4TPSA

Sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ERHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQYEMTEKQIQYITQPIPILHMHQRLKMNLNKTDYRQLDYIYRIALPKAKGHATFMMKEHMIEIVASGDYEAETIFFEVLRKVSPCFLAMDFNSKRYGWLNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sporulation inhibitor of replication protein SirA
publication title Structure and interactions of the Bacillus subtilis sporulation inhibitor of DNA replication, SirA, with domain I of DnaA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Replication
total genus 44
structure length 140
sequence length 140
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10747 SirA Sporulation inhibitor of replication protein SirA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.250 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4tpsA00
4TPSA
chains in the Genus database with same CATH superfamily
1B9KA 1QN5A 5BMPA 2QRCA 4TPSA 1EBMA 5HSHA 1KYFA 3EIKA 1DIZA 1K35A 5JMVD 2JHNA 4QG5A 1QNCA 5AN4A 3TE5A 2EHBD 2V9JA 3CWTA 3ENOC 3NA5A 4EAGA 5BMNA 1RM1A 2HZMA 2FKMX 3VN5A 1QNBA 1TUOA 2QLVA 3OCIA 3C04A 4EAIA 2XHIA 3PMGA 4EALA 2JOIA 2D0AA 3OC3C 2HZSA 2NOZA 1K2YX 3I0XA 1QN7A 1KY7A 2F7LA 3OH9A 4EAKA 1XSZA 1HU0A 3OSTA 3SNSA 2HKPA 2ZFDB 3T4NA 1P5DX 2DKDA 4D7QA 3IH7A 4WZSD 5IYBP 3OH6A 1KYUA 2JPIA 2NWVA 2NOBA 1N3AA 1EUVA 2IV9A 1NGMA 3CWSA 3CW7A 5IYDP 2LAEA 3ASMA 3N89A 3OSEA 2HL9A 2NOEA 1QN4A 3CVTA 4EJYA 4WXAA 3I3WA 1PVSA 1QN9A 2D0CA 4ROCB 1JDYA 4RODB 5IYCP 1YTBA 2MJ7A 1VOKA 1J3MA 1C47A 1QNAA 3OLPA 2DKCA 1C4GA 1LWVA 2I5WA 3D7QA 1KY6A 2QR1A 3RPJA 1LWWA 1UT7A 1Q9UA 4EAJA 1JFIC 1P5GX 1M3HA 1TGHA 2NOLA 4ROEB 3D4VA 4DULA 2NVMA 2NOFA 1D3UA 1MP9A 2FUVA 3F10A 2R5XA 1TBAB 1PZDA 3HS8A 2V92A 1QNEA 2H4LX 2IV8A 2O3OA 1QN6A 3DPTA 1M5Q1 1YQLA 1MPGA 4B0AA 3F0ZA 3HS9A 2JHJA 1N3CA 1KFIA 1WJWA 1VTLE 1VKLA 3CWUA 2FKFA 4PY5A 1UT4A 3EAYA 3ENCA 4MRQA 1QTSA 3RSMA 4HJHA 2NLVA 3KRMA 2Z8UA 1KO9A 1AISA 4IL8A 2Y8LA 5KL0A 2FGTA 2D0BA 4EJZA 1KYDA 1KFQA 2OOYA 3OSMA 1TBPA 1FN7A 1C9BB 1QTPA 1UL7A 2HL8A 4D7RA 5EPCA 5JN5A 1CDWA 2NOIA 4CFFA 2G30A 1WQAA 4Q11A 4BJUA 3I0WA 1VTOA 1YQMA 3CVSA 1N39A 3CWAA 1QN3A 2OOXA 4I8OA 2QRDA 1M3QA 1LXTA 4WX8A 1NH2A 3KTUA 2V8QA 2YH5A 3BKQX 3H1ZA 3UW2A 1YQRA 1QN8A 1LWYA 2PWWA 5F9CA 2YA3A 1E42A 1W80A 3ULXA 2QREA 2NOHA 1PCMX 1NVPA 1R4XA 2VJ0A 1PCZA 1T6AA 2DKAA 4C7PA 1VOLB 3OGDA 3TDHA 3DPUA 1YTFA 1PCJX 1YQKA 2H5AX 2MZ8A 1V5SA 2Z0FA 2Y8QA 3PDKA
chains in the Genus database with same CATH topology
1B9KA 1QN5A 4TPSA 1EBMA 1KYFA 3EIKA 1QNCA 5AN4A 1QNBA 1RM1A 2HZMA 3VN5A 3OCIA 2XHIA 2JOIA 2D0AA 3OC3C 2HZSA 2NOZA 3I0XA 1QN7A 1KY7A 1HU0A 3OSTA 3SNSA 3IH7A 4WZSD 5IYBP 1KYUA 2NOBA 1N3AA 2IV9A 1NGMA 5IYDP 2LAEA 3ASMA 3N89A 2NOEA 1QN4A 4EJYA 1QN9A 2D0CA 4ROCB 4RODB 5IYCP 1YTBA 2MJ7A 1VOKA 1QNAA 1LWVA 2I5WA 1KY6A 1JFIC 3RPJA 1LWWA 1UT7A 1M3HA 1TGHA 2NOLA 4ROEB 4DULA 2NOFA 1D3UA 1MP9A 3F10A 1TBAB 1PZDA 3HS8A 1QNEA 2IV8A 2O3OA 1QN6A 3DPTA 1YQLA 4B0AA 3F0ZA 3HS9A 1N3CA 1VTLE 4PY5A 1UT4A 1QTSA 3KRMA 2Z8UA 1KO9A 1AISA 2FGTA 2D0BA 4EJZA 1KYDA 3OSMA 1TBPA 1FN7A 1C9BB 1QTPA 1CDWA 2NOIA 2G30A 3I0WA 4Q11A 1N39A 1VTOA 1YQMA 1QN3A 4I8OA 1M3QA 1NH2A 3KTUA 2YH5A 3H1ZA 1YQRA 1QN8A 1LWYA 1E42A 1W80A 3ULXA 2NOHA 1NVPA 1R4XA 2VJ0A 1PCZA 1VOLB 1YTFA 3DPUA 1YQKA 2MZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TPS A; 
#chains in the Genus database with same CATH topology
 1B9K A;  1QN5 A;  5BMP A;  2QRC A;  4TPS A;  1EBM A;  5HSH A;  1KYF A;  3EIK A;  1DIZ A;  1K35 A;  5JMV D;  2JHN A;  4QG5 A;  1QNC A;  5AN4 A;  3TE5 A;  2EHB D;  2V9J A;  3CWT A;  3ENO C;  3NA5 A;  4EAG A;  5BMN A;  1RM1 A;  2HZM A;  2FKM X;  3VN5 A;  1QNB A;  1TUO A;  2QLV A;  3OCI A;  3C04 A;  4EAI A;  2XHI A;  3PMG A;  4EAL A;  2JOI A;  2D0A A;  3OC3 C;  2HZS A;  2NOZ A;  1K2Y X;  3I0X A;  1QN7 A;  1KY7 A;  2F7L A;  3OH9 A;  4EAK A;  1XSZ A;  1HU0 A;  3OST A;  3SNS A;  2HKP A;  2ZFD B;  3T4N A;  1P5D X;  2DKD A;  4D7Q A;  3IH7 A;  4WZS D;  5IYB P;  3OH6 A;  1KYU A;  2JPI A;  2NWV A;  2NOB A;  1N3A A;  1EUV A;  2IV9 A;  1NGM A;  3CWS A;  3CW7 A;  5IYD P;  2LAE A;  3ASM A;  3N89 A;  3OSE A;  2HL9 A;  2NOE A;  1QN4 A;  3CVT A;  4EJY A;  4WXA A;  3I3W A;  1PVS A;  1QN9 A;  2D0C A;  4ROC B;  1JDY A;  4ROD B;  5IYC P;  1YTB A;  2MJ7 A;  1VOK A;  1J3M A;  1C47 A;  1QNA A;  3OLP A;  2DKC A;  1C4G A;  1LWV A;  2I5W A;  3D7Q A;  1KY6 A;  2QR1 A;  3RPJ A;  1LWW A;  1UT7 A;  1Q9U A;  4EAJ A;  1JFI C;  1P5G X;  1M3H A;  1TGH A;  2NOL A;  4ROE B;  3D4V A;  4DUL A;  2NVM A;  2NOF A;  1D3U A;  1MP9 A;  2FUV A;  3F10 A;  2R5X A;  1TBA B;  1PZD A;  3HS8 A;  2V92 A;  1QNE A;  2H4L X;  2IV8 A;  2O3O A;  1QN6 A;  3DPT A;  1M5Q 1;  1YQL A;  1MPG A;  4B0A A;  3F0Z A;  3HS9 A;  2JHJ A;  1N3C A;  1KFI A;  1WJW A;  1VTL E;  1VKL A;  3CWU A;  2FKF A;  4PY5 A;  1UT4 A;  3EAY A;  3ENC A;  4MRQ A;  1QTS A;  3RSM A;  4HJH A;  2NLV A;  3KRM A;  2Z8U A;  1KO9 A;  1AIS A;  4IL8 A;  2Y8L A;  5KL0 A;  2FGT A;  2D0B A;  4EJZ A;  1KYD A;  1KFQ A;  2OOY A;  3OSM A;  1TBP A;  1FN7 A;  1C9B B;  1QTP A;  1UL7 A;  2HL8 A;  4D7R A;  5EPC A;  5JN5 A;  1CDW A;  2NOI A;  4CFF A;  2G30 A;  1WQA A;  4Q11 A;  4BJU A;  3I0W A;  1VTO A;  1YQM A;  3CVS A;  1N39 A;  3CWA A;  1QN3 A;  2OOX A;  4I8O A;  2QRD A;  1M3Q A;  1LXT A;  4WX8 A;  1NH2 A;  3KTU A;  2V8Q A;  2YH5 A;  3BKQ X;  3H1Z A;  3UW2 A;  1YQR A;  1QN8 A;  1LWY A;  2PWW A;  5F9C A;  2YA3 A;  1E42 A;  1W80 A;  3ULX A;  2QRE A;  2NOH A;  1PCM X;  1NVP A;  1R4X A;  2VJ0 A;  1PCZ A;  1T6A A;  2DKA A;  4C7P A;  1VOL B;  3OGD A;  3TDH A;  3DPU A;  1YTF A;  1PCJ X;  1YQK A;  2H5A X;  2MZ8 A;  1V5S A;  2Z0F A;  2Y8Q A;  3PDK A; 
#chains in the Genus database with same CATH homology
 1B9K A;  1QN5 A;  4TPS A;  1EBM A;  1KYF A;  3EIK A;  1QNC A;  5AN4 A;  1QNB A;  1RM1 A;  2HZM A;  3VN5 A;  3OCI A;  2XHI A;  2JOI A;  2D0A A;  3OC3 C;  2HZS A;  2NOZ A;  3I0X A;  1QN7 A;  1KY7 A;  1HU0 A;  3OST A;  3SNS A;  3IH7 A;  4WZS D;  5IYB P;  1KYU A;  2NOB A;  1N3A A;  2IV9 A;  1NGM A;  5IYD P;  2LAE A;  3ASM A;  3N89 A;  2NOE A;  1QN4 A;  4EJY A;  1QN9 A;  2D0C A;  4ROC B;  4ROD B;  5IYC P;  1YTB A;  2MJ7 A;  1VOK A;  1QNA A;  1LWV A;  2I5W A;  1KY6 A;  1JFI C;  3RPJ A;  1LWW A;  1UT7 A;  1M3H A;  1TGH A;  2NOL A;  4ROE B;  4DUL A;  2NOF A;  1D3U A;  1MP9 A;  3F10 A;  1TBA B;  1PZD A;  3HS8 A;  1QNE A;  2IV8 A;  2O3O A;  1QN6 A;  3DPT A;  1YQL A;  4B0A A;  3F0Z A;  3HS9 A;  1N3C A;  1VTL E;  4PY5 A;  1UT4 A;  1QTS A;  3KRM A;  2Z8U A;  1KO9 A;  1AIS A;  2FGT A;  2D0B A;  4EJZ A;  1KYD A;  3OSM A;  1TBP A;  1FN7 A;  1C9B B;  1QTP A;  1CDW A;  2NOI A;  2G30 A;  3I0W A;  4Q11 A;  1N39 A;  1VTO A;  1YQM A;  1QN3 A;  4I8O A;  1M3Q A;  1NH2 A;  3KTU A;  2YH5 A;  3H1Z A;  1YQR A;  1QN8 A;  1LWY A;  1E42 A;  1W80 A;  3ULX A;  2NOH A;  1NVP A;  1R4X A;  2VJ0 A;  1PCZ A;  1VOL B;  1YTF A;  3DPU A;  1YQK A;  2MZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...