4EAIA

Co-crystal structure of an ampk core with amp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
AKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDGGGGGGGSHTIEFFEMCANLIKILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 23
structure length 100
sequence length 100
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4eaiA01
2QR1A 3T4NA 2Y8QA 2QRCA 2OOXA 4EAIA 3TDHA 4EALA 2QLVA 2QRDA 4EAKA 4EAJA 2OOYA 2ZFDB 2EHBD 2Y8LA 3OSEA 1UL7A 3TE5A 2QREA 2V92A 2V9JA 1V5SA 2V8QA 4CFFA 4EAGA 2YA3A
chains in the Genus database with same CATH superfamily
1LWVA 3F10A 2FGTA 4B0AA 1PCMX 5JMVD 2D0AA 2NOFA 2QR1A 1KO9A 3T4NA 4WXAA 5F9CA 2Y8QA 2XHIA 1PVSA 1YQRA 1QN7A 1VKLA 3H1ZA 1KYDA 1LWYA 3ASMA 4EAJA 3CW7A 5EPCA 4WZSD 1UT7A 1LWWA 3OSMA 1UL7A 3TE5A 1P5GX 1J3MA 1N39A 4EJZA 2HL9A 1QN3A 1EUVA 2D0CA 2V9JA 3N89A 1E42A 3CVTA 3F0ZA 1N3CA 1KFIA 1MPGA 1QN6A 4QG5A 1V5SA 2LAEA 3UW2A 5IYDP 3RSMA 1XSZA 2FUVA 2JOIA 1FN7A 3CWUA 3CWTA 2YA3A 4DULA 1R4XA 1TBAB 2HKPA 3OH6A 1YQKA 3ENCA 2Z8UA 4Q11A 2F7LA 3EAYA 1YTFA 1KFQA 1PCZA 1M3HA 2NOBA 4I8OA 3CWSA 3D7QA 4EAIA 1WQAA 4TPSA 5BMNA 1QNAA 2FKMX 2QRDA 3HS8A 3KRMA 1C4GA 2ZFDB 1D3UA 5AN4A 1KY7A 2MZ8A 3IH7A 1QNBA 5KL0A 2NOLA 2DKAA 1M5Q1 3HS9A 5IYCP 2V92A 1KYFA 1K2YX 2DKCA 2HZMA 3BKQX 3DPTA 3DPUA 3CWAA 1RM1A 1JFIC 3OCIA 2R5XA 1UT4A 2DKDA 1TGHA 1PZDA 1YTBA 3RPJA 4C7PA 2O3OA 3NA5A 1KYUA 2IV8A 1C9BB 1CDWA 1TUOA 2Z0FA 1HU0A 3OC3C 1M3QA 2NOHA 4IL8A 2JPIA 4ROEB 3I3WA 1YQLA 2JHNA 1PCJX 2QRCA 3ENOC 1QTPA 2NOIA 1P5DX 1DIZA 2VJ0A 3ULXA 2NLVA 2OOYA 5BMPA 4EJYA 1AISA 2EHBD 2Y8LA 1QTSA 3OSEA 3VN5A 1NVPA 3OLPA 4PY5A 5JN5A 2HZSA 2QREA 2YH5A 1NGMA 1EBMA 1VOKA 2NVMA 3EIKA 1JDYA 3PDKA 1WJWA 1Q9UA 4CFFA 4D7QA 2D0BA 4WX8A 3I0WA 3CVSA 4EAGA 1VTLE 1QN8A 2MJ7A 3PMGA 3SNSA 4RODB 3C04A 2HL8A 4HJHA 5IYBP 2NOZA 2NWVA 1QN5A 1T6AA 3OH9A 2I5WA 4D7RA 3KTUA 4BJUA 1QNEA 2OOXA 2NOEA 3TDHA 2FKFA 1K35A 1B9KA 1TBPA 4EALA 2QLVA 3I0XA 4EAKA 4ROCB 1MP9A 2G30A 1QN4A 1QN9A 1VTOA 3OSTA 2PWWA 5HSHA 1C47A 2JHJA 2H4LX 1W80A 2IV9A 1QNCA 2H5AX 3D4VA 1YQMA 2V8QA 1NH2A 1N3AA 1VOLB 3OGDA 1KY6A 1LXTA 4MRQA
chains in the Genus database with same CATH topology
2QR1A 3T4NA 2Y8QA 2QRCA 2OOXA 4EAIA 3TDHA 4EALA 2QLVA 2QRDA 4EAKA 4EAJA 2OOYA 2ZFDB 2EHBD 2Y8LA 3OSEA 1UL7A 3TE5A 2QREA 2V92A 2V9JA 1V5SA 2V8QA 4CFFA 4EAGA 2YA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QR1 A;  3T4N A;  2Y8Q A;  2QRC A;  2OOX A;  4EAI A;  3TDH A;  4EAL A;  2QLV A;  2QRD A;  4EAK A;  4EAJ A;  2OOY A;  2ZFD B;  2EHB D;  2Y8L A;  3OSE A;  1UL7 A;  3TE5 A;  2QRE A;  2V92 A;  2V9J A;  1V5S A;  2V8Q A;  4CFF A;  4EAG A;  2YA3 A; 
#chains in the Genus database with same CATH topology
 1LWV A;  3F10 A;  2FGT A;  4B0A A;  1PCM X;  5JMV D;  2D0A A;  2NOF A;  2QR1 A;  1KO9 A;  3T4N A;  4WXA A;  5F9C A;  2Y8Q A;  2XHI A;  1PVS A;  1YQR A;  1QN7 A;  1VKL A;  3H1Z A;  1KYD A;  1LWY A;  3ASM A;  4EAJ A;  3CW7 A;  5EPC A;  4WZS D;  1UT7 A;  1LWW A;  3OSM A;  1UL7 A;  3TE5 A;  1P5G X;  1J3M A;  1N39 A;  4EJZ A;  2HL9 A;  1QN3 A;  1EUV A;  2D0C A;  2V9J A;  3N89 A;  1E42 A;  3CVT A;  3F0Z A;  1N3C A;  1KFI A;  1MPG A;  1QN6 A;  4QG5 A;  1V5S A;  2LAE A;  3UW2 A;  5IYD P;  3RSM A;  1XSZ A;  2FUV A;  2JOI A;  1FN7 A;  3CWU A;  3CWT A;  2YA3 A;  4DUL A;  1R4X A;  1TBA B;  2HKP A;  3OH6 A;  1YQK A;  3ENC A;  2Z8U A;  4Q11 A;  2F7L A;  3EAY A;  1YTF A;  1KFQ A;  1PCZ A;  1M3H A;  2NOB A;  4I8O A;  3CWS A;  3D7Q A;  4EAI A;  1WQA A;  4TPS A;  5BMN A;  1QNA A;  2FKM X;  2QRD A;  3HS8 A;  3KRM A;  1C4G A;  2ZFD B;  1D3U A;  5AN4 A;  1KY7 A;  2MZ8 A;  3IH7 A;  1QNB A;  5KL0 A;  2NOL A;  2DKA A;  1M5Q 1;  3HS9 A;  5IYC P;  2V92 A;  1KYF A;  1K2Y X;  2DKC A;  2HZM A;  3BKQ X;  3DPT A;  3DPU A;  3CWA A;  1RM1 A;  1JFI C;  3OCI A;  2R5X A;  1UT4 A;  2DKD A;  1TGH A;  1PZD A;  1YTB A;  3RPJ A;  4C7P A;  2O3O A;  3NA5 A;  1KYU A;  2IV8 A;  1C9B B;  1CDW A;  1TUO A;  2Z0F A;  1HU0 A;  3OC3 C;  1M3Q A;  2NOH A;  4IL8 A;  2JPI A;  4ROE B;  3I3W A;  1YQL A;  2JHN A;  1PCJ X;  2QRC A;  3ENO C;  1QTP A;  2NOI A;  1P5D X;  1DIZ A;  2VJ0 A;  3ULX A;  2NLV A;  2OOY A;  5BMP A;  4EJY A;  1AIS A;  2EHB D;  2Y8L A;  1QTS A;  3OSE A;  3VN5 A;  1NVP A;  3OLP A;  4PY5 A;  5JN5 A;  2HZS A;  2QRE A;  2YH5 A;  1NGM A;  1EBM A;  1VOK A;  2NVM A;  3EIK A;  1JDY A;  3PDK A;  1WJW A;  1Q9U A;  4CFF A;  4D7Q A;  2D0B A;  4WX8 A;  3I0W A;  3CVS A;  4EAG A;  1VTL E;  1QN8 A;  2MJ7 A;  3PMG A;  3SNS A;  4ROD B;  3C04 A;  2HL8 A;  4HJH A;  5IYB P;  2NOZ A;  2NWV A;  1QN5 A;  1T6A A;  3OH9 A;  2I5W A;  4D7R A;  3KTU A;  4BJU A;  1QNE A;  2OOX A;  2NOE A;  3TDH A;  2FKF A;  1K35 A;  1B9K A;  1TBP A;  4EAL A;  2QLV A;  3I0X A;  4EAK A;  4ROC B;  1MP9 A;  2G30 A;  1QN4 A;  1QN9 A;  1VTO A;  3OST A;  2PWW A;  5HSH A;  1C47 A;  2JHJ A;  2H4L X;  1W80 A;  2IV9 A;  1QNC A;  2H5A X;  3D4V A;  1YQM A;  2V8Q A;  1NH2 A;  1N3A A;  1VOL B;  3OGD A;  1KY6 A;  1LXT A;  4MRQ A; 
#chains in the Genus database with same CATH homology
 2QR1 A;  3T4N A;  2Y8Q A;  2QRC A;  2OOX A;  4EAI A;  3TDH A;  4EAL A;  2QLV A;  2QRD A;  4EAK A;  4EAJ A;  2OOY A;  2ZFD B;  2EHB D;  2Y8L A;  3OSE A;  1UL7 A;  3TE5 A;  2QRE A;  2V92 A;  2V9J A;  1V5S A;  2V8Q A;  4CFF A;  4EAG A;  2YA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...