3H9HB 4OLVH 1X9QA 1NEZB 1WWBX 2VMJA 4Y4FA 5MHSD 4JFEE 1F3DH 3DLQR 4PJBA 2UXVA 4G6KL 2YXVA 5IP4A 1J3MA 4Z78A 1KXTB 3BKCH 3RILA 1U9KA 3LXAA 4XNXH 5IUCA 1EX0A 4PHXA 2HRPL 2W0FB 3TVMB 2F9BT 3Q9QA 3PWJB 4HS8L 5CN2A 2XN9E 4IHOB 3FUHA 4Y4KD 4UV7L 2WLZA 3N42B 5HHVH 4CGTA 1O9ZA 4L4VB 5D1XE 5HHME 1QLEB 2G30A 3KPQA 5E2TH 5D8JH 3NJXA 1EJFA 2DQMA 2H45A 4R4NC 1GY1A 4RAUB 3FSAA 2JIXA 3AABA 3DHMA 5AAMC 4UOQA 3C6LA 3V5DB 1NDTA 2ICEC 4LSSL 5FAAA 3U6XA 5BO1H 1S7XB 2XYCA 3D1MC 3EF4A 4LFHD 2BIPA 4OIBA 3WN5C 3O11A 3TN0C 5F7NC 2FNWA 4KRPD 4XNAA 4BSWB 5MP6L 3R7RA 1D7BA 4XCEB 3T65A 3FSOA 2VABA 4OD2A 2VR5A 3HMXL 1C1EH 2XDHA 2BOBB 1D3CA 1OTSC 1RERA 3GTNA 1EHXA 3NCWA 1P7QA 4BHUA 3US0A 2BH0A 3FH5A 4FI7A 1M7UA 1K8IB 4L5FE 2UX7A 1QLRB 3G6JA 1EIBA 2DQTH 5C3IA 4QLWA 4H7VA 4PYHA 5F89B 3KBFA 3KYAA 1DBML 4P3DA 2QR1A 1PD6A 1NGXA 4I5BB 5HGDB 5TDPA 4O9HL 1E5CA 1IARB 5FYKL 5ENWB 4MXWL 4AIEA 3HZKB 5CLWA 3PL6A 4POZC 4W68A 4L8DB 4YHIB 4JPSA 1AD0B 1QBAA 4FF9A 3UJJH 4TVPL 4G1EB 3B37A 3FL7A 5LO7A 3QQ9D 1F3DJ 3BUIA 5GZND 1OD9A 2NSQA 3H9SE 1LP9B 4CA4A 3O2WH 3GZKA 3WU1A 3VAEA 3VD9A 1WZAA 5EOQH 2O5XL 4PJEF 1U8IA 4TUJB 1UM5H 2NYYD 3WIIL 5DUML 4FKEA 4CADA 2HKPA 4K3HA 1JBJA 1HKLL 1SXZA 2YBGA 3BT0A 1V5SA 4LSUH 2KLRA 5FYLL 1NCGA 4G9FA 4WW1A 2APXA 1J86A 1OIOA 2OLDA 3BGMB 1FFRA 5C3LD 2I27N 3MLRH 2VW7A 4NRYB 2NR6D 3DIVA 2EABA 4RSYA 3KWUA 2VE6B 3UZQB 1W8OA 1IE4A 4WFFD 1QFWM 3O41B 1MFNA 1A02N 1NWOA 1RSFA 4AJWA 1D5ZA 2BHUA 2QGCA 4JHAH 2PYFB 3DXAA 4GAGL 4MFHA 4QRPE 5B38G 4LSPL 3HN8A 4KY1L 3F7RA 5LKNA 4IGBC 4JJOA 4PJFE 3LXUX 1FZKB 4MXVE 4UQ3A 5D6DC 4J12A 2UZPA 3BZDA 2F68X 5HI5C 5FHAL 3L6FA 3MXWH 1ZTXH 5INDB 4M6MH 3FT4B 2CHWA 4Z76B 4PJ7F 3V7AE 4AYSA 2NOHA 3VD2A 4UQ2A 5F1OB 2ED6A 1GGCL 1MCDA 4WKXA 4XP5H 2NOEA 3OXRB 3TGXA 5LAXB 2YJQA 4OQTH 4YNYA 3NJNA 4P5RA 3I50L 4HCRL 5EOTA 5SV3A 4EUPB 1HXYB 3EIFA 3MGTA 1HINH 4KDVA 1NMBH 4JGNA 1XD0A 5DK2B 5J1AA 3RTQA 2WN2A 4G72B 4IRSD 1BZDA 2Y36H 5FFGA 2F8IA 3EYSL 1CDUA 1CS6A 1T04A 3ZDYB 2WKOF 2OMTB 1QEWA 1NBQA 2KI6A 2YUXA 2VSCA 2F74A 3QORA 4Y9GA 4FJZA 3TO4B 3CZEA 1MREH 5SX5H 1HWWA 4AKPA 3PP4L 4MNQA 3VFTB 1A3LL 4G5ZL 1NIFA 1P2CB 5I1AA 4U49A 4AYDC 4YE4L 1QW8A 4MRCA 2CLVB 4PRIA 3S35X 3ZTJG 3MSPA 2BW5A 3NCJL 2FHBA 2IFGA 1Y1UA 3EUUA 2G3MA 4EE2A 1JGEB 4EIGB 3D39D 2B3IA 1ID5I 2K6ZA 3FO1A 4FYRA 3SD2A 1ETA1 1T66C 2BINA 4RSVA 2HLAB 5DU7A 3AS3A 1G7JB 2A1WH 1LWHA 3K71A 4DFHA 5I6NA 1N70A 2H1PL 5L2KE 3JWOL 3PGCA 4KHXL 3LRLA 4S0TD 1G0XA 1DQML 2JCCA 3D69B 4HKXB 4Y4KC 3B9KB 5FFOA 3OPUA 3OXSB 1MFAL 4KROD 1PTZA 1VACB 5FM8A 2R1WA 1Q9KA 2XCMC 3ATBA 3TBSA 1LO3L 3HPJA 3OX8B 1OT4A 4LNRB 4JM2F 1I8AA 3EOAB 1RJZB 3L4CA 5JR1L 1CI3M 3NACL 5D70H 3NAAH 3TPUA 4P2YA 2DQUH 3VYPA 1A4BA 3SBPA 3ZL4H 5DMYA 5LBSA 4NC2B 1DE4B 4NQQA 5DWUH 2DQEL 4TTDD 2YS4A 3BQUB 3SKOA 4MQXD 1ID2A 4HD5A 1IGCH 4AJYV 1ZE3H 3HE7A 4FXLA 5EZPA 4WX8A 4KRPC 1IKNA 4PMEA 2FECL 3HRZC 3EF7A 2DLFL 3UGXA 2X10A 4WSGA 1QLEH 3EUDA 1TKWA 2Q86A 3PWPA 5JHLL 1NCDH 2JTDA 2ZWZA 4L4VE 1RZFH 4X9GA 4JFXB 3SDYH 2JIXD 4G42A 2Y7LA 1YZZA 2CM6A 3TXAA 5FYKU 3SE4A 1WC7A 3C6LD 4ZX6A 4X6BA 1FGNH 5DI8B 3KYNA 4FTDA 2IH3A 1MDAA 4D9RE 3STZA 4XMKH 1J48A 2AANA 1IBZA 4OJCA 3P4LA 4LE8A 2B2XL 3ZN6A 4LHQB 5MEOB 1JD9A 4XN7A 3ZZLA 2EVJA 2LU7A 3MV01 5GZNC 1E0OB 2WD0A 4F91B 1PZCA 3S3DB 3K74B 3NRQA 1P7QD 3MJ7B 1YUHA 2DS4A 3KH3A 1W9XA 4CL7A 5H2BA 1YEWA 3FCSB 3B7SA 3OKNA 1U8LB 5GRUL 5K1VA 1OP5K 4A7UA 1CG9B 4F2MB 1YPZF 1IBYA 2A9BA 2C8NA 3CBJB 4OVVA 4JLRB 5I1CL 1G7IB 3VI4F 4I89A 2Y23A 4M7ZC 3PL6D 1MF2H 4DKFH 5FOBB 4LASH 4NQDA 1RK0B 2WO2B 1SY6A 1UOWA 3ZKMD 1RK1B 4MNGB 1ZVNA 3SODB 4PGCA 1B6UA 1PL3A 3L7FB 2NLVA 3KLQA 4HAFA 1A3RH 5GGSY 4PVBA 1HNGA 1KCVH 4YXKH 3X3FH 3DPDA 4S1SH 1ZK5A 5IM7B 1AGEB 4QHKI 4O2FA 1S9VA 4ALAH 1FNEA 2B8OT 2DI7A 3RX7A 3S5LA 4Q9RH 3GEFA 4BK4A 3GKWH 3VX1A 1QFWI 5FO2A 2CO7B 1KOAA 3U48A 2YXMA 4N0UE 1A8JH 3CUPA 2XBTA 4G9FD 1RI8A 3BIKB 4PJXE 5T3XD 4QHUA 4K3GA 4ADIA 3MV8D 4LFHG 3IFPB 2NSXA 4R97C 2NDFA 1GCYA 1JZDC 2WLLA 2NW2B 2GBAA 4HWBL 2HFEB 1UXSA 1CICA 1PYWB 4ETQB 2O30A 2IBZX 4R5XA 4HFWB 1UCBH 3GDBA 1WV7T 3LTVA 4R0LB 3A3YB 4I8OA 3NJVA 4RNRB 2XC8A 5FV2A 3NIGF 4OZGF 3U7YL 5I6PA 4YK4B 3N6YA 3FT2A 4PP2B 3BSZA 3MQIA 3TH3T 2QBWA 3OKMA 1DJXA 3NZHH 3KGRA 3QUMA 4FLRA 1WDAA 4LSRL 1WFTA 3T5WA 2QKIC 3DI2B 2HVJB 4GBXB 1UD8A 2BSEA 2E76C 3FU8A 1KGCE 3OR7A 3C8KA 2FJGA 1EWHA 4OLZH 4R2GB 5EWIL 1QN9A 1YEFL 5C0FA 4FQIL 5IESH 4YWGL 3WKYA 1K8DA 3QJUB 2OMVB 1L9PA 2EXYD 2DJSA 2PCPA 3MOQA 5HGHA 5T1KB 1L7IH 3IDIA 1JGIA 3KGTA 3VXRB 2XZQH 1KIRA 2Z9TA 4JPIA 4Y2DB 5J6GA 1ZK9A 6PCYA 3BGAA 4JY6A 5E2UH 3RTQD 1NCBL 1OOAA 3E1F1 3MLYL 1DYZA 1WA1X 3I3DA 3R4RA 4NLHA 4EUPH 2AKRA 4TSBH 1Z9PA 3UTPE 3M8OH 2GI7A 4L8SC 3WGVB 4HF5L 1KN2H 1NGQH 2HWZL 4F9PA 2UX6A 3VFMB 1YECH 4ZUUA 1JZJA 3C5ZC 2QQNH 2ZX8A 4ZYKB 4O2EB 5B7FA 1F2QA 3CFEA 3QORD 5DYOA 5I73C 5E7BA 4AQAA 1C7TA 1VJSA 5HDQH 3ZDYE 4ZNEE 3K72A 4MNQD 1TQBC 2CHXA 4D8OA 2O61B 1KG0B 4B9CA 3VFPA 1JDAA 1EANA 3F05A 1RUML 4XPBH 3QISA 4OZHA 3R4DA 3L9YA 3WG7B 2PXYB 4PRID 4PJ9A 3IEAA 4HCFA 4ZFGL 2ICWA 3EO1A 3H2WA 4KROC 1LTXA 4LKCA 4MA1B 2BERA 3UROR 4E5XB 1L9RA 5C7ZA 5KYNA 5HGBB 3K6SB 3UH8A 4PVLA 3P3YA 4XP1L 3DUUA 4I0KA 5KBMA 4LMQE 5GJTH 2QPFA 4Y4FC 2A74B 4P5TD 2NNCA 3I3BA 2X89A 1AZZC 2XWZA 4XRCB 2VDKL 2R7EB 4BA8A 4MD4A 3OGDA 4X8XA 1IGYA 4P99A 4TTDC 2FYVA 1FLRH 4MQXC 4H1LG 1GC1L 4LPCA 3PCYA 4RFEA 3M17A 4ZTOH 3ZSSA 1JDDA 1K2DA 4A7QA 4LPVA 2OMWA 1I7UB 5D4QA 1M53A 1K6QL 2MOVA 3RYMA 6PAZA 1JPFB 1L9QA 2J8OA 1I4FB 1SDDA 2X6BA 5LXGH 3RNKA 3OR6A 1Z9SA 4KX8A 4UOW1 3EYQD 1SLVA 5KSBE 4F33B 2EDHA 3PHSA 3C6LC 1DBKL 2WXIA 1R4XA 4PJCA 4PBVC 5TE4L 1TJHL 1G6RB 2FUTA 4P59L 5EZIL 5L4FA 3HE7D 3UTOA 4GG6A 3Q05A 5DQJB 1XGQB 4PS4L 4QDGA 4E9XA 1TZOA 2H8PA 1D9KA 3IFNH 4Q4EA 3C2AH 1VENA 4OLEA 2MNUA 3A24A 1BPVA 1U8MA 3OLGA 2OSLA 1DFBH 1Z3RA 3QJOA 4QYOA 4GAJH 3VJ6A 3IGAB 3MBXL 1R3IH 3WFHA 1LE9A 5EEXA 2KDGA 5CBEB 1UWEL 1E4XI 1OSZB 3S3JA 4JM2B 3ZRFC 2JI2A 4F5CA 4FULA 5A43C 3IMTA 1T7WA 3KPRE 4RDBA 1KN4H 2D3JA 3ESNA 4DVBB 5AN4A 3FN9A 1IAIH 2JKJA 4LOFA 4KO7A 3D0VB 3WHXA 5CD3B 1O7SA 2Y5QA 2W9DL 3CXFA 3PL6C 1IJNA 3QFJB 5IMOB 1CFMA 3ZKMC 4LOVA 3BKJL 2LOEA 5JZ7D 3EAYA 1D6EB 3GFUA 3QWQB 2I9TA 3WUWA 1KJMB 5F7LB 4G6JL 1DBJH 4PS8A 3KYKL 5EO9B 2X4UB 5FUCC 1YEHL 4RBPH 5B1KA 1P6AB 1NM4A 4WTWA 1B0IA 2FSEB 2R2EB 4JCMA 5KBDA 2FIKA 2B08A 2XX0A 4GW4A 4U1SB 2V17H 3BT2H 2IFFL 4HJ0D 4XBEH 5JIMA 4XC1L 2YAMA 2ZXWB 3L3DA 3B34A 2LFGA 4YHZH 3ILEA 5IQNA 4X99B 4F2ME 4NQDD 5BXFA 4GW1B 1WGOA 1CZ8L 4ODHH 4KX7A 3T8MA 4FRWA 4LPWA 4YDVB 1OAYL 4JREC 2IXQA 2P5PA 2HJKA 3PE9A 3O0LA 4LP5A 1LNUA 3CVDA 4MNGE 4DPRA 1FC1A 4X8JA 2ZQKA 1TNMA 1KFQA 1KB5H 1QZNA 3PWUB 4F57L 1CFQB 4XOEA 4PTUB 5CD5D 1FNSH 1ZHNA 4ODSH 4X9IA 3U9PL 3U4EA 5GGVH 1AO7B 1EAOA 2A5UA 3I02A 3CVHL 3M86A 5E1GA 5BRZB 4M7KL 4G7YL 1PSKL 4HZLA 4K7FA 4OF0A 4HIJA 1E50A 4P4KD 5IHUH 3RWHA 4U2YA 4HISA 4RAVA 1EZVY 1PZ5A 4UQ9A 1E6JL 2XKSA 2EXYC 3DA0A 1WFNA 3ZSTA 4E42B 3VFWB 5D7LA 1VKXA 4TPRL 1I7RB 2NY1B 4K2UH 3D2UB 4HUVA 1WJ3A 5I1JH 2F53B 4U0RB 3ZHFA 4H2AA 5LNEA 1BMWA 4RQQA 5AVYB 1KC5L 2H3KA 4JRXB 4ZMPA 2DOCA 2BSED 1CFSA 1TFHA 1VGKB 4L5FL 4ACPA 1RCYA 4YFEA 5I23A 2WBJA 3NFPA 4NAMA 4N5UA 3PV7A 5D9SB 5B8CB 1ZLVK 4YHOH 1KBKA 1RIUH 1CE6B 1MHCB 2D03L 5LQBH 1ND0B 1ZXQA 3NRFA 3QSKB 1Q4NX 3D8MA 3DRQA 4N3TA 1L9OA 4JDZB 1AY1H 2C9QA 5DJ0B 3GUTA 1KT2A 2HZHA 1A9EA 4X4XB 2Y0SA 3APFA 2OP4H 5E08H 4FXGA 5HP5A 3PXHA 3C5XA 2G60L 2WANA 3E2HC 2G3ZA 1PCZA 2EDXA 2VUOA 4IRJA 3VXRE 3LEXB 4YZFF 4AYID 5IB1B 2WLYA 4ZPVA 5J7CC 3IGKA 4UB0H 3GMLB 3N55A 4X7TB 2YK1H 2BSDA 1FGVH 4HKBA 3P2DA 4X4ZA 2Q3XA 1QHQA 1RURH 1QNIA 1KYOK 1WS8A 5GS2H 3C5JA 3ARDB 1O6SB 3GM0A 1IGJA 1AIFA 4PJIB 1EHKB 4MQ7A 1UOLA 1CDGA 2V9RA 3FB8B 3GSNA 5A16B 3V52L 5LG6A 1YEEL 1JTOA 1JGUH 1NAKH 4JKNA 6FABL 1E4JA 1U3ZA 3A67L 4PJ9D 4BZ2H 2FT6A 4WW2A 3HE6C 2QLVA 4XPTH 3FOLB 3GSQA 4XN5A 1BGXH 2JKIS 2P44B 3BGFC 1FYTA 2B16A 3ATEA 2LHAA 2VXTH 3AUWB 2HJFA 2VDPL 5E2VH 5KVDL 5LDUA 2X89D 5CNHA 2K3TA 4QRUA 3MMEA 5CUSH 5F3HB 1B2YA 2XWCA 4JRLA 5E8EB 3RHWF 2GTZA 4ZW6A 1W80A 4YHPA 2LLGA 1RUQH 2H2PD 4XI5C 5HHOA 3TBTB 4PEEA 1MCEA 4F15B 7PAZA 3HE7C 5IZ7A 1CF8H 3T4AB 5DHVB 1KTBA 1ZOXA 4N5ED 4CGUB 1E3FA 4JQIL 1GGUA 1KFAL 1IKNC 5I6XB 4IBUA 1S46A 3H53A 2EDMA 4X5XA 3UP1A 2DYSB 2LGNA 1A7PL 2YJLA 3IXTB 3QCVH 2QZQA 2R9HD 3IJEA 3TJHC 1XF2A 4WI3A 2MCG1 4UU9A 1I3RA 4KJWD 3I75B 3L3HB 2VN4A 1MW1A 1WFIA 1AC6A 4KZDH 4GQPH 1R75A 5FUOL 4FP8L 3SE4C 1JERA 2CAKA 3I6LD 4GRMB 4R5TA 4ZS7H 5I71C 4R4FH 2BP0B 5AWNL 1WJWA 2V7NA 4OZFB 1MCHA 2QRDA 4NX0A 1E43A 2OL3L 1YAIA 2MTPA 2QVIA 2GBVA 1J9SA 3C2SA 3MRIA 1SLUA 3QRGH 4HAGA 4E9TA 4U2ZA 4Z95L 5KBLA 3P40A 4GIAA 3QC6X 5CF3A 2IAMA 1D9KD 1HXMB 5CFHA 4NKMB 3S35L 3VXSA 3CHRA 3KVDD 4NAJA 5JORA 2H0EA 4XMLH 3SGKA 5E1AB 1V7NL 5DD5H 3NVQA 1NPUA 3WKQA 4H20L 3NDYE 4L9LA 3HI6L 4PJDB 1KXQE 3DDFA 2VAJA 1PDKB 3J7HA 1L0YA 3B9AA 4RIRA 4NC1E 3VXPA 2ZOWA 2EDTA 1FAIH 3ZT6A 3MRNA 2R4SL 1PZUB 1LDPL 3H4FA 1T1XA 3BEVA 3L9EA 5IG7B 3ABKB 4WWNA 5F9CA 4KUZH 2ENYA 2FYYA 4X9HA 2GUOB 3R06A 1J9RA 1AS6A 1G9HA 5DLML 4ZQKA 1DZBA 1EERB 1UB5B 4KFMA 1ETZA 2OZ4A 3DX9B 1DDHA 1NGZB 3BAKA 3L4UA 4MD0B 4MB3A 4DZBB 2APBA 3MGOB 4N8CL 4XBGB 3V0FA 3JUZA 4B3EA 4F8LA 2HZSA 3QFJE 1EAJA 1XAKA 5CR1A 1DUZA 2X1XR 5T5FA 2IAAC 3CBRA 4UTAA 3PS6A 1B6DA 3RIFK 5DHDA 2EDOA 1ONQA 1H5BA 1S6NA 4BEIA 2YMXH 5FHBH 5HJDA 5I1IL 1T6WA 2LU4A 2XU9A 1HKFA 5F88B 3CH1A 1UH4A 5K93A 5CAYB 1DVUA 4HC1L 3BZEA 1DBBH 5CLZA 5AD0B 1ICTA 3MRPB 4HJIA 2BVTA 2FHCA 4QXVA 1OE1A 3EJSA 4PD4K 4NO5B 3BO8A 4PRNB 3VGAB 5B3NA 5JIDA 1CE1L 2ARJA 3K0YA 4U6VH 3OJ2C 3II3A 5ADOH 3T8XA 1CICC 1ORSA 4F58L 2FATH 2GTQA 1RZJL 2EDDA 1FO0B 3HUJF 1AGCA 3FQWB 1MWAL 4JFQA 4Z7UE 3VXQA 4D94A 5M95B 4TUOA 3VD1A 1BPLB 1SJMA 3QZMA 4HXAH 4MZRA 2K4WA 4PB0L 2WQVA 2GK0B 3ASWA 4PRHA 1OGPA 2OCJA 4FERA 4QOKB 5CWSA 1TO4A 1C5CL 2VXUL 1XGRB 4G3YH 1FL6A 4BELD 3ZTJH 2HPTA 1U93B 4A2DA 4L2LA 1KLGA 5AFAA 3VW3L 2EIMB 3UIZA 3MUJA 3P9LB 3RWIB 4LK4A 3U4BH 4ZUWB 4KZCA 3VB8A 2O93L 4NQXA 1FF5A 1XF5A 1UGNA 1AO7E 3PWVB 1NMAL 5D7LD 5BQ7B 5BRZE 1YQMA 1VFUA 1E65A 1VZIA 2RIKA 4MMXA 4YPGA 1C9SA 1PNDA 3FMGH 1PQZB 1VESA 1FNGB 1MCBA 3LZNA 3WS3B 3OB0K 1Y18A 3QR0A 4HLJA 4NDMB 3QNFA 2P5WB 4I3RH 1EBAA 1EFXA 4PRBA 4FLOA 2QVFB 3ZO9A 1L3WA 3MV7B 5F7AA 3LRKA 2F53E 4YBQD 5E94B 3K2KA 3QO1B 3QR2A 1CQYA 3ABGA 3Q5TA 4PI2A 3FQNB 2BVPA 12E8H 4F9PC 5A6IA 3OKEA 2I7OA 2WBJD 4TNEA 4YSAA 1X5HA 1G7QA 3D3VD 1FZJB 4UT7H 4P3CL 3L9RB 4ZO8A 4C54A 5J8OA 4K8RL 4FFYA 2HTKD 3OVUB 2DAVA 2AJXL 4QKXB 4TRPH 1XHHA 3B4NA 4HKZA 2BSCA 1TEFA 4L1DA 4OF7A 3S5LG 5AAPA 2NRDA 5CP3H 1QO3A 3MV9B 4DGIH 1IZJA 4PJ9C 4BH8B 4IRJD 2MQCA 1EHNA 2WZ0A 3ZE1B 1JFQH 4ZBJA 3HS8A 4H5SB 3SB3A 3WUZA 1YEDB 4WU5B 5JHDE 5F8RC 3AS2A 4UV4H 2YMOA 3M7FB 3LXCA 3MU3A 1AHWB 3OSTA 1YEKH 3BDYL 2H9GB 1DANT 2P7TA 3QDGA 1C5BL 1I1RA 1IM3A 3FO0L 1YMHA 2EE0A 2ZP9A 4LCIL 4XE5B 4PJIE 5L7XH 3JXAA 2ZIDA 1NAMB 4KNQA 1E2WA 4OJEH 1GZPB 2R9HC 4NPKA 4Y2LA 5DDHB 4LIQL 4NSKB 1WA0X 4JKPH 3U0PB 1RHHA 4ACTA 4KJWC 2P42B 4FLQA 1FZMA 4XPAH 4HIEB 5I0ZA 1HI6A 1NH6A 3W56A 1Y0LB 5EEWA 2IEPA 1I85A 1PAMA 4Y8AA 3ESVF 2YD8A 4NWTH 2JTYA 1MFDH 1TTUA 3DMMB 4PCSA 5HHOD 4JFPB 2CMRL 5CKGA 3BP4A 3DX7B 5IYCP 4NFBA 5GRZA 4I18A 5GSRA 3MJ9H 1ZLSL 1YHPA 1N5YL 4RMUA 4CVXB 2BXYA 1D9KC 2R39A 5F6HI 1XVSA 4HEMA 3A6CH 3F7LA 3BUDA 5FKAA 5I1HH 1ET7A 1HSAA 3RDJA 2A73B 3MBEB 2GUYA 2G5BA 4MAYA 2VDLB 3B2UD 5DRXB 3WL9B 2IPKA 2IPUK 5C8JA 1Q9LA 2OA9A 4AVKA 5FOJA 3H9YA 2YAOA 1F90H 1TETL 4UZUA 4KMQA 2JLLA 3RU8L 1IEHA 4HSQA 1R3LA 2GT9A 2V2XB 4MAZA 2EEAA 4N0RA 4OJFL 4PJGB 3UBXG 4N0YH 4FFZL 4OZFH 2IAMD 1Q0YL 1I3GL 1KY6A 1AZRA 4KI5D 1V05A 3VXSD 5HVHC 1T0PB 2X09A 3MUHL 1ADWA 2IANB 2RHEA 2CIIA 3HG4A 4JBSA 2V3DA 4KXZH 1J1XL 1MCLA 1MIEH 3K4AA 5EA0H 3WLBA 3EADA 1UM6H 3IS0X 5FFLA 2E0PA 2Y1AA 3G5XA 4HJ1A 2ZXAA 4R84A 1BV8A 5IVNA 1YTBA 1O6VA 4E2OA 3D85B 5F7UA 4PJDE 4PR5B 1XMEB 4G7VH 2NTFA 4MSWB 2AJYL 2L0DA 3N2JA 4WEMB 3BWUF 2DIAA 4IMLA 1EZLA 1HHJB 4CVZB 3CC1A 4O2CB 4J8RB 3VFUB 1DDTA 1R5WA 4M6NH 3JWDL 2E9JA 3M1BB 1TT6A 4TSCL 1E28B 3IDGA 4K9EH 4P3WA 2FAUA 3JTBA 2R0WH 1T1WB 4UAOB 4N1EA 3QAZC 1GL4B 3KHOA 2IV9A 5DO8A 1KGXA 1RIHH 5EORH 1ZLWK 1MEXH 3LD8B 4F3FA 3W11D 3FU6A 3EZ8A 5BO0D 1I1YA 2ESVA 2WYZA 3CCHA 3MFFA 2ALWA 1A7NL 3UPRB 2E7BA 4MHHI 4M56A 3CGTA 3RDTA 4ELMA 2AEQL 4ZSOE 2YA2A 4AQEA 3QGVA 4G70B 1UYWH 2EILB 1ZHKB 5CEXA 4BFKA 2CHZA 3OGCB 3BAEL 1I7ZA 5F8QC 1G1CA 5GGSB 5IF0A 4LO9A 4QHMA 2OYMA 1UXLA 1OWRM 1CL7I 1XGPB 4JG1H 3BX7C 3H8NA 4WI9A 1TLMA 4F9LA 2YPKA 4Z7OB 3HN3A 3LNHA 1B9ZA 3PHQB 1TPXC 1LWRA 2FUQA 4PRHD 5FM5M 2KKQA 4OGXH 4DGVL 3D06A 3BYYA 5AZ2H 1RUPH 3QCUH 3RPIA 1IJ9A 2DYPB 1BJ8A 4OGAD 5I1GH 4GUPA 3EJZD 4QOKE 4MKMA 1CQKA 4J6IA 4NCC1 1PCJX 1N0LA 3K4ZA 4OZIF 3TJEH 3CDZA 2WBJC 2WAHA 3WO4B 4NZJA 4HUWB 2YZ1A 3ISRA 4BE5A 2E9IA 5JPNA 1HL8A 4UQIM 3BHBB 1BFSA 4OH2A 4IQHA 2XTLA 4RDQF 3WUWG 1KCWA 3ABLB 4LEOA 1U36A 2HG0A 4FNLL 5L4JA 3KCPA 2BCMA 2NY0B 2P43B 3Q48A 1E40A 1WSST 4BSVB 1THCA 1NCCL 4RZCA 1TQSA 4H1LH 4FXGC 3VG9B 5IT2H 1QZ1A 1KBWA 1XXDC 1EFXD 4IRJC 2XWBA 4M7LL 4OF5A 5L6YL 2JB6B 3L08A 3MLUH 3T0VA 3KXFB 3T09A 3N41B 4O4YL 3MRRB 4PCTA 5KJRL 4P2AA 2V8MA 5BNXD 5JIIA 3B5TA 3I6GB 1EUUA 1MFCH 1G94A 1YNTF 2J6EA 3CSGA 3MV7E 3OZ9H 4GQRA 5AYQA 3WNKA 4F1SA 1NBZB 4ZUSA 2WCGA 3ILPB 4OV5A 1P5UA 2MHAB 5D7IB 2NMSA 5BZWB 1S9YA 1JUFB 3QRBA 4X6EB 4C4KT 3RWJB 5EF1A 2MPVA 3LSOA 4M3JA 4N8VA 1HCZA 1QYGL 1CJYA 3DTUB 3MTXA 4WW2C 1TVBA 4YDIH 3DNKA 1N9PA 2UY6B 4C83A 3QDJA 2PABA 4ZD3H 1Q9OB 3S6CA 3OQ3B 4HIPA 3ASMA 2ZKHL 3AG3B 3I6SA 3CG8A 1H0DA 2DQCH 2Y6SD 5IOPB 5IFAL 3MV9E 4UT6A 4A6YH 3CHOA 5IYBP 1IGTB 2YO3A 2XWDA 3DVGB 3KJ4B 4WI0B 1XF4A 2W07A 3TT1H 5EEUA 3D2TA 2A6DB 3VCLA 5AW5B 4XCNA 3N9GH 3ZE1E 1MAKA 1FN4B 2KMWA 2X0VA 3MNZA 3X14A 1SEBB 4F8TA 2IDFA 2E59A 3AWEA 3QDGD 2XA3A 1G7PA 1CTOA 5KYWA 4J39A 4P23B 4MB5A 5CSBA 4KTYA 4R5VA 1KZYA 5I9QC 3G5ZB 3RJQB 1IM3D 4Y5XB 4IU3B 2I9LA 3SZ6A 4DKTA 4O02L 4KVNH 1NMCC 5DSCB 3HPLA 1DVTA 4Y16A 3V9EA 5D7HA 2V9QA 2VLRA 3KLKA 2AV7A 3QIUA 4TNFA 5CEZD 1NGMA 4GSDL 1NAMH 4HJUA 4YIQB 1W72B 2W9EL 1TVHB 3B2UC 4FQHA 5F7HA 2F5BH 4OD3H 4UT9A 4U6HA 1MJJB 1FH5H 2O6EA 2CDGB 2D7NA 1TUPA 3H2PA 3MRCB 4JN2B 1PX3A 5DMIL 2ZXEB 4F93B 4MKTA 3LS5L 4WJG3 2G0LA 4X0KA 1ANUA 3DX6B 4PJBE 4A37A 2GITB 2KZBA 1QSFB 2G9HB 4M93B 2EYTB 4R4BB 4ICXA 3NZ8B 2X4RA 1JNLH 1WS7A 4KI5C 4QLRA 5GZOA 4OCSL 5C6TL 1E9OB 3DWTA 1U91B 2GJ6A 3CXHJ 1AI1H 3HN5A 4L9LC 4APXB 5K9KA 4P2OB 4I85A 5L4IA 3JV0A 2VDLH 1B0GB 3L5JA 5FF6B 1R24A 4NXSA 2H1LM 3FQ1A 3RL2B 4DJMA 3MODH 4HQQH 3GRGA 1YCSA 2GC7C 2WINA 2Z0BA 4A1RA 5GISL 3CSBA 4OLWL 2WPGA 2HT4D 3P4OB 2ZOUA 2ZUUA 1SF3A 3SE9H 3WY3A 1XGTB 2OM5A 3O8XC 5D1QB 5KZCB 1N3CA 1S5HB 2WBKA 5HYJD 2AC0A 4PJGE 3I85A 2YAEA 4MX7A 5C6WH 1TYRA 1UFUA 2VYRE 2YAHA 3AREA 1OARH 2VR7A 3CNKA 3IE9A 2WAQA 3MRDB 4H8UA 2JMRA 5HDLA 5CJ5A 4I9XA 4GUOA 3DETC 3VTMA 5I8KL 3RRQA 2GTWA 3P73B 2F0CA 2IANE 1A3ZA 4O58L 4YC2B 5CN1A 5FYJU 1H5BC 1S7TB 4XPHL 3W11C 3ZR6A 1UVQA 1TLKA 4OJDH 4LPXA 3FU9A 5I28A 1DVQA 1IIIA 3QZLA 3GHBL 1EEYB 2VERN 2BVOB 4X83A 5E9NA 5J3HC 4RETB 3CZLA 5C0GB 5I66A 3GB7B 4UBDC 4PRAB 2IPTL 3V95A 4YXHH 1JMZA 4QXUH 3ZYJA 3TFKC 1S7UA 1JXDA 3BPCA 1UENA 2BFGA 2QGBA 3CTTA 4WK4B 4IOIA 4WHCA 5AUMA 3DSNB 4WCYL 4AJ0A 3DC0A 2VITA 2HX8A 1MFEL 3R1GH 1J8HA 4AMXA 4GOSA 1I9IL 1KCRH 2C4FU 2ESVD 4N3UA 2P1YA 4X4MA 1E4WH 3V5KA 4KXBA 1FL5A 1RPKA 2M26A 3ZHLA 4UANA 3IF1B 4X6DA 1XF3A 3DDGA 4OGAC 1WCBA 4NO0A 2BFVL 2IMNA 4XCCH 2ETWA 3QI9B 5I1LB 2BNQB 1F56A 4K5NA 1OSPL 5BVJB 3AQYA 2AK4B 2TAAA 3DRTB 4MLIA 2PETA 5ESAA 1MZZA 1JVLA 4M62L 4LCYA 1QLFB 4J7RA 5CSZB 3O3EA 4G9FE 2FL5B 3WTUA 1N10A 3MV8E 1JRHH 1JF1B 3DECA 1T0MB 1OXYA 1YNKH 1KGYE 2VR3A 4MMXC 2P8PA 5EO0A 3THML 4HOMA 1KSRA 1FVCA 2OXHA 2NQDA 3BKQX 3RLSA 1I1AB 1EEUA 1CFNB 3L3OA 3PABA 4E0RA 1G6RL 4Q11A 3OAZK 4Z7OE 5D72H 4K0OA 4XXCA 3AG2B 1IBGH 4X9FA 3DV4B 4MHHG 2DEWX 1ED3B 1NDMA 3AC0A 1RULL 5AOZA 3AW5A 3V4PA 4YHKL 5C7XH 4AXWA 1E8WA 5BQDA 4Q52A 3EYVA 4D9LL 4WFGD 1DVXA 2BZ7A 1G43A 3QDHA 1BLIA 1YYMH 4XTRD 2K9UA 3GI8L 3FB7B 25C8H 4Q9BA 5CIPA 3K1DA 4HUCA 4E9YA 3DK0A 4IS6B 5K59E 2C3VA 4AEIH 4U6YA 3SSGA 3GXNA 1E9PB 1QR1A 1K35A 3UBFA 3VRLE 1QFPA 4L0PB 5C0GA 1JZ3A 4YDZA 1NDGA 3CDYA 3WTVA 2VZOA 1MXGA 32C2A 2I5WA 3TF4A 2ADYA 1F97A 2DWTA 2C7FA 4J8QA 5ALBH 4MJ6A 5K1JA 2DKCA 2YWZA 1ECYA 1FHNA 3KPOA 5CU5A 2VXQH 4MDJB 4K23L 4P5MB 1KCLA 5KN5A 2CIKB 4PWJA 2CBQA 3KXFE 3W2DH 4D0DB 2ZAGA 2WQWA 3KWWA 2J4WL 4N2BA 2V8QA 1KCUH 1UWGH 1QBMH 1WBXB 4Y2OB 3EW3B 2APSA 4YLQT 5FV1L 1U8KA 5IVZB 2Z8VC 3BPNB 3DROA 4KKLD 1N64H 1W0WA 2GJRA 2LT9A 2A2QT 4KJQD 1P1ZA 1ADQH 3UBXB 3ARGA 3P77B 5C09A 5D7IE 4N22A 5MENA 3QDJD 2Z92A 5TDOB 2JH2A 4LLUA 5DFAA 2KBGA 2ZG3A 1I1FB 1UTDA 3X1FA 4PLKD 3UO1H 1YEGH 1OEZW 2ZNWA 2R1XA 2IGLA 2Z91B 2ZX5A 4H8WC 5EBMA 1DJHA 3O4LD 5GRJL 2BHZA 4K71C 1DN0B 2IG2L 4NENB 1I85C 3ATDA 2OTWB 5D71L 1M05A 2X6VA 1A1NA 4HWZA 2J8UF 2NLJB 1G5AA 4PLOB 3PDDA 2ADGB 1VCAA 1W0VA 4I18C 2QELA 4BBWA 1OP3H 3MUZ1 3WDJA 1CI5A 4Y16D 1MUJB 5KSUB 2VLRD 3QIUD 3VQ1C 5DMGD 1S5IL 1JCKA 4MAYC 3BVNB 3IN0A 4BWUA 2QGDA 3OSMA 2QSVA 1RFDL 2FJUB 3NK3A 4CBZA 1WHPA 1SRDA 4V33A 3EFOA 3DIFA 4QRQB 4L3EA 5GS0H 3T0BA 1U58A 2VZ3A 1HJBC 1CTNA 2HT4C 3CHPA 4KMTL 1HQRB 2I60L 2Q20A 2Y7SA 2AK1L 3PHAA 5I15L 3SN6N 5GZO