4EAIA

Co-crystal structure of an ampk core with amp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
100
structure length
100
Chain Sequence
AKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDGGGGGGGSHTIEFFEMCANLIKILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 23
structure length 100
sequence length 100
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4eaiA01
2QRDA 2EHBD 4EALA 3OSEA 2Y8LA 4EAJA 2QLVA 3TE5A 4EAIA 3TDHA 2OOYA 1UL7A 4EAKA 2ZFDB 2V9JA 2QRCA 2V8QA 2YA3A 2Y8QA 2OOXA 4EAGA 2V92A 4CFFA 2QREA 3T4NA 1V5SA 2QR1A
chains in the Genus database with same CATH superfamily
1QN8A 3EIKA 1KYFA 5BMPA 1RM1A 2PWWA 1HU0A 3RSMA 1CDWA 2QLVA 1QNAA 2I5WA 2NOHA 4DULA 2DKAA 3IH7A 1QN6A 3F0ZA 2ZFDB 4IL8A 1DIZA 2YH5A 2FUVA 1P5GX 1NGMA 5IYBP 1FN7A 2HZSA 2O3OA 2YA3A 2R5XA 2NOBA 3I0WA 1YQMA 5AN4A 4C7PA 2IV8A 1B9KA 3I3WA 1R4XA 1TBAB 2FKMX 4CFFA 1C47A 1YTFA 1JDYA 2IV9A 2F7LA 3C04A 3VN5A 4D7RA 5JMVD 1EUVA 3OLPA 1LWYA 4TPSA 1WQAA 1YQLA 1MPGA 1C9BB 1PZDA 2XHIA 3D4VA 3BKQX 1QN4A 5IYDP 2JPIA 1QNBA 4EJZA 4WZSD 1QN9A 1KYUA 5KL0A 2NWVA 3HS9A 3CWUA 1J3MA 3CWSA 1KFQA 1VTOA 2QRCA 1QN5A 2V8QA 3ENCA 3DPUA 3EAYA 2JOIA 1N3AA 1C4GA 2Y8QA 2D0AA 3OSMA 5HSHA 1TGHA 3OH9A 3D7QA 2V92A 1UT7A 1QN7A 2D0CA 1M5Q1 1QNEA 4BJUA 1YQKA 2JHJA 3H1ZA 1UT4A 2MJ7A 3CVSA 3CWTA 3KRMA 1V5SA 2H4LX 3CW7A 1LXTA 2DKDA 4EALA 1WJWA 2Y8LA 1PCZA 4EAJA 5BMNA 4ROCB 4D7QA 3N89A 3TE5A 1LWVA 1TUOA 1D3UA 3OSTA 3PDKA 4QG5A 4EAIA 2MZ8A 2NOEA 2FKFA 2H5AX 4ROEB 2Z8UA 3OC3C 5F9CA 1QN3A 3F10A 4PY5A 2Z0FA 3HS8A 1KY6A 1QTPA 2JHNA 1XSZA 1VOKA 2HL8A 3ULXA 4RODB 2HL9A 2OOXA 3KTUA 1K2YX 4EAGA 2NOZA 1KO9A 2HKPA 2LAEA 1LWWA 4WXAA 2VJ0A 3OCIA 3DPTA 1W80A 3I0XA 2QRDA 2D0BA 1VKLA 2EHBD 1PCMX 3OSEA 2DKCA 4HJHA 4I8OA 1KY7A 1NVPA 3CVTA 3OGDA 1EBMA 5IYCP 4EJYA 2NOIA 3TDHA 2OOYA 1MP9A 1P5DX 3ENOC 1UL7A 4Q11A 4EAKA 3OH6A 2V9JA 1YTBA 4MRQA 1YQRA 1M3HA 3PMGA 1VOLB 1Q9UA 2NLVA 2G30A 1JFIC 2NOFA 4B0AA 5JN5A 2FGTA 1TBPA 4WX8A 3ASMA 1PVSA 2NVMA 2HZMA 3NA5A 1E42A 1M3QA 1AISA 1VTLE 1PCJX 2NOLA 1N39A 1NH2A 2QREA 3RPJA 3T4NA 1KYDA 5EPCA 1QTSA 1KFIA 3SNSA 1N3CA 1QNCA 1K35A 3UW2A 3CWAA 1T6AA 2QR1A
chains in the Genus database with same CATH topology
2QRDA 2EHBD 4EALA 3OSEA 2Y8LA 4EAJA 2QLVA 3TE5A 4EAIA 3TDHA 2OOYA 1UL7A 4EAKA 2ZFDB 2V9JA 2QRCA 2V8QA 2YA3A 2Y8QA 2OOXA 4EAGA 2V92A 4CFFA 2QREA 3T4NA 1V5SA 2QR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRD A;  2EHB D;  4EAL A;  3OSE A;  2Y8L A;  4EAJ A;  2QLV A;  3TE5 A;  4EAI A;  3TDH A;  2OOY A;  1UL7 A;  4EAK A;  2ZFD B;  2V9J A;  2QRC A;  2V8Q A;  2YA3 A;  2Y8Q A;  2OOX A;  4EAG A;  2V92 A;  4CFF A;  2QRE A;  3T4N A;  1V5S A;  2QR1 A; 
#chains in the Genus database with same CATH topology
 1QN8 A;  3EIK A;  1KYF A;  5BMP A;  1RM1 A;  2PWW A;  1HU0 A;  3RSM A;  1CDW A;  2QLV A;  1QNA A;  2I5W A;  2NOH A;  4DUL A;  2DKA A;  3IH7 A;  1QN6 A;  3F0Z A;  2ZFD B;  4IL8 A;  1DIZ A;  2YH5 A;  2FUV A;  1P5G X;  1NGM A;  5IYB P;  1FN7 A;  2HZS A;  2O3O A;  2YA3 A;  2R5X A;  2NOB A;  3I0W A;  1YQM A;  5AN4 A;  4C7P A;  2IV8 A;  1B9K A;  3I3W A;  1R4X A;  1TBA B;  2FKM X;  4CFF A;  1C47 A;  1YTF A;  1JDY A;  2IV9 A;  2F7L A;  3C04 A;  3VN5 A;  4D7R A;  5JMV D;  1EUV A;  3OLP A;  1LWY A;  4TPS A;  1WQA A;  1YQL A;  1MPG A;  1C9B B;  1PZD A;  2XHI A;  3D4V A;  3BKQ X;  1QN4 A;  5IYD P;  2JPI A;  1QNB A;  4EJZ A;  4WZS D;  1QN9 A;  1KYU A;  5KL0 A;  2NWV A;  3HS9 A;  3CWU A;  1J3M A;  3CWS A;  1KFQ A;  1VTO A;  2QRC A;  1QN5 A;  2V8Q A;  3ENC A;  3DPU A;  3EAY A;  2JOI A;  1N3A A;  1C4G A;  2Y8Q A;  2D0A A;  3OSM A;  5HSH A;  1TGH A;  3OH9 A;  3D7Q A;  2V92 A;  1UT7 A;  1QN7 A;  2D0C A;  1M5Q 1;  1QNE A;  4BJU A;  1YQK A;  2JHJ A;  3H1Z A;  1UT4 A;  2MJ7 A;  3CVS A;  3CWT A;  3KRM A;  1V5S A;  2H4L X;  3CW7 A;  1LXT A;  2DKD A;  4EAL A;  1WJW A;  2Y8L A;  1PCZ A;  4EAJ A;  5BMN A;  4ROC B;  4D7Q A;  3N89 A;  3TE5 A;  1LWV A;  1TUO A;  1D3U A;  3OST A;  3PDK A;  4QG5 A;  4EAI A;  2MZ8 A;  2NOE A;  2FKF A;  2H5A X;  4ROE B;  2Z8U A;  3OC3 C;  5F9C A;  1QN3 A;  3F10 A;  4PY5 A;  2Z0F A;  3HS8 A;  1KY6 A;  1QTP A;  2JHN A;  1XSZ A;  1VOK A;  2HL8 A;  3ULX A;  4ROD B;  2HL9 A;  2OOX A;  3KTU A;  1K2Y X;  4EAG A;  2NOZ A;  1KO9 A;  2HKP A;  2LAE A;  1LWW A;  4WXA A;  2VJ0 A;  3OCI A;  3DPT A;  1W80 A;  3I0X A;  2QRD A;  2D0B A;  1VKL A;  2EHB D;  1PCM X;  3OSE A;  2DKC A;  4HJH A;  4I8O A;  1KY7 A;  1NVP A;  3CVT A;  3OGD A;  1EBM A;  5IYC P;  4EJY A;  2NOI A;  3TDH A;  2OOY A;  1MP9 A;  1P5D X;  3ENO C;  1UL7 A;  4Q11 A;  4EAK A;  3OH6 A;  2V9J A;  1YTB A;  4MRQ A;  1YQR A;  1M3H A;  3PMG A;  1VOL B;  1Q9U A;  2NLV A;  2G30 A;  1JFI C;  2NOF A;  4B0A A;  5JN5 A;  2FGT A;  1TBP A;  4WX8 A;  3ASM A;  1PVS A;  2NVM A;  2HZM A;  3NA5 A;  1E42 A;  1M3Q A;  1AIS A;  1VTL E;  1PCJ X;  2NOL A;  1N39 A;  1NH2 A;  2QRE A;  3RPJ A;  3T4N A;  1KYD A;  5EPC A;  1QTS A;  1KFI A;  3SNS A;  1N3C A;  1QNC A;  1K35 A;  3UW2 A;  3CWA A;  1T6A A;  2QR1 A; 
#chains in the Genus database with same CATH homology
 2QRD A;  2EHB D;  4EAL A;  3OSE A;  2Y8L A;  4EAJ A;  2QLV A;  3TE5 A;  4EAI A;  3TDH A;  2OOY A;  1UL7 A;  4EAK A;  2ZFD B;  2V9J A;  2QRC A;  2V8Q A;  2YA3 A;  2Y8Q A;  2OOX A;  4EAG A;  2V92 A;  4CFF A;  2QRE A;  3T4N A;  1V5S A;  2QR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...