4TPSA

Sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ERHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQYEMTEKQIQYITQPIPILHMHQRLKMNLNKTDYRQLDYIYRIALPKAKGHATFMMKEHMIEIVASGDYEAETIFFEVLRKVSPCFLAMDFNSKRYGWLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Sporulation inhibitor of replication protein SirA
publication title Structure and interactions of the Bacillus subtilis sporulation inhibitor of DNA replication, SirA, with domain I of DnaA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10747 SirA Sporulation inhibitor of replication protein SirA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.250 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4tpsA00
4TPSA
chains in the Genus database with same CATH superfamily
2V8QA 2JOIA 3OCIA 3OSEA 1KO9A 5KL0A 2XHIA 1D3UA 1UT7A 1VOLB 3I3WA 4ROEB 1UT4A 1YTBA 1KFIA 1KY6A 2OOXA 2YH5A 1R4XA 1Q9UA 2NVMA 3DPTA 1HU0A 1N39A 1T6AA 1K2YX 5JMVD 2D0CA 2O3OA 3OSTA 1YQRA 3TDHA 3EAYA 1PCJX 5JN5A 1NGMA 2FKFA 2H5AX 2Y8QA 1RM1A 3RPJA 1P5GX 1VTOA 1JFIC 1TUOA 3EIKA 1KYUA 5BMPA 2Z0FA 5IYDP 3ENOC 1LWVA 1LWWA 3SNSA 2ZFDB 4TPSA 2FKMX 3HS8A 1QTSA 2D0AA 4EAIA 1VTLE 5IYCP 3PDKA 4IL8A 4RODB 1M3QA 1P5DX 4PY5A 1PCZA 1JDYA 3HS9A 5AN4A 4ROCB 2NOLA 3CVSA 3CVTA 3CWTA 1C4GA 2IV9A 2Y8LA 1LXTA 1WQAA 2Z8UA 1QN4A 1FN7A 1VOKA 4BJUA 1QN5A 2D0BA 4I8OA 1V5SA 2HL8A 1KYDA 4EAJA 3OH9A 3OLPA 1QN9A 4D7QA 1WJWA 1TBPA 3F0ZA 3UW2A 1DIZA 2NWVA 1LWYA 1QTPA 1MPGA 1NH2A 3VN5A 1PVSA 4CFFA 1QN8A 2G30A 2EHBD 3OGDA 2QREA 2NOFA 3D7QA 1TGHA 4Q11A 4C7PA 1E42A 1PCMX 1C47A 2NLVA 2OOYA 3N89A 3PMGA 3BKQX 1QN6A 1KY7A 1YQKA 4EAGA 5IYBP 3ENCA 2MJ7A 4EALA 3D4VA 1YTFA 1XSZA 2QRDA 2QLVA 5BMNA 2LAEA 2YA3A 1TBAB 5HSHA 1QN7A 2NOEA 2DKDA 2F7LA 5EPCA 1QNAA 2MZ8A 2PWWA 4DULA 4EAKA 1NVPA 2NOIA 3OSMA 2QRCA 3TE5A 3CWAA 1M5Q1 1N3CA 3CW7A 2H4LX 2R5XA 3DPUA 3I0WA 5F9CA 4EJYA 4EJZA 3CWUA 1B9KA 1CDWA 1QNEA 1C9BB 4WZSD 2DKAA 3KTUA 1EUVA 3KRMA 3ULXA 1KYFA 2HZMA 2IV8A 3OC3C 4B0AA 3IH7A 2NOZA 4D7RA 2V92A 3H1ZA 1PZDA 2JPIA 1YQLA 3NA5A 4WXAA 1UL7A 1KFQA 3CWSA 1YQMA 2FGTA 2V9JA 2FUVA 2JHJA 4HJHA 2I5WA 2VJ0A 1J3MA 1QNCA 1QNBA 3F10A 2NOHA 2HZSA 4WX8A 1W80A 3ASMA 4MRQA 3T4NA 3RSMA 2HKPA 1QN3A 2QR1A 2JHNA 1N3AA 1M3HA 1AISA 1EBMA 1MP9A 1K35A 3OH6A 1VKLA 2DKCA 2HL9A 4QG5A 2NOBA 3I0XA 3C04A
chains in the Genus database with same CATH topology
2JOIA 3OCIA 2XHIA 1KO9A 1D3UA 1UT7A 1VOLB 4ROEB 1UT4A 1YTBA 1KY6A 2YH5A 1R4XA 3DPTA 1HU0A 1N39A 2D0CA 2O3OA 3OSTA 1YQRA 1NGMA 1RM1A 3RPJA 1VTOA 1JFIC 3EIKA 1KYUA 5IYDP 1LWVA 1LWWA 3SNSA 4TPSA 3HS8A 1QTSA 2D0AA 1VTLE 5IYCP 1M3QA 4RODB 4PY5A 1PCZA 3HS9A 5AN4A 4ROCB 2NOLA 2IV9A 1QN4A 2Z8UA 1FN7A 1VOKA 1QN5A 2D0BA 4I8OA 1KYDA 1QN9A 1TBPA 3F0ZA 1LWYA 1QTPA 1NH2A 3VN5A 1QN8A 2G30A 2NOFA 1TGHA 4Q11A 1E42A 3N89A 1QN6A 1KY7A 1YQKA 5IYBP 2MJ7A 1YTFA 2LAEA 1QN7A 1TBAB 2NOEA 2NOIA 1QNAA 2MZ8A 4DULA 1NVPA 3OSMA 4EJZA 1N3CA 3DPUA 3I0WA 4EJYA 1CDWA 1B9KA 1QNEA 1C9BB 4WZSD 3KTUA 3KRMA 3ULXA 1KYFA 2HZMA 2IV8A 3OC3C 3IH7A 4B0AA 2NOZA 3H1ZA 1PZDA 1YQLA 1YQMA 2FGTA 2I5WA 2VJ0A 1QNCA 1QNBA 3F10A 2NOHA 2HZSA 1W80A 3ASMA 1QN3A 1N3AA 1M3HA 1AISA 1EBMA 1MP9A 2NOBA 3I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS A; 
#chains in the Genus database with same CATH topology
 2V8Q A;  2JOI A;  3OCI A;  3OSE A;  1KO9 A;  5KL0 A;  2XHI A;  1D3U A;  1UT7 A;  1VOL B;  3I3W A;  4ROE B;  1UT4 A;  1YTB A;  1KFI A;  1KY6 A;  2OOX A;  2YH5 A;  1R4X A;  1Q9U A;  2NVM A;  3DPT A;  1HU0 A;  1N39 A;  1T6A A;  1K2Y X;  5JMV D;  2D0C A;  2O3O A;  3OST A;  1YQR A;  3TDH A;  3EAY A;  1PCJ X;  5JN5 A;  1NGM A;  2FKF A;  2H5A X;  2Y8Q A;  1RM1 A;  3RPJ A;  1P5G X;  1VTO A;  1JFI C;  1TUO A;  3EIK A;  1KYU A;  5BMP A;  2Z0F A;  5IYD P;  3ENO C;  1LWV A;  1LWW A;  3SNS A;  2ZFD B;  4TPS A;  2FKM X;  3HS8 A;  1QTS A;  2D0A A;  4EAI A;  1VTL E;  5IYC P;  3PDK A;  4IL8 A;  4ROD B;  1M3Q A;  1P5D X;  4PY5 A;  1PCZ A;  1JDY A;  3HS9 A;  5AN4 A;  4ROC B;  2NOL A;  3CVS A;  3CVT A;  3CWT A;  1C4G A;  2IV9 A;  2Y8L A;  1LXT A;  1WQA A;  2Z8U A;  1QN4 A;  1FN7 A;  1VOK A;  4BJU A;  1QN5 A;  2D0B A;  4I8O A;  1V5S A;  2HL8 A;  1KYD A;  4EAJ A;  3OH9 A;  3OLP A;  1QN9 A;  4D7Q A;  1WJW A;  1TBP A;  3F0Z A;  3UW2 A;  1DIZ A;  2NWV A;  1LWY A;  1QTP A;  1MPG A;  1NH2 A;  3VN5 A;  1PVS A;  4CFF A;  1QN8 A;  2G30 A;  2EHB D;  3OGD A;  2QRE A;  2NOF A;  3D7Q A;  1TGH A;  4Q11 A;  4C7P A;  1E42 A;  1PCM X;  1C47 A;  2NLV A;  2OOY A;  3N89 A;  3PMG A;  3BKQ X;  1QN6 A;  1KY7 A;  1YQK A;  4EAG A;  5IYB P;  3ENC A;  2MJ7 A;  4EAL A;  3D4V A;  1YTF A;  1XSZ A;  2QRD A;  2QLV A;  5BMN A;  2LAE A;  2YA3 A;  1TBA B;  5HSH A;  1QN7 A;  2NOE A;  2DKD A;  2F7L A;  5EPC A;  1QNA A;  2MZ8 A;  2PWW A;  4DUL A;  4EAK A;  1NVP A;  2NOI A;  3OSM A;  2QRC A;  3TE5 A;  3CWA A;  1M5Q 1;  1N3C A;  3CW7 A;  2H4L X;  2R5X A;  3DPU A;  3I0W A;  5F9C A;  4EJY A;  4EJZ A;  3CWU A;  1B9K A;  1CDW A;  1QNE A;  1C9B B;  4WZS D;  2DKA A;  3KTU A;  1EUV A;  3KRM A;  3ULX A;  1KYF A;  2HZM A;  2IV8 A;  3OC3 C;  4B0A A;  3IH7 A;  2NOZ A;  4D7R A;  2V92 A;  3H1Z A;  1PZD A;  2JPI A;  1YQL A;  3NA5 A;  4WXA A;  1UL7 A;  1KFQ A;  3CWS A;  1YQM A;  2FGT A;  2V9J A;  2FUV A;  2JHJ A;  4HJH A;  2I5W A;  2VJ0 A;  1J3M A;  1QNC A;  1QNB A;  3F10 A;  2NOH A;  2HZS A;  4WX8 A;  1W80 A;  3ASM A;  4MRQ A;  3T4N A;  3RSM A;  2HKP A;  1QN3 A;  2QR1 A;  2JHN A;  1N3A A;  1M3H A;  1AIS A;  1EBM A;  1MP9 A;  1K35 A;  3OH6 A;  1VKL A;  2DKC A;  2HL9 A;  4QG5 A;  2NOB A;  3I0X A;  3C04 A; 
#chains in the Genus database with same CATH homology
 2JOI A;  3OCI A;  2XHI A;  1KO9 A;  1D3U A;  1UT7 A;  1VOL B;  4ROE B;  1UT4 A;  1YTB A;  1KY6 A;  2YH5 A;  1R4X A;  3DPT A;  1HU0 A;  1N39 A;  2D0C A;  2O3O A;  3OST A;  1YQR A;  1NGM A;  1RM1 A;  3RPJ A;  1VTO A;  1JFI C;  3EIK A;  1KYU A;  5IYD P;  1LWV A;  1LWW A;  3SNS A;  4TPS A;  3HS8 A;  1QTS A;  2D0A A;  1VTL E;  5IYC P;  1M3Q A;  4ROD B;  4PY5 A;  1PCZ A;  3HS9 A;  5AN4 A;  4ROC B;  2NOL A;  2IV9 A;  1QN4 A;  2Z8U A;  1FN7 A;  1VOK A;  1QN5 A;  2D0B A;  4I8O A;  1KYD A;  1QN9 A;  1TBP A;  3F0Z A;  1LWY A;  1QTP A;  1NH2 A;  3VN5 A;  1QN8 A;  2G30 A;  2NOF A;  1TGH A;  4Q11 A;  1E42 A;  3N89 A;  1QN6 A;  1KY7 A;  1YQK A;  5IYB P;  2MJ7 A;  1YTF A;  2LAE A;  1QN7 A;  1TBA B;  2NOE A;  2NOI A;  1QNA A;  2MZ8 A;  4DUL A;  1NVP A;  3OSM A;  4EJZ A;  1N3C A;  3DPU A;  3I0W A;  4EJY A;  1CDW A;  1B9K A;  1QNE A;  1C9B B;  4WZS D;  3KTU A;  3KRM A;  3ULX A;  1KYF A;  2HZM A;  2IV8 A;  3OC3 C;  3IH7 A;  4B0A A;  2NOZ A;  3H1Z A;  1PZD A;  1YQL A;  1YQM A;  2FGT A;  2I5W A;  2VJ0 A;  1QNC A;  1QNB A;  3F10 A;  2NOH A;  2HZS A;  1W80 A;  3ASM A;  1QN3 A;  1N3A A;  1M3H A;  1AIS A;  1EBM A;  1MP9 A;  2NOB A;  3I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...