3HS8A

Intersectin 1-peptide-ap2 alpha ear complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
b'FEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adaptor protein complex AP-2, alpha 2 subunit
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 58
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs8A02
2DWYA 2DWXA 1W80A 4RODB 3ASMA 1GYWA 1D3UA 1KY6A 1QN5A 4B0AA 1NA8A 1QN8A 4WZSD 1E42A 1GYUA 1RM1A 5IYBP 1TGHA 1QN7A 1R4XA 2D0CA 1MP9A 2YMTA 3MNMA 3H1ZA 1PZDA 1YTBA 1P4UA 1NVPA 1OM9A 1VTLE 1QN6A 3OC3C 4BCXA 2IV9A 3ZY7A 2E9GA 1C9BB 3HS8A 1KYDA 4PY5A 1QN3A 1JFIC 4ROEB 1NH2A 2Z8UA 5IYDP 3VN5A 1QTPA 1QNCA 1TBPA 1KY7A 1VOKA 1CDWA 1KYUA 5CN2A 1QN9A 1PCZA 3HS9A 1AISA 3OCIA 2D0BA 2G30A 3ZHFA 1QNAA 1QTSA 1IU1A 2D0AA 1TBAB 1YTFA 1QNEA 4ROCB 1VOLB 1B9KA 5CN1A 2IV8A 1KYFA 1GYVA 5IYCP 2MJ7A 2A7BA 2VJ0A 3EIKA 1VTOA 1QN4A 1QNBA 1NGMA
chains in the Genus database with same CATH superfamily
2XBTA 2HFGL 4LRNL 4WI3A 3NQKA 5HPOA 3IKCA 4EIZC 2EDXA 1XGYL 4MNGA 1JV2A 3II2A 3L48A 1NGQH 2HVKA 2AJ3A 4JHWH 1KY6A 1YY8A 5DF0A 3MOQA 1AJ7L 3RE0A 5B8CA 4NS0A 3MNWB 4P2RE 2VXSL 4ZAKD 1QBAA 3D39E 1NGYA 4NO0B 4XMTA 3PLYA 4LCYA 1PNDA 5ILTL 4GT0A 3UBXA 3QUZB 3GJEB 2FZ3A 1U9KA 5DVNA 1JPTH 4YHML 3UZEC 1YCSA 2RR3A 3SCMC 4JQVC 4RGMC 5AVVB 1CFTB 3D25B 4NWUH 4I7ZC 1MCLA 1L3NA 3RVVD 4ICWA 1AGBA 1OHQA 2DQFA 3BJLA 1KPRA 1N6VA 2VMJA 3SOBL 1H3XA 4APXA 2CHDA 3ECVA 1PDKB 2WLIA 3KXFD 4NM4H 4XNQB 4F7EB 2AJZB 5F3BA 3QUYD 3LH2L 4HIQA 5EUOB 2CBMA 2I9TA 1O7DC 5EZLB 1C9SA 2H2PC 3P9LA 2B20A 4BSWB 3DSFL 4G6JL 2OXHB 4YDZA 4LKCA 4ZS7H 3A4EA 3ZYZA 4P2RA 3VXSE 4H0GA 4NRZA 3AY2A 5IMOB 5DJ0A 4PS3A 2E4TA 1G1CA 2VLJB 4I2XE 4OFYA 2HT4D 1IKNC 2VERN 4U1HA 5B3JE 5C8JB 1DQDL 3FYEB 3KJ4C 4NBYB 5LKNA 4QY8B 3N06B 4WEBH 5GGTL 3GS0A 5B7MA 8PAZA 4X6EA 5CLXA 4LPXA 1BQHB 1B4RA 2BVQA 3MGAA 4D2NA 1ND0A 1NJ9B 5JIMA 3MOAH 5IEHB 2YAEA 3IF1A 4Z7QB 4U2YA 2CLVB 5T3XL 3VM5A 3DWTA 4UIMA 1T1ZA 4A68A 3NZHH 7CGTA 3TN0B 3ETBJ 1BQLH 4U1JB 5DS2A 4EI6B 1U33A 2FK9A 1F86A 1JWUA 2WBWB 1I9IL 5EN2B 4ZPTA 3PJLA 5DJXA 2ESVA 3KDPB 2EYTA 4LSVH 4KPHL 3B5GA 3SY6A 3CVIH 4J2QA 2BDNL 2NXYC 3KGRA 4AKPA 1SFDA 4PJDB 1TQWA 3VXSA 2DYPB 3BH8A 4M62L 3QRBA 1FRGH 2YWYA 1VFOA 4P5TB 2NUPB 2V17L 2CRMA 2DQJH 2BINA 1JZIA 3MO1A 1AXSB 1HXKA 2R51A 3OKMA 1W72A 1QNBA 3JYCA 1GTFA 3X3GL 3MBWA 4JPVH 4PWEA 1NIBA 2X0VA 1CLOL 1I8IB 2R4RL 2AV1A 4JFDE 3BH4A 4CKQA 2FHFA 5T3ZH 2AFNA 3DSNA 1WJ3A 3WEXB 3EGXB 4LCWD 2Q86B 2AQPA 3HC0A 1YC8A 2XV2A 3SYCA 1T83C 1NZRA 4TLUA 5EC1A 1HI6A 3SQOL 4AEHL 1J9QA 1QYGH 2CGRL 1LEGB 4PRBB 2UXVA 3QIBC 2JB6A 4MXQD 4QRRE 3TT1L 3U9UA 1F3JB 3JBG7 1CDUA 4N5EC 1ZS8B 4RFEB 5IQNA 1UT7A 5GISL 2FVNA 3QAZB 2P24A 3FQUB 1WAPA 3DX9B 4BKLB 5E5LA 3IN2A 2V6HA 2NNAB 1EHNA 2KL6A 3DLQR 2E6PA 4UNTA 3D4ZA 4OZIF 3A3YB 3OGCB 5EEUA 4YE0A 4GKNA 3SPJA 1KTDB 2IG2H 5CM1A 1NFKA 4JFDA 3HI1B 3NESA 1A3RH 1RZKC 3TCLA 2E7CA 1NFAA 4BXSV 3ILDA 2DQMA 3ZE2F 3OKKA 3G7TA 4ZW8A 2R1WB 3GMRA 5A6LA 1IQWL 1MFAH 1HHJA 4JCLA 3OXRB 3CN2A 1HHIA 2D7NA 3W56A 4QRRA 3ULVL 1YUHA 2AGJL 1XCTA 3CDZA 4PBDA 4NCDA 4PPTA 3OKLB 1BPVA 4PB0L 2VL5A 3DOIA 2V5MA 4NUJA 1M42A 4AXWB 3MLVL 2GEEA 4XPHL 4JAMA 1ILUA 1CI5A 4HHAA 2H8PA 1GGIH 2NOFA 4O9HH 4AH2A 3ZDZE 3UO8B 1AR1C 5EU6E 4HZLA 5DQJA 1HQRB 3L3KA 2G0LA 2F19L 3VG9C 4FZ8H 1GY1A 1QKZH 3KCPA 1J9TA 5ISZD 4I48A 4LHQB 1CR9L 3VWKB 3KPRE 2FLMA 1PKQA 1F11A 3WCYA 1S9WB 2WGNB 4OBRA 4PJEE 1QUNA 4YWGL 2KPWA 2FKMX 5IMLB 3MNVB 4GT7A 3LZFH 4WZ9A 4YHLL 4DNLA 3UTTB 1W9XA 4KKBD 1IAII 3ULUC 3BT0A 4S1DC 3MSPA 4XCEA 3LHPH 4ZUWA 3B9VA 4JW3A 5ES4B 2EH7L 5KSVB 5E8NA 4ZXBD 5DC2A 4HFUL 4JO1H 1K2DA 2FBJL 3ULVF 3I84A 1G0DA 1ETJA 3DVIA 2HKHL 3ZE0E 5K69A 2CDFA 3G5VA 3ULUH 1BJ1J 1EBAA 1LHZA 1WIPA 1R75A 2HVJA 4Q8BA 4IS6B 4EI0A 5I28A 1T6AA 2BFVL 3LPGA 3A24A 1CK0H 3NCWA 5GJTL 3FU7B 5CCKL 1UOWA 3U9PL 3DROB 4G8EA 2FTAA 1F6AB 3NFNB 2YAPA 1DVFC 1NQBA 3RDTC 5DLML 1ZT4B 4IIQA 1MY7A 2AQ3A 3KPRA 1WSST 4YH6A 2JKWA 3H0TA 2R29H 4FXGA 4PW4A 2VXQL 2R8SH 1D9KB 2ERJB 2N7BA 2OTWB 1JZEA 2R23B 1KEML 4PFEA 3IFNL 4JFSA 4QGYA 2GQHA 4E9TA 5CD5C 4LHUG 1TUPA 5F6HJ 5E99H 4KX9A 1IC5L 1QWUA 2D03H 1YEIL 5LN4A 1BD2D 1I8KB 1B4LA 4FQ2H 4N2KA 1KGYE 3CZFB 4JFFB 1LO0L 2V4LA 3HS8A 3U7WL 1AS7A 5KVGL 1IUZA 3NPSC 4YDIL 3WS3A 4BCZA 4BQ6A 1ZIAA 1T2XA 2NOYA 1BEYL 4TOYL 1NC2D 2WKGA 1IFHL 3O2DL 1MWAH 1ZWIB 4RDBA 1GOGA 4BJUA 2OMBA 3B6SB 3MA9L 3ENCA 2VERA 4HPOL 3K1KC 1JNNL 1TYEB 4IJ3C 1P2CB 3T8MA 5GXBB 3D0VB 3LOWA 4EAJA 2FJUB 4Y7OC 3QJHB 1FQ9C 3T1FA 1QWHA 4OUUB 4P9HL 2RHEA 4B3EA 2VYRE 1CXLA 3TFBA 3I0WA 2YSSA 4HKJA 2VISB 4MVBC 2GHWB 3VXME 4WFGD 3E6FB 5ICYA 3L1GA 4NIKB 1NOLA 5KVDH 1YNKL 5CS7A 2JI3A 4KNTA 4Z7UE 1BBDH 3WFBL 2NY0D 2XX1A 2QKIC 2WB7A 3V6ZB 1J86A 2G30A 3FT0A 4R0LB 5AOLA 5GGQL 3CQQA 2XU9A 4IJTA 3MKKA 2Y9RT 5IBLC 2F53D 3VRJB 4L3EB 5EDXA 3MRLA 5C0CE 2FIRT 3BP7A 4FJZA 4JR9H 4ROCB 3VXNA 1AIFA 1JPGA 3QG7L 1ETB1 5AB1A 3WTYA 1ONQB 4UQDA 2GC4C 3EDJA 2W91A 4JHZA 1QI3A 3QXTA 1X5MA 2EVJA 5K5YA 1DANT 3VM7A 3L3OB 1FGVH 1WCBB 3CLFH 3RQ3A 1BVZA 3KPSA 2YAFA 5DFTA 1N5AB 3VXMA 1PIGA 2CO3A 1MCIA 3T0ED 3VG0H 1ZKAA 1RQ5A 3QUYC 4H8WL 4I89A 3QCTH 1YEHH 2JTDA 2XRAH 4Z1PA 2J5LB 2CWRA 4H5SB 1AD0B 2ZUTA 1S9VB 5DD1H 4N68A 4M3JA 3HNSH 2IH1A 4JFED 4NN6C 4Z7NE 1U91A 5FO8A 4LK4A 1D2PA 1U8JB 2HRLA 2OMZA 3PNWB 1TMCB 4CVXA 2R69A 4JG9A 3H4HA 5GSVB 3SNSA 5F96H 5TPWL 5LGJA 2DJUA 4JDEB 5C0CA 4GRMA 1R4XA 4WTZA 1OAQH 2PCPB 2D8KA 2QSQA 4NQQA 4IK6A 4GRLD 2W59A 4F7KA 1C5BH 2NOBA 2YK1H 3BUTA 1KACB 4NKDB 4RAUB 4P2CG 2DIBA 4HH9A 1TVBA 2WBKA 2JJVA 3GO1H 4D94A 1X7TA 3EW3B 1KIUB 2LV4A 3QDMD 4EI5B 3HZ3A 2VSKB 3OC8A 5E0QA 5L0QB 2MNWA 2QQLL 1EEYA 5DUML 4JO3L 3QPXL 4B9PA 3V52H 1K6QH 3OX8A 1Q94B 3K8KA 2Q6WA 1WHPA 4LSSL 2EIZB 2WTRB 3WYRA 4OLYL 3WIIH 3ARFC 4D3CH 3H3PH 3CBKB 5D1ZA 2OMVB 1Z3RA 1JYWA 3GSXB 2CCWA 5FUZL 2GC7C 3M1OA 3QI9A 2VE6B 3RKPA 4DK6A 4PV9A 4LLUA 1UWXH 1ET7A 1Y18B 5HDLA 2CDGA 1JZDC 5I73B 5BMPA 2RALA 3V0HA 1M3QA 1QVOA 4OFQA 4OVUA 4LLVA 4OKDA 3RJQB 3Q2VA 1KBGH 5JA8B 5B38B 2JCCE 2O72A 4TVSa 1PZBA 3MUZ1 4AV5A 1YEEH 4U0RC 1X7QA 2BJML 3P0VH 1XMEB 2YPLA 1MKFA 4XCCL 1WEJL 3SKNB 1A1NA 1WZAA 3I02A 3NABH 4FI7A 4M8VA 3L7FB 4OLEA 5D2LE 3PQYB 3LS4L 1L3WA 3SJVB 1S8DA 1SJHB 5EOQL 3ETTA 3LKNA 5TQ0L 1BAFH 1QHOA 4DN3H 4EOWH 1RJYA 5F21B 1QLRA 3VFRA 4LP8A 5IJVA 2ZX9A 3GKWL 2CG9X 3C08H 4ZDHB 2ITCA 4QTIH 1KB5H 3PABB 4MXQC 1JRHH 2G9HA 3WXWL 4I8OA 3VD2A 2FIKA 2WINB 3C60B 4OJEH 5AOKA 5BS0E 3QNFA 1HZKA 1T89A 1M7IA 1I85C 2ZSVB 4ODSL 3VFOA 3K6FA 2DMKA 3FO9B 2O6FA 1DQKA 2XZAH 4KKLD 1K4CA 3P11H 1AFVL 3L3IA 1I7TB 1I4FA 4XC3H 3V4VH 2DKAA 5HYJD 5HVHB 4CBPA 2V7NB 5LO7A 3JWOC 3AMLA 3SKOB 4E68A 4I13B 4U05A 5D2LA 3L3HA 4X99B 3BAIA 3MCYA 3NAAH 3OZ9L 3QZPA 5KOMC 5CEXB 3RVXD 5I26A 4M5YL 3UAEA 1JE6A 4YEFA 1CVSC 2DAVA 4I3GA 4WWNA 3CFJB 3CSTA 5CINH 3EJZD 4XCYB 1IGFH 5MEQA 2VSCA 1TQCB 3HBGA 2XFGB 1QEXA 3KWWA 5CEYB 4MRBA 1WFMA 1ZSDB 3CSFA 4JUSA 1T0OA 1V55B 3EYUL 3GSVA 3K4AA 2QR1A 5I1EL 4HMDA 3K8LA 4YL4A 1U3HD 3UDWA 2GK0B 4AMKH 2FT8A 4PRNB 5GS1C 4IU3A 3QISA 4N4YB 5F72S 5SWSB 2EDFA 1RK0B 1TCMA 5EIIG 1OGAE 2UZXB 5SWZB 3B9KD 3G08B 5DEFA 5D4HA 4YDLC 5F1KC 1L6XA 3F7QA 3EUUA 4MFHA 3C09C 3LB6D 3KD4A 2AQRA 3AQYA 1IC7L 2PNDA 3QXDB 3E6HB 1T4WA 1G9MH 1QP1A 3KLQA 3WL9B 1E9OA 1MFDH 2OMTB 5IHHA 1O75A 2UVFA 2QQKL 4QRAA 2QREA 4YDVA 4WJG3 4X6DB 3L95B 4KKBC 1OP5K 1GKEA 1RHFA 4N28A 4ZXBC 2KLRA 4JO2H 3SODB 4FQLL 1OOWA 3CFCH 4OFKA 2PWWA 3AREA 3UZVB 5EEVA 4HT1L 2B5IB 4R97B 4M1GL 1ANUA 1F2QA 3D85B 3WKMH 1NGZA 4LEXL 3GTNA 3OF6A 1OGAA 4XBGA 1AGCB 1X5FA 1KJMA 1KLGB 5J0BA 2I24N 1IGTA 4Y2DA 3AMKA 3BEVB 2WZPA 4P5MB 5AVXB 4K4KA 3FU8A 3RUGB 5DRXA 4CFFA 1HEZA 5AFAA 3C9NA 2GK2A 1EEZA 3MFFA 5C0IA 1IAIL 3P1VA 4P2OC 5IVXB 4PJFA 3GC3A 5H37A 3S2CA 3VW3H 3ARRA 1JK9B 2PP8A 3Q1EA 2O1AA 2EDOA 4TNEA 3HG1D 5D7JA 5ANHA 1T0NA 4DGWC 1RUKL 4XWGH 4FFWD 4TUOA 3KL0A 1UD6A 1W0YT 1FAIH 5FEBA 1CFNA 2UZYB 2A83A 1JK8A 1BGXL 4U6YB 2F08A 1WV7T 2KUTA 3CZGA 3L5HA 4ZQKB 1NGMA 3L4CA 1PPIA 1UXLA 2NOZA 1BECA 3GPSA 5DUPH 1BBJB 1WICA 1UJ3C 2O30A 3GIZH 4NN5C 3VFWA 1RXLA 3FB5A 1KJ2L 3ARWA 1QFWH 2AJYL 3NTCH 4HEMA 4NGHH 5ALBH 4GQPH 1J5OH 1USQA 2VXUH 1BQ5A 4G9DA 4PJBF 1HWHB 1EAPA 1JPFB 1NEPA 1MW1A 1HWWA 1NM4A 2AF2A 5GGRY 3ZRFC 1U93B 1UXSB 2PN5A 3HI6H 2QFPA 3U1PA 2WXIA 5IROA 3VMOA 3TVMB 3DK2A 4LIQE 1KELH 4OW6A 3QJQB 4TQEH 4FP8H 2O93L 1KC5L 1IL1B 4G3YL 4NJAH 4FD0A 4U3SB 5JW5B 4QPEA 1QN6A 2DQUH 2HFFB 4XP1L 1YNTF 1CTMA 5FCUL 4I87A 5EUOE 4K8RL 5INDB 3E0GA 1GJIA 4KUZH 4TMPA 2AP2A 3Q5OA 3AU0A 2NWVA 4XOCA 2C3WA 3RP1A 2JLPA 1N67A 3QPQD 3BPOC 3MNWA 3T3PF 4GBXB 1IBBA 4NO0A 2ZICA 4XNXL 1I1RA 2JXMB 2IF7A 4I9WE 3QUZA 3GJEA 4M6MH 3PDKA 4P05A 4TPRH 5D96C 3ESPA 3VI4B 1N64L 2IH3B 4BJLA 1H8SA 3MUY1 3TO4D 1NDMB 1YA5A 4L9LC 3D25A 4N9OB 3OMNB 3R19A 1NCCL 3ZDYF 1KN4H 5BUGA 3V4UL 4L8DB 3F7LA 4KKNA 3DTUB 3T0EC 5GS3A 5AKTA 4EDXB 2FR4B 2ADFH 4JMNA 4UT9L 2FEEI 1PDKA 2ROYA 4XNQA 4P2QD 2AJZA 4F7EA 5E8PA 5EUOA 3AS1A 3F62A 3TZVC 1FHNA 2X87A 1JFQL 1QNAA 4BSWA 4XAKD 3TCTA 2OXHA 5TDNB 1K4DB 1ZLVK 2X3CA 1WZ1L 2EE0A 4OIAA 5IMOA 3ZDYB 3OH9A 3O4LB 1MZYA 4OM1L 1JXDA 3RGHA 2VLJA 4M7LT 5ABZA 1E4XH 4YNYB 4PJ8D 4QY8A 1AP2A 2WQVA 5ANMB 1FFPA 3M86A 2ZONA 5JXAL 3MLZL 3WDJA 1BQHA 3TTYA 2C4FT 3A22A 1NJ9A 3FULA 4H20L 5IEHA 3DPBB 3FU5A 4KTEL 1J9SA 4PMEA 2CLVA 2F1EA 3B1TA 2XT1B 2D3JA 1YO4A 1XCXA 1A6UH 3TN0A 2D7OA 1WS7A 4U1JA 5EU4B 4EI6A 1PCJX 3BPLC 1W0VB 5J12B 5EN2A 4B6ZA 5JW3L 3D50A 2NY3D 4JGMA 2Y25A 1EMTH 1UQSB 3FTYA 4GMSL 4PJDA 2ARWA 2MZ8A 4AUJA 3S3JA 3H2WA 4KZDH 2DYPA 4AIOA 1XH1A 3QDJB 3TBSB 4IDJL 4Y19B 5F70A 4ES8A 5CSBA 4P5TA 3RAJH 2NUPA 2BOBB 4AE0A 2VAAB 2YA3A 1JUFB 1FIGH 1AXSA 1EHAA 1E90A 4XODA 1MJ8L 5LBSH 2XTJD 2N1TE 5E08H 1FNSL 4NHUA 1OSEA 2GUOB 1I8IA 4GKSB 4ODVH 1SOKA 1JNJA 3BSGA 3WEXA 3NACL 3EGXA 2Q86A 1A02N 3ALPA 4WWID 4PD4K 3LRGA 5CAYB 5BMFH 1IARB 4NNPH 4F3FB 4MAYB 5LB1A 3KYOB 4P5KB 4Y4HB 5DFVD 1NMBL 3BLPX 3Q0HA 5ESAB 4YHPB 5C0FB 5LBGA 4C56D 2EKSB 1I1CA 3MLTB 4N3UA 4RISH 1F3JA 5FV2A 4AGMA 3QHFL 1RJCA 4YGVA 4ZW6A 1ZS8A 4RFEA 4LLDB 4C47A 4N2OA 5FYLL 3U82B 1CYXA 4V33A 1TENA 3FQUA 2FHBA 1MJUH 3DX9A 4BKLA 4KKLC 5A16B 3QHZL 3KS0H 3ZQXA 3GMLB 2MHAB 3F6IA 1A7RH 3NCEB 2WKLA 4XNZB 3GM0A 2ED8A 1II4E 3OGCA 4UB0H 3VFVB 4JX0A 1C5CH 1KTDA 3F5WB 2ENPA 3GMNB 1YEJH 3RPBA 3AXLA 3HMXA 3KPPB 4HUXB 3FO1B 2QR0B 3HI1A 3F05A 2WXJA 5T1DH 3UAFA 3IDXL 1FNLA 1TPXB 2EEFA 5DUBB 3DUSA 3WHXB 5I30L 1HAWA 2R1WA 2OPCA 4W6YB 2EDYA 2C1OB 1HYRC 3UTTE 2E56A 3OXRA 4ZD3H 4HIHB 1BP3B 4X80H 1H19A 3DRQB 4U1GB 3IWUA 3U7YL 4GINA 2XN9D 4FKKA 3L5XL 3WNOA 3NJMA 3OKLA 4AXWA 2MOGA 4Y9GA 2VXVL 1OWRM 3PAYA 4LSRH 3FK3A 4Q0XL 3DC0A 4OZFB 3B9KC 1WAAF 4CNIB 1BLIA 4G42B 3EOBA 3VI3E 4UIKL 1HQRA 3LB6C 4EQ3A 1V7ML 2VZTA 4H25B 3P69A 3F8UB 3V95A 1B4JH 3ECQA 3VWKA 1DANU 5TFSH 3UJTL 1S9WA 4HLZH 4OQTL 4KHTL 5I6LA 3V7AE 3PNRB 1XCWA 5IMLA 3V4LA 3MNVA 2V3DA 4R2GD 5K9JL 2E86A 4I18C 4I0PD 1OGSA 2XUWA 1U8QB 3UTTA 2QSCH 2MMXA 2VDML 4H8QA 1RZPA 4NC1E 2CZNA 1L9MA 5KSVA 2NY7H 4ENED 4DO4A 2B2XL 1F4HA 1KFAH 1GH7A 5HGBB 4YHIB 2ZOUA 4LCIL 2NY1B 2Y36L 2DLFL 3V0IA 1DIZA 4IS6A 1QACA 1JZ2A 4WJKB 1UC6A 3L8QA 5D71L 1MCPH 3BXNB 1MUJA 4JVWA 3FU7A 1AIZA 3RSMA 3VI3A 1M2OA 4OZGE 3DROA 5DHEA 1B0IA 3KEDA 3VXUD 1F6AA 3FTUA 3NFNA 4WCYL 3ZHNA 4ALAL 1NCNA 1P69B 1S9XB 1NGQL 1ZT4A 3CZNA 4LP4A 4ROEB 3T09A 4XNBA 4B53A 2BP3A 4S1QH 2BSED 1MCCA 2ZCLL 3QBTB 1JPSL 4J4PC 5AZUA 4D9QD 3ATBA 2V92A 2OLDA 3QUGA 4EUPG 4CDHA 5L8JB 3G9AB 2F68X 1KV7A 4EN3D 4JFHE 1D9KA 2OTWA 1RZJC 2R23A 3U0WH 4NQTA 5E2VH 1T1XB 3TDHA 4MASA 4X6FB 4UAHA 4Y4KC 3A6CL 4F7TB 1I8KA 1SUJA 2BCKB 2MNUA 3CZFA 4JFFA 3TF4A 1KTBA 1UJTA 4XPBH 1PZ3A 2F18A 5BVPH 1ZWIA 2XV6B 5DMGD 4BQ9A 3B6SA 4OZGA 3IU4L 4WI4A 5AVYB 2ZPKL 3VGGA 1EGJH 4OLWH 3C6EA 1OP3K 3EFOB 1F58H 3D51A 3HNVL 4L1TA 3D0VA 1JCKA 1ZA6B 2MQCA 3JT2A 4ZS7L 2OM5A 3QJHA 4JPIB 1H6UA 4OUUA 4JREC 1BFVL 3ME0B 4F58H 2AK4D 2VISA 1N12A 4P23B 3TPUB 3E6FA 4ZUTB 1RVFH 3J7HA 1IEAB 4P4KB 5ACZB 2FO4B 3RTQB 1OO2A 3RIAF 3ZMRA 2LTQB 3ZK0A 2CRIA 1R3IH 2YD2A 3MV9B 5TE7H 1XF2B 3WO4C 1J8HB 4OIIH 4OI7A 3KM1A 1A6ZA 3ZRCC 3N50A 4K94L 1OPOA 4R0LA 3V6ZA 4AGOA 1MF2L 4IGBB 1JYVA 3MQIA 2NR6A 3CZJA 4TS6A 4HCRA 3UEZA 3VRJA 4L3EA 2BW4A 4JPQA 3WFEL 1BQLL 5E9NA 3U46B 3DETD 3U30C 4F2MB 3B9AA 3GI9L 2B0SH 1E42A 2YFNA 2AERT 3I3BA 3US1A 1ONQA 4LSVL 3U2SB 1OB1B 2HLEB 1SXCA 3KXFE 4IOFC 5HPMB 2XKSA 3LPFA 5L9DL 4J27A 3PG2A 2L7UA 3K5SA 3L3OA 2WVSA 5JW4R 1WCBA 4YZFF 1WDAA 2AMUA 5I9QB 1CE1H 2DLEA 2NTFB 3E1ZA 1YECH 2CNZA 2VC2L 2X5PA 3KPOB 1FRGL 1N5AA 4LDLB 5C7ZA 3WUWB 1ULVA 3MBEB 3SDYH 4G8FB 2ZUUA 1BVKB 4KJPD 3FTGB 3HBZA 3ZTNH 1HCZA 3HN5A 2ZCKH 3IKKA 2NY2B 1BM3H 4H5SA 1AD0A 1S9VA 4UV7L 4L3FA 3ALWA 1F41A 3W0WB 1EUVA 2I5WA 1R3HA 4JQXA 4G8GE 3W39B 1AR2A 2ETWA 2ZWNA 3OL2A 1S7TB 1U8JA 3PNWA 5B1JC 1FO0H 1KXHA 4HK3J 5GSVA 2NY6B 4JDEA 4IKJA 4PJ8C 1I9RH 1MFBL 2PCPA 4KRLB 5AW2B 5CWSB 1IB5A 1JSYA 4Z18A 1SGKA 4DP5X 4NKDA 3W5MA 4RAUA 2VRQA 2DBLL 2ZUWA 1AVAA 1DJXA 4OM0H 1BFSA 1KIUA 3FB6B 2FEEL 5AAMA 5J1TC 4HUVB 4XB8A 4Z9KB 4PRIB 3V6OA 3OKDB 1G9EA 1Q94A 4HUMB 2XVLA 2EIZA 1V3KA 2P80A 2WTRA 5ELIA 2OMVA 4NBZB 3LN4B 4YHZL 3QWRA 1R3LB 2NY3C 3QAQA 3GSXA 1QBML 4GI8A 1XB6A 4LDOB 4UT7H 1VA9A 3I9GH 5I2IB 2VE6A 2WUCH 2XVGA 3BAYA 5BZWB 1RUML 1Y18A 4G8GA 5FO7B 3SD5A 4HOXA 1OKEA 1C16B 5T3XE 4LQ1A 4OB5L 5SWQB 4LCWE 5B38A 5ETUB 2X89D 1BQSA 4Y5YB 4G6MH 4NQUA 3TGXA 1M1XB 4J6IA 4KV5F 2XTJC 3SKNA 4X9HA 1RZKL 2Y2YA 3L7FA 4M43L 2BCMA 3G6DL 3PQYA 2X4UB 2C3VB 4GUPA 4K5PA 3SJVA 3OPUA 3OB8A 5C7XL 2WNGA 3KPQB 4LEOB 1SJHA 2D7TH 4XBEL 4K15A 4HF5H 2Y7QB 1FUNA 5D2NC 5IHBA 1G9NC 4JO4H 5I66A 2F9BT 4AGPA 1YMMB 4IBUA 2XWDA 3FSOA 3VYNA 3MJ6A 3AG2B 5DFVC 4OZIE 3CWSA 4HCGA 2QADB 1RIHH 2EP6A 4ZDHA 4GG6B 2NNCA 3PABA 5GGTA 5HDQH 1T20B 2WINA 2Y1VA 3C60A 3QDAA 1G9NH 4KK6C 4AQ1C 4BZ2H 3DIDA 2UX6A 1J0YA 2ZSVA 2N0KA 3LX9A 3BEWA 5MEND 2XYBA 3FO9A 4XXDA 1B3IA 4BA8A 3HG3A 1INDL 4OKVB 1I7TA 1P4UA 4N2CA 3PE9A 4PR5B 4QUOA 4Y5XB 1VTLE 2V7NA 1RIVL 3LHPL 2K4AA 3GSNH 3FUKA 3SKOA 2AK1H 3SDCB 4X99A 5FWQA 2JI1A 4JO1L 3BMVA 2I5YH 2V37A 1QSZA 5I24A 1A64A 2JLLA 4OD2B 3CFJA 3BD4A 5GGVH 1URZA 2YD6A 1IIIA 4XCYA 3RL2B 4PJXB 2ZOKB 1H9DA 2BVEA 2HZSA 5K93A 5A2CA 2Z31D 3GXMA 2RB8A 3MFGB 5CEYA 2CJTA 1AYRA 4HCFA 3SDAB 4IBVA 1ZSDA 4U6VH 3LHAA 3SDDB 5H4ZA 3BPNB 4Y16D 5AW4B 2XN0A 1DBBL 1WQAA 4L0PB 2OL3L 2GK0A 4PRNA 2PXYC 3LJ3A 3UC2A 2QVKA 3VQMA 5SWSA 3CAFA 1WGVA 4XHJC 1RK0A 4K3EH 2UZXA 5SWZA 3C75A 5EZIL 3G08A 5HHVL 1EIBA 4BE5A 2CHWA 1HTYA 1L0YA 5DS8B 1DVQA 3VXPB 1MREL 2D03L 1CDYA 2BIMA 2HPTA 4ZT1A 4EDWH 5GZOD 4YN3A 3ULVE 4E9WA 5IJVB 3QXDA 1QFHA 3E6HA 4AZ8B 1YQMA 3NYKA 3H9SE 5FM8A 2FWOB 3WL9A 5BOJA 2OMTA 1GXEA 2OP4H 2VDNH 3QQ9D 5IVXE 5D55A 4I1PA 3Q2LA 1IBHA 4OF8A 2GABA 4HUNB 4X6DA 3L95A 2ZAHA 4U0QB 4H2AA 5CUSL 3U36A 2W81C 5D72H 5HI5D 2CGYA 3QORC 3V0EA 2CQVA 1L6ZA 2OJEB 3MJGX 3X13B 4W9KC 3T1WA 1BZDA 1UASA 2BP5M 2ZX6A 4PRDB 3UZVA 4BWTA 2XZQL 4LBEB 3FT2B 4FDWA 2G60L 4MHHG 3D85A 3IS0X 5EBGA 1X5AA 1N7MH 1YYCA 2KDGA 3WIHL 4GXVH 1AGCA 2NXZD 1KLGA 3MX0B 1L6PA 5J8OA 5BRQA 2E9IA 3BEVA 4P5MA 3KBEA 4JKPL 4LSQL 1VEPA 3RUGA 3NCCB 2WO4A 5DJ8B 5F0MB 1OB0A 3ZL4H 1Q0YH 1OF0A 2C4FU 1N0XH 5DHYB 2JHNA 1JD7A 3MCLL 4KY1H 1BD2E 4MCZB 3MOBL 5FDYA 5EN3A 1KENL 4DN4H 1CXHA 3LZRA 5IVXA 1JK9A 3RWCB 3UBFA 2HRPL 3DYOA 1KCUL 4YXLH 3RURA 4PSPA 4FULA 1EBMA 1KIRB 1K8DB 2IFFH 2UZYA 1HZLA 1CO1A 1RUAH 3ABMB 4U6YA 3UERA 4E9YA 4N20A 4ZQKA 3EDEA 3N43F 1BBJA 3CLFL 1W6LA 4HJEA 1IZJA 3HB3D 4OTXL 3IN0A 1FE8L 2XFXB 4MX7B 2XHIA 4D0BA 1PCXA 3D5OF 4N2IA 1NTDA 6FABH 1SOQA 4E36A 5HGHB 1KDIA 4AGNA 2VLKD 1GYCA 1AYOA 3PGCA 5GRYA 5LJYH 2HX8A 4NX0A 4WFGE 4BGDA 2XRAL 1JPFA 2VDMB 1NGWB 1PX3A 3GBNL 3GLAA 1JJUA 3KYAA 3KH4A 3NN8B 4I1RA 4OAWB 4N0UE 1NH2A 1U93A 1UXSA 2Y5TB 3N3EA 4QNPF 1C8PA 3TVMA 2DQHL 2HN7B 2N0MA 1JGVH 3QEGL 1IL1A 4YVUA 4JFVA 1RZ7H 2I25N 4A67A 4U3SA 5JW5A 5KVGE 2HFFA 3QZMA 2OMYB 2F53E 2YBRB 1Z3GL 1A8ZA 1LO4H 2VDLL 2WQSA 4B9IA 1C5BL 5INDA 4OV6F 3MLYH 1RERA 3TV8A 1ETZA 2DJ4A 2JB5L 5KANG 1ZTMA 1XH0A 2BIPA 3IRZA 3P3YA 3NIFB 1TZHB 4JL1A 1G7HB 2A74B 5T5FH 1G7MB 1U2YA 4GBXA 3IAGC 5AKRA 1VGEH 5D1QB 5C6TH 5HBBA 2JXMA 3DETC 3DMMC 5GGRB 3TH3T 2RA1A 4GIOA 1EO5A 2J20A 1R17A 2VXQA 5LG6A 5JUEH 3VI4A 4D7BA 3H3PL 4JFXB 4RMRA 1KTLB 3QJOA 2IH3A 1BEXA 1CC3A 3M6DA 1MRCL 4U1KB 2AW2A 1NDMA 2FBRA 2VW7A 2C3HA 5KSAD 3VGAC 2HX9A 1GYVA 1RULH 4A2FA 1UOVA 1PZSA 1ET5A 3SDXB 3PAZA 5JHLH 35C8L 4JFEE 1KBGL 2HTLD 4IRSC 4JKLA 5A2JH 4EDXA 2FR4A 3SCMB 4K7PX 4KJPC 1BV8A 2OFQA 4R9HA 4RGMB 3BRFA 3O2DA 3VCLB 4ANKA 3R0MA 2W94A 4KK9D 1CDBA 1FBIH 5MP6H 5F7EL 5TDNA 1K4DA 1QEWB 2J6EL 4EAGA 4ZI8A 1DVXA 3ROOB 3IT8D 3I74A 3O4LA 4YQXH 1BAFL 4O02H 3QDME 4WGWB 4H8HA 4WK4B 3OSTA 2OX5B 4DP6X 3IDYC 1G7LB 1GIGL 3FUJA 4YNYA 2XJKA 4XMLH 5JHDB 1I75A 5ANMA 3Q13A 3SGJC 1H6FA 5H94B 3B3BA 4W4OA 5I6XC 5B21A 4XXCA 1UEMA 2CHZA 3MHZA 3C5ZC 3DPBA 5E6UB 2DS4A 1X5YA 2LGNA 2VKWA 4J3UA 3KJ4B 3LNGA 2XZAL 3QB7C 4ANXA 3WKYA 5EU4A 5AW7B 3ZY7A 7TAAA 4XOEA 2B1HL 2PP9A 1W0VA 2VTFA 2J8HA 4QO1B 1NUDA 3EBIA 3QEQB 4IBSA 2BSBA 1OP9A 1IT9L 1UQSA 2DTML 2XQYG 3MXWH 3RDJA 2YRLA 5T1MB 4ODUB 3JZ7A 5J13C 2HRGA 3FRPG 3QDJA 3TBSA 3MJ7B 4OCLC 4QT5B 1WUZA 4Y19A 3LSOB 5HYQB 3QRFM 5HP5A 3JWOL 2GIMA 4J3OD 2VC2B 2X6BA 1PY0A 2WBJC 2BOBA 2RCSH 3E8VA 4QCIB 2VH5H 4AYMC 5AVRB 1JUFA 1TJHH 3QRGL 2N59A 3UMNA 2H26B 2GJ6D 2NXYB 5E6YA 3D06A 4ADJA 5HDBB 2GUOA 4P2AA 1MIMH 2FX9H 4UAOC 4GKSA 1NCHA 1F4XL 4RRPG 4WFFD 2VUKA 4WUUB 3QIWD 4UOW1 5LCVH 1HQ4B 3EBHA 4X7CC 3LEVL 1AMXA 5CLTA 1JNLH 4B41A 4F3FA 2CK0L 3KYOA 4P5KA 4Y4HA 1IO4C 1A7OL 5ESAA 4Q6IB 1QASA 4YHPA 2ZUYA 5C0FA 2EKSA 2ZYRA 3MLTA 2E0PA 2EIBA 3MA7B 3PUUA 3Q7JA 1F1GA 3NRFA 3LEYH 5E8OB 1MLCB 4LLDA 5BPPA 5KS9B 1TJMA 3KW8A 2XZCL 4KRNA 2VLRB 1NKGA 3FONB 4QRPB 4HK3N 5A16A 3UAJA 2AJUH 3N0AA 5EO9B 4HZ1A 3GMLA 1Z32X 1L9OA 3F83A 4MRCA 1PX8A 3DHPA 5KBPA 5I16B 2ZKHH 2MHAA 3QIBB 4MVBD 2CKBL 4CILA 4YDNA 3QULB 4UTBH 4BH7B 3TE5A 1WK0A 3NJVA 1DJGA 1BAGA 1OT4A 2W0FB 3F5WA 1LO2L 3LNDA 3CFCL 3GMNA 3QZOA 3V10A 3CVBA 3B2UD 2V5SA 3KPPA 2EEBA 1M7UA 4RODB 3FO1A 2QR0A 1XX9C 3POHA 3OB0K 3L08A 4LCVA 3L54A 5CMAB 4J6RL 5DVOA 3UTPE 5DUBA 2V9UA 2EVFA 2YUVA 2FYYB 3WHXA 1YYLH 2Z31C 2C1OA 2BY1A 4U1IB 4F1ZA 2IGTA 4F8QA 4C4BA 4HIHA 2NYKA 1J0HA 1NANH 1O7SA 3DRQA 2ISDA 5K9KB 1P7QD 2PP7A 4QXUH 2GG1A 3OLGA 3DI3B 4PBXA 5AL0A 1OE1A 4EZLA 2NLVA 2QTVA 4MQSB 4OZFA 4L8BB 4W9EC 1VESA 4CNIA 3ZIMA 1R3JB 4G42A 4NXKA 4JB9L 2C3GA 4JY6B 3TJHC 4JANB 5FUCC 4X9FA 3GXPA 3QUXD 1BWWA 5CJQL 4MDJB 4H25A 3UP1A 2V7HA 1RLWA 4OCWH 4CC4A 5DUPL 3P9WB 2A4EA 2LABA 2ZWSA 2CALA 2WMPB 4UYPA 1OM3H 1OPGL 3QQ9C 4OGYL 3Q3GA 4CGUB 3VXOB 5JNYB 1TYRA 3KYKH 1AR1B 2YPVL 2Q8BL 3CH8A 5L6YH 5E7BA 4PD4J 4S1SL 4WNJA 4E0RB 1ZHBA 1ADQL 1U8QA 3L9RB 4J28A 1QSFE 3UO1L 3VG9B 5AW5B 1UFGA 4YS4A 4HIXL 3STZB 3O11B 5G4NA 1U8OB 1D5RA 2C7UB 2O4EA 4M8QB 1FGNH 3D33A 3FOMA 4YHKH 5LHDA 3HNTH 5LWYL 1WA2X 2HKFH 5HGBA 5IJDC 5CJOL 1BZ7B 1CDCA 4YHIA 4YLQT 2M2DA 3ZHKA 5I0XA 4MBRA 4DKEH 2RGSA 3AT8A 3WNMA 3BXNA 1ZVYA 3CDCA 5L8LB 1OHZA 3EHBD 4MQTB 3RBSA 4YSAA 3MV7B 3I3WA 1WBZB 5I8KH 2YAHA 1KDJA 2GBUA 2WYHA 3OJMB 4X5WB 3CZSA 3CC5B 2H1PH 4J39A 4BFBD 4DP2X 4GUOA 5FC9A 1BX2B 5EIIB 3WFCH 5JO5B 2OL3B 4K7PH 1SDAB 4EZKA 1IEBA 4J3XA 3HJ0A 4JFYB 4HISA 5AG8A 2ZYHA 1DVFB 4PJBE 3W11D 3RDTB 5T1KB 1A4CA 4L37B 2VDQL 1PQZA 4PS7A 4X6FA 4G9FE 3ZN6A 4K71C 4TUJB 5DEJA 2VDKH 4F7TA 1MHPH 1ZY9A 2OW6A 3P4MB 3MNZB 4IMKA 1OCCB 2DQDH 5DD6B 1EZVX 5F44A 4CA4A 4X6CB 1JGIA 1KBPA 4FTVD 4YBQD 5DEGB 1KG0B 1UH4A 3FUFA 2WANA 4Q9RL 2VN4A 1OK8A 4KXZI 4N0FB 5LNEA 4JN1H 5E9DB 3EFOA 4GSDH 2LW3A 5IOPB 5KSBF 2J88H 4MD5B 4AI7A 4ZMAT 4FERA 4TSCH 2YEZB 4LL1A 5AOJA 3NPSB 5I1HH 3T3PE 3V4PL 4ADGA 3ME0A 1RLBA 3CWGA 4KGLA 1A4KB 2FEDC 4X4YB 1WFIA 2EHBD 3WS6A 3H1ZA 4P23A 3OPZL 5GHWH 3FT3B 4ZUTA 5DK0B 3DARA 3TPUA 1IEAA 2EXWD 4P4KA 2FO4A 3RTQA 5ACZA 4IJ3B 5SV3A 4EAEA 1N6QL 3VB8A 1HKLL 3MV9A 2GITB 1J8HA 2GBTA 2L7EA 5IW1A 4EJZA 3ZDYE 3DXAB 2B1AH 2LHAA 5IREA 2MOVA 4GIPD 4IGBA 2Z0FA 4DGVH 3RZCD 5LDSA 4P3DA 4IOSA 4O58L 4HQQL 3VRLF 3DUUB 1AO7D 5PAZA 3TA3D 5DHMC 3U46A 2VITB 4F9PC 3ZKNC 5F9AC 3U2SA 2QKIB 1OB1A 2KI6A 3CFEB 5KSAC 5HPMA 3IXAB 4D9RD 5TDOB 3G04B 4XPAL 1E4JA 4YK4C 1CFBA 1TCRB 4N24A 1NCIA 3VD0A 4DWHA 2NTFA 2HTLC 3FKUS 3KPOA 1KJ2A 1IIKA 4Q74A 2ZX5A 3RHWF 3WUWA 3MBEA 4JRLA 4S0TD 4G8FA 4GQQA 4JPWH 2F7PA 3FQXA 3NA9L 5JXEA 1BVKA 4PIRF 3WFDH 1SBBA 3BLKA 3FTGA 2CA3A 3WEOA 1JXFA 4KK9C 2QGDA 4NOBA 4MJ4A 5MEOB 2VDPL 1ZSHA 2IWEA 4PCKA 5C97A 3U4BH 3W39A 4W93A 3ZHFA 5F7YC 4R7VA 4ZUUB 3T2LA 5L2KE 3UPRB 1S7TA 1LWYA 3FC8A 3W3BA 2XQYK 4KVNH 1Z9OA 3TIDB 3S48A 4Z7VB 4QJ4B 4NJ9H 4NNPL 5CWSA 2AJVL 4LEBA 4QHLB 3VH8G 2VDLB 2F58H 1WZMA 2G4GA 4NN6B 1UD3A 2WQXA 4A66A 1IM9D 1FCGA 4A04A 4XP5H 5HYSB 2VDOH 3FB6A 3P3RA 1MAMH 4HUVA 4PRIA 3OKDA 1MJUL 1F4WL 1IEHA 4BZ1H 1YLBB 4QKTA 3UG3A 4XO4A 2YN3A 5K1NA 5B3SB 1U6AL 4F24A 5M7QA 2B9BA 3LN4A 2P52A 4ZTEA 1LLAA 2OW7A 2OZ4L 2PWFA 3S35L 2PR4L 5ADOH 5I2IA 4LE8A 3RY6C 1NINA 1BLNA 5BZWA 2H0FA 5FO7A 5L2KA 3KVPA 3OAUH 1CD8A 3GZKA 1E9PB 1KGCD 5KBLA 5SWQA 2JQMA 5AYUH 3ARFB 4J3OC 5FUOH 5ETUA 5CO1A 4Y5YA 5I8EB 2WWNA 3RIFK 5CILL 3BQVA 1JD9A 4OLXH 3RU8L 3B37A 2YOAA 3DO4A 1QN7A 1M1XA 4YUEH 1B0RB 15C8L 2HL8A 2R0KH 4UT9A 4WI2A 1JAEA 3NEXA 4HIPA 3CXDL 2X4UA 2C3VA 3GXIA 4YBLB 4J3OH 4DCQB 1M6OB 1PEWA 3KPQA 4LEOA 4Q56A 1KB3A 3BYTA 5LUMA 2Y7QA 3WMSA 3AABA 3DGDA 4U0RB 2DI9A 2EDRA 1TZ8A 5DZAA 1JPEA 3BVNB 4LFHG 4ELMB 3S34L 1MCHA 1KTKE 3ABGA 2EVIA 1DJYA 1D5IL 4PY5A 4GG6A 4XVSH 3CHPA 4OJCA 3PAVA 4AVIA 2DRUA 2ITEA 3QO0B 3AXIA 3GHBH 1T20A 1NCBH 4ORGA 5IBUG 1V54B 4RSVA 5CSZB 4HV8B 1T0MB 1Q1PA 3DBXB 2XA8L 4NUPA 5L7XH 3WHE0 1XBDA 2ZX7A 3ZRSA 4NNYB 2YJLA 3CW7A 4OKVA 4NXSA 5KVFL 2JPIA 4Y5XA 4PR5A 2X2YA 1DJIA 1WISA 4IBZA 4PJ7F 2QSCL 5GGUB 2AQ1A 5D7IB 2NOHA 1IKOP 1KYOK 2DL9A 3SDCA 3FFCE 1FV1B 5LQBH 3B2UC 4YDKH 2GKIA 1B0GB 4GB9A 2XN9E 2F15A 4OD2A 4TQIA 2OXGA 6PAZA 2OOYA 5FYLE 1IQDB 3NCFB 5B3NA 5FFGA 3RL2A 4PJXA 1R47A 2ZOKA 1WAAE 3MUGB 1KJ3H 4HMCA 1KEGH 2PCFB 3C2AH 2UXFA 1KJVB 1V8HA 1J1XH 1HEHC 2ZCZA 3GJFK 3ZL1A 5IUSA 3SDDA 5LXGL 3RI5F 3NIDF 3CSYB 4Z7OF 4Q52A 3MMEB 4MCYB 2DICA 3UTQB 3S6CA 4X5PA 1OLLA 1AQHA 1JTOA 4X7SL 1KN2L 1SXSA 4XMKH 4GSRA 3U0WL 2Q3AA 3X17A 4PGZA 1GGBL 3MDJA 1RIUH 3HAEA 1SY6L 1EVTC 1RU9H 3HKZA 1RFDL 5IQMA 2IAMD 5DS8A 1LE9B 3QUXC 4R4BB 3KWVA 3VXPA 3FFCA 3X3FL 4HKBB 3GUTA 2RQ8A 4KQ3L 4XZ4A 4L4VE 2FGZA 5GS1B 3QEUB 3FZUC 4KNUA 3WI9A 1OVZA 3N42B 4UM8B 1RZJL 4AZ8A 4AKQA 2DKUA 2FWOA 2QGEA 1I9JH 5E1AB 3QPKA 4NO3B 2XX0A 4XPBL 4PEEA 4E9SA 1OP4A 1WAAA 2QHRL 2ZT9C 2VZSA 4M7KH 4R90L 1OSYA 4WHTB 2Y24A 1FNGB 2NLJB 3C09B 3RNKB 3UTSD 2NOEA 2KQMA 3VFPB 3NJNA 3ORJA 1U95B 2DMHA 5EA0L 2ZXAA 5KVEH 2CKBB 2C3XA 2X2UA 4HP5A 1MH5B 4OJFH 2O3OA 2OJEA 3X13A 2DQIL 4PRDA 1EAQA 3WLBB 4LBEA 3U83A 3FT2A 5L4JA 4GKLA 1IGIL 4KK8C 5AQ0A 4D9QE 3VFGH 3EHBC 3MX0A 4ODWB 3GLDA 5JOFB 4ZXBB 5FX3A 5EF1A 3CFDA 2VJXA 2XSKA 5D1XD 2VCOA 3CVCA 3JV4B 5TE7L 1AHMA 2VN3A 3SD2A 5DJ8A 1X4ZA 1UWEL 3MLUL 4Y9CA 5E5MB 2VR9A 5DHYA 4RMSA 2DQEH 4MCZA 4TXVB 3WG7B 2R9HD 4FXKB 7FABH 4PJ5E 3RWCA 1Z5LB 1GR7A 3I2CH 3IU3B 4BD4A 5DHXB 4EPSA 5BUAA 1DLFH 1QPXA 1A3ZA 2E9BA 3HHMA 3UBHA 3W11C 2B0SL 4BK8A 1KIRA 3GRGA 1K8DA 2ICEC 2MCPH 4HUCA 4P2OB 1I3GL 1QUPA 4MXVF 5DWUL 1ZLDA 4KFMA 4YBQC 1LP9F 1CE1L 3T2QA 1E4HA 2V33A 1YECL 4MX7A 2CO1A 4ZO9A 4H8VA 3H42H 3HE6C 4KNSA 1KGWA 4MA7L 2JJSC 5HGHA 1PGRB 2AK4E 1OCWL 3C6SB 4KJWD 4FL4C 1T7VA 3Q2NA 4DW2H 3VFSB 1EZUA 2BWQA 4GRWH 4UTAL 1UJ3B 4NN5B 4OAWA 4EJYA 4U6HA 2Y5TA 1YDPB 1CXFA 3HG5A 1NC2B 4RFNC 4IHBA 1TR7A 2HN7A 4NQVB 4OU3A 4AOFA 4LKXB 1BQUA 2M1KA 3S5YA 5IMKB 4LAJH 4JG5A 1I9RL 2E4FA 2OMYA 2YBRA 3WTWA 1IV8A 4NKIL 5E4AA 4J8RA 4MDRA 1V10A 3N85H 4UBDC 3LPWA 1ROWA 1VACB 4XNYL 5KSBB 3LQMA 4HK0B 3DTXB 4QOKE 5JPNC 4EUPB 3IFPB 4YZFE 2X4PB 3KLAB 2J25A 4F9LC 3TFKD 1TZHA 2DF3A 1UZ8B 1G7HA 2A74A 4ZQTA 1G7MA 5EORH 5GGRA 1SHWA 1D7FA 3O6ML 2R0LL 4UDTB 4CADA 3WNIA 4JFXA 1ASPA 1G5AA 1KTLA 4XRCB 5J06A 4JO5A 4FQXD 4XE5B 4U1KA 1DQQB 3I9GL 2VDQB 1J5DA 3BPOB 2OSLB 3P9MA 2DM2A 4LGSB 2XCMC 3BCFA 1KCWA 3SDXA 3IXTA 1S7SB 5FLVA 3W2DH 4PCSA 1YN6B 3KLHC 3UZEA 2RBLA 4FYRA 4QWWD 3SCMA 2W65B 4B50A 1FZKB 5CCHE 2QQQA 3BD3A 4L9LB 3VCLA 1MRFL 1UATA 5IQLA 2R1YA 2E9GA 5INCA 4CC1A 4NQEE 5KJ7E 3JVGC 1QEWA 3SBWC 1QHPA 4AYBA 4FABH 5HY9B 4M93C 3ROOA 2Z3FA 4QXGH 2X7LB 3IMWA 4LPVA 3SYPA 2D7QA 5HHMB 2JKNA 3EH2A 1EFQA 4Q9BA 2PCXA 3V4PB 1KXQA 2EADA 4NZRH 4J3OG 4JO4L 5IQ7L 3K6SB 2OX5A 2I60L 3ISYA 3PJNA 1G7LA 2YOCA 2LU4A 3TZVB 1WFTA 4QJ5B 4W9LC 1YHPA 5JHDA 3X11B 4PY7B 5H94A 3RLSA 2V8LA 4ZMYA 2O6DA 2DMGA 5ENWB 2AEPH 3PWJB 1G9NL 2R7EB 4G70B 1VHPA 1ROCA 2Y7NA 4WUUE 4KQ0A 5AD0A 1IKNA 2X12A 3C04A 1IM3B 3C6LD 2V9JA 4HUWB 4DPAX 3WFZA 4KMLB 3UYOD 2IPTH 2NRDA 2MH4A 4KV5E 5DZNA 2OI9C 3UGEA 1BZOA 4QO1A 5JQ6H 4H4NA 2AK1L 3EBGA 3QEQA 4M5ZL 3KG5A 1G84A 4NQEA 2CLRB 2XPGA 1UUNA 5ID0B 4KRMB 5T1MA 4ODUA 3QDHA 5ICUA 2VLRE 3MJ7A 4QT5A 2NW3B 3LSOA 3BPLB 2Y5QA 3UGXA 5HYQA 3OVUB 4N2LA 1D5BB 3D52A 4XO8A 5EOTB 1B9KA 4QCIA 4RFOL 3N1QC 4RX4A 5J3HD 2CE6A 2FT7A 2Y6SC 3O6FD 4FJ6A 3PDOB 4KOBA 1TEYA 4RMUA 3ZDXF 4FJYA 1LDSA 4GKZB 4ZS6C 1S7VB 3T0AA 3VGEA 1HILB 4WUUA 4CSZA 3O2WH 1LEIB 4R3SB 2YA0A 1HQ4A 3VFMB 2WVUA 3TASA 1OLZA 2DMBA 3ZSTA 5MENE 2XBZA 2B7DT 1NAML 3CLEL 4FLQA 1EHLH 4I3SH 1U41A 4TL4A 4Q6IA 1J0ZA 1C7TA 1SVBA 1WPCA 5DO2D 5JW4N 2WSKA 3GNMH 3I6KB 3MA7A 5HGAB 1RPQA 4PJ9C 5E8OA 4U6XB 5KS9A 1T83A 4DPCX 1MJ7L 2VLRA 2VDNL 3FONA 4QRPA 3W1ZA 1MOEA 1QO3B 12E8H 5DFWH 5CU5A 2P28B 3NSXA 3HC2A 4OGQC 5EMYA 5I16A 3QIBA 4MNQD 4GSUA 2G5RA 2FD6L 2DI7A 5IBTH 4BH7A 4UQBA 3IMBA 2HT2D 4TSAH 2EE6A 3GHEL 3QYCA 1D7DA 1EVUA 3H2QA 2W0FA 1J5HA 2KS0A 2VO8A 3IGUA 4CMHC 3D9AL 1QFUL 1AZVA 3WY1A 2KZWA 1RUQH 1GGYA 1ZEAH 1XL4A 4NZTH 3IJHB 5HYJB 2J57A 3THML 2X4RB 2FYYA 4MZ2A 3ZZSA 4CAGA 2AJSH 3ZKQD 4R4FL 3DGCR 4U1IA 1G9HA 4Z0BH 5I5IA 4RGNC 2EYSA 3T0XA 5IHUH 2EDBA 4EKXA 1XVSA 2K70A 5G4MA 5K9KA 2X6CA 4NAJA 3VQLA 2Z91B 3ATDA 3GRWL 1ID5I 4L1LA 4WI5A 1X5KA 3MRRB 1F2XK 1JHTB 3HUJF 4AIZB 1CGSH 3HPLB 4AJ0A 1HDMA 1JCVA 4DERA 1TMQA 2TSAA 3S4SG 3MACH 5GS2D 2ZXWB 4L8BA 3FCSB 1IBZA 4HHGA 1R3JA 2IADB 3GMQB 3CV5A 4PRHD 4JANA 5HDOA 1RL1A 4MDJA 1DL7H 1F4YH 3RY5A 4JDTL 3NIDB 1PMYA 2EVHA 1TTCA 2WMPA 3B2VH 5SX4I 3UADA 2NYYC 2FGWH 4EXPX 3B9KB 3VXOA 5DMYA 5JNYA 2JFCA 2H1XA 5A43C 4WAFA 1DR9A 2VM4A 1LJMA 4E0RA 2V3FA 3L9RA 4KTDL 1HYSD 1L0XA 2FQEA 3STZA 3O11A 8FABA 1U8OA 5DXWA 2C7UA 3FTWA 3IMSA 4M8QA 4TPSA 2DLTA 3UMTA 1N5YL 3NUKA 4K7PY 2EIDA 2YKLL 5BZZA 1BZ7A 3RWIB 4X6CE 1KOAA 2HZMA 4Z8FH 1IAIM 4GW4B 4I18B 4YR6B 3TJPA 2Q1EA 3EIKA 3ESMA 1N59B 2EDQA 3EFDH 2NDGA 1T3FA 5EU7E 1FH5H 5CEZD 4JLRB 4QHNB 1X9RA 2FSDA 1CDHA 5D1XC 4X8XA 3KHQA 1XD1A 1XWVA 3MV7A 1NBQA 1TQVA 4NQDB 5CIPH 4E9RA 2FE0A 1HHGB 3WJJC 4X5WA 3FU9A 4N2AA 5C07B 3CC5A 3GSOB 1J1PL 1MXGA 3L6FB 5EIIA 5D7SL 2P8LB 3NEOA 2BHFA 2E6JA 5JO5A 5C6TL 2OL3A 4W9DC 2XIDA 1LWWA 1X7SA 4KKCC 4BHUA 3DHUA 4JFYA 1UADC 1V5SA 1DVFA 5JUEL 2K3HA 2XNAB 5DMKB 4L37A 1I8AA 3TBVB 2BRQA 4LAQH 3OSEA 2PF6A 3ZTCC 4TSBH 3BUQA 4TUJA 4QNPE 3P4MA 4YSQA 4I4WB 1JGLH 3DXAE 3MNZA 1ZIBA 1RULL 5DD6A 4Z78A 1PZ2A 3NG5A 5EPMB 4X6CA 3HG1B 1MG3C 5DEGA 3MV11 5JZ7D 1KG0A 1WCQA 4YZWA 1C9BB 4DSYA 1QRKA 3QFJB 5F7BA 1NFDB 4N0FA 4Y4FC 4Y4KB 3BVXA 3HOGA 2P7TB 5IOPA 4XCFL 4UM9D 2IVFC 3G6JB 3OD3A 4MD5A 4ABUA 1PCSA 1TU2B 2YEZA 4LOUD 3GUFA 1MQKH 1NICA 2VLMD 1MWOA 4TVPD 3S36X 4A38A 4ERSL 4WK0B 4O02L 2IDCA 4AK2A 3MV8D 4X4YA 1A4KA 4LHJB 2PPAA 3RBGA 3T4AB 1HE8A 4IMLB 1B6DA 4KVCL 3FT3A 5CNHA 1B4TA 5DK0A 5TQ2H 3OMAB 3ZL2A 5IT2L 2FEJA 3HN8A 1M53A 3WIHA 3DK0A 4YLBA 1OQXA 4HAFA 3FUEA 4F1SA 3K1DA 4FQQB 1MFCH 4POZD 4JREB 5D1ZI 3DXAA 3TFKC 4GUCA 3TX4A 25C8L 3R06B 3EJUA 4HKZB 3TNNB 4BWWA 3GZQA 3Q8EA 4WY7H 2OJ1A 3DUUA 1G0YR 3DVNB 1S5IL 3BI9X 3VQ2C 3M8OL 4Z3IA 3E80A 1PVHA 2VITA 1RMFH 2E59A 3B4NA 5FYKL 3T3MF 3WENA 2ZKWA 1RPUA 4JFPB 1ZRUA 1XZWA 3CFEA 3FNKA 1WWBX 2P8MB 5TDOA 3G04A 1A3LL 4HU8A 4KK5D 1TCRA 3FXIC 1AH1A 2Y2TA 1A6VH 3PU7A 1HXMB 3BAEH 3U30B 5CCGE 2XWTB 1UM5H 4BUGA 3EXJA 3FQ4A 3WTSA 5I6KA 4XNUH 1UWGH 4NLHA 4NZJA 1EJ6A 3V0GA 3GXUB 4JZJC 2D0HA 3PAUA 1XD0A 5MEOA 2NY5H 4P2RD 3V55A 1CICA 3CMOL 3KDMB 3UPRA 1QW9A 3ASMA 2HLAB 4FNPA 4OFYD 4RDQF 4ZUUA 4BBWA 4YFLF 3L1EA 2HAZA 3TIDA 4P2QB 3IM1A 4KZEL 1MI5B 3VD9A 3HS0C 4AYID 1LO3H 1N4XL 1LEKB 1LK3H 4QHLA 4IBWA 2R2EB 3TTSA 1Q9OB 3N9GL 3CHSA 1RKRA 4LEEA 2Q8AL 5HYSA 1MFUA 1INQB 3FAXA 4WSGA 5I82A 4NC2B 3UBGA 4OLUL 2VWEC 1AQKH 4HU2A 4DTGL 5FGBC 1KZYA 4PJ8B 4XGZB 3OMZA 1H8NA 4MCMA 3NGBC 1A9EB 1FLRH 2J6WA 3CX5J 2WXLA 3SB3A 2ESVD 2WXFA 1NL0L 1TQUA 2HT3D 4WENB 2IBZY 3HFFA 4XX1G 3S8GB 4K3DL 3HLKA 4Y8AA 2K6YA 3VXSD 2HA1A 3EXLA 1TO4A 2PYEE 3IMVA 4HUKB 2E74C 1E9PA 3B8SA 1DQTA 3ARFA 3S97C 5I8EA 4N8CH 1F3DH 5B3JF 1IBGH 4R5VA 1B0RA 5E2WL 2AEQL 5DJCB 4Z6AT 5D7IE 2B8OT 2LOEA 1VENA 2LAEA 1Q9KB 4NFDA 1CG9B 4DCQA 1KTRL 1M6OA 2DY2A 4J23A 5ADPH 3HZYB 1G1YA 3M7OA 4TNVF 1D5XB 5F9OH 3KH3A 2J6EA 3V0DA 3CN1A 5FLUA 2X1PA 4Y9FA 1U92A 2AXGB 4F37F 5DTFB 5E8DH 3GZPA 2AVGA 3BVNA 4ELMA 2WO3B 3D3VB 4FI6A 2QT6A 3N2JA 5TF1H 3WMQA 3GKZA 1T80A 1ORSB 1S3KH 1TZGL 3QO0A 4APQC 1PTZA 5BQ7B 1FYTB 1PF3A 2WXKA 4A37A 4HOMA 5CSZA 2NNRA 2YC1B 4HV8A 5D2NB 1IKFH 1T0MA 3DBXA 1CGWA 2PYEA 3ARSA 4JO8A 3EJSA 1JPST 4C59B 1E5YA 2ZWKA 5C0RH 2HWZH 3FO0L 4F57H 1I8LC 4C56B 1YEDB 2Y23A 1NIEA 5LGKA 2JKTM 5GGUA 3UP6A 4MB5A 2HT2C 5D7IA 4CC0A 2WQAA 4NO2B 4AQ1B 4JFDD 4KJYA 1FFQA 4XP6H 1FV1A 1I85A 3GSNB 3FRPB 4YHKL 2X09A 5BV7L 2HKFL 3EOAB 3WSQL 2CUMA 5GRZA 1B0GA 2WLLB 3C8KB 1G5GA 2OR7A 1IQDA 4JG1H 1GYWA 1IAMA 1F1AA 3AG1B 3MUGA 3OZKA 3HR5B 2J5WA 1JVOA 3PREA 3EO9L 4QRRD 3S3SA 4B0AA 2NSQA 3QJXA 3EJJX 2CBTA 2FX7L 3ISWA 3KR3L 2HYMA 1X6NA 4ZMXA 4KROC 5AW1B 3MMEA 2G9KA 4MCYA 2JIXD 3JZYA 3UTQA 3Q43A 2QHLA 2YD8A 1WD9A 2YMTA 3TWCL 3QC6X 4K7PL 1PNCA 5D7KD 3HJEA 4A2DA 1NAMB 5DR5L 3GMOB 4WI8A 5DLLA 4R4BA 4HKBA 2IWKA 3BD5A 4QTFA 2Y1YA 2Q7YB 5GS2H 1WZKA 4U4IA 5GS1A 3QEUA 2K1MA 2PXYB 3S36H 4UM8A 1S78D 3IPEA 5E1AA 4XVJL 5E9AA 1MIEH 2A6IB 3OSKA 4NO3A 4B7IA 2RMNA 2VDNB 1C1EL 4WHTA 1FNGA 2NLJA 4HX1B 3RNKA 3CCHB 3VFPA 5DQDL 4I3RH 1U95A 2CKBA 4XI5D 2CPUA 2QVFB 1N19A 4YGAB 1R0AH 2IGFL 3NEEA 3WLBA 5I1HL 4XZUB 5HHQB 2K3TA 1H8OA 1U30A 5I1CH 5E4EC 2ZCHL 5EU6D 1UENA 3QORB 3OAYK 4MS6A 5AVUB 3ZKMD 5JOFA 1CZ8H 4MQ7A 2PTTB 4Q4IA 1X4XA 5KTEH 2GB2A 2W0PA 3IJ7A 3JV4A 1Q9UA 4JQIH 3ZUCA 1KYOJ 2F7OA 3KPRD 4K9JA 3ZTDC 1PVSA 5E5MA 3W57A 5AZ2L 5CEZH 1ITCA 4ODXB 1TEFA 4DGVL 3CFTA 3RJOA 2EEXA 1E28B 2PMZA 4FXKA 4O5LL 5JQIB 4FTVE 1Z5LA 4K9EH 5EZPA 3VXUB 2YGOA 1UZ6F 1FFOB 1M1SA 2WK2A 3IAPA 3MYJB 2Z93B 2WZ6A 3PMGA 4L8SC 1QBBA 2QPEB 3V9CA 2Q5BA 1RZFH 1P4LB 3L4XA 4BQCA 5KSBE 3VFUB 2NX5E 3L16A 3BWZA 3MRGB 4P2OA 4PWFA 1UTDA 2BNRB 2EUXA 1G6RL 2CAKA 1L7IL 2LLNA 3FQNB 2AXFB 4GAYB 4Q58C 2IALB 3GJFB 4H40A 4UT6L 1JG9A 5AAWC 1KUMA 1VKXA 4HBQA 4YJZL 4JPWL 3C6SA 5D7LB 2YPVA 3N5AA 3CZLA 4EJ1C 2CJUH 1ADQA 2KLTA 3VFSA 2VLLB 3TJEL 1SQ2N 4Y2OB 1UJ3A 2FUQA 4JRXB 1T04B 1EJFA 1HCYA 3WEMA 1YDPA 4WI7A 1MEXH 2BHYA 1WBYB 3BQUC 3R7RA 4PREB 4NQVA 4YAQB 3VRLE 4LKXA 4R26L 3U4AA 1WS8A 2HJKB 5IMKA 5E1GA 3L3JB 4ZO7A 3O9WA 2CK2A 5FM5O 2IC2A 1N26A 4HDIB 5HI3D 3QYNA 4TVPH 4AW4A 5KSBA 2IJ0C 3L2LA 4GG8B 2A3TA 4HK0A 5I0ZA 4POZC 3DTXA 3LNFA 4U1LB 1BF5A 4EUPA 4QDGA 3IFPA 2VDOL 4R7NB 2X4PA 3KLAA 4D9RE 1UZ8A 4XPGH 1JHLH 4WFEE 1OTUD 5EH1A 1QI4A 1FSKC 4GNKB 4UDTA 3ELQA 3HZVB 2BSTB 1KGIA 3NJLA 2KLSA 3RL1B 1DQQA 1DJZA 4PTUB 1SQMA 2F2HA 3L5JA 2HX7A 4OZ4B 2Z8UA 5HGDB 3BWUF 1S7SA 3DMMB 2WQRA 1YN6A 2VSDA 3F7VB 3VXMD 1ZOXA 2NQDA 2O5YL 3ECWA 3L2MA 4ODTL 5IMMB 3GXNA 3BW9B 2ICES 2W65A 1PG7L 3RB5A 1DZ0A 1FZKA 3U6XA 3DDGA 4L9LA 1KCVH 2W60B 3VGAB 3RVTD 3BO8B 1KWKA 4AL8C 3US0A 3A4AA 4MDIB 2X1WL 2IPUK 4MMZC 5HY9A 3D12B 3OCIA 1DUZB 4LCCC 4IRSB 5KJRH 2X7LA 5LGHL 5C0CD 5KYWB 3V4PA 3ENOC 5JDJA 3K6SA 4O02B 4E9VA 1VGKA 2CMRH 3TZVA 4AL8H 1YTFA 1L5GB 3LS5H 2WIIB 2AXWA 4KKPA 1H3PH 3MXVH 4XVSL 3ILPB 3X11A 4PY7A 4F80A 3CBRA 3GHBL 5ENWA 3PWJA 1H8LA 2R7EA 4HBCL 3T6VA 3HPJB 3F58H 1UM6H 5F2FA 1NEZG 5C3TA 1VFMA 1IGML 1IM3A 5GRXG 3DA0A 2X9WA 3IDYB 3QUHA 3GSWB 2UXTA 5I1AB 1SEQL 4HUWA 4NB7A 2VZVA 4FZEL 3BWAB 3NCJH 3OTTA 3L9BA 5KYXB 4B9JA 5I6XB 3LQAC 1UCBH 2WLJA 3HZMB 3C5ZB 1E3FA 1D6VL 1HKFA 2LFGA 3ARUA 2O5XL 1AZCA 2BSRB 2CLRA 4PJAB 4XVTH 4YDKL 4PRPB 5ID0A 3L4ZA 3QVAA 1NBYB 1T21B 1OT1A 4FXLA 3U4KA 2NW3A 1D5BA 4HA1A 2OSXA 1UA6H 5EOTA 4LMQI 5C2BH 2YPLD 4WWKC 3GXFA 4Q6YA 1KCSH 1RJLB 3CK0H 2EH8L 1EHKB 2APXA 2QDWA 3PDOA 4N2DA 4P9ML 4GKZA 4FQHB 3QNYA 1S7VA 5AKSA 1LDPL 1HILA 5EULV 1UXWA 1W72H 5BXFB 1A6AB 1FG2B 1LEIA 4R3SA 5L88L 2R56H 2WBJB 4HH8A 3VFMA 1E8WA 1S3RA 4HPYL 3BKYL 3VH8B 3N04A 4PJ7E 3DYPA 4OJYA 5JPMC 2WB1A 4UAOB 5DMIL 3TBCA 2JH2A 2FO8A 5E2UH 3HR6A 3TBYB 3TXAA 3I6KA 4RSYA 3ZO9A 2X0WA 4U6XA 3S88L 4MTMA 2AXHA 4LLWA 2Y1ZA 5JIDA 3VMPA 1QO3A 2WC7A 1G7IB 2JKLA 1FLTX 3MRHB 5EWIL 1GKOA 5SX5H 4M7KL 4EN2A 4JFWA 4LESA 2F74B 2AQ2A 1M71B 4FS0A 5DC9B 5I1IH 4G7YL 3NCYP 3WJLC 3L2NA 1HEJC 1WG3A 2JV6A 5KW9H 3LZPA 2OZ4A 4NFCA 1NOFA 4Z7OE 3NIDE 1BZ9B 2IANB 3JUYA 2I07B 4C83B 4MD0B 2DLHA 3IJHA 4XVOA 5HYJA 5HTSA 3I50L 2X4RA 2H5AX 3S37L 2WTPA 5IVNA 3REWB 4J8QA 3UCQA 4OCSH 4K3JH 3QFGA 5GRUL 2NSMA 3IDGB 3ZO0A 1P7HL 4MD4A 4BQ8A 3BDXA 4JFZH 2Z91A 3VSTA 3MRRA 2N7SA 2IOMA 5GGSY 2Z31B 1JHTA 4AIZA 1N2RB 1J18A 5A2FA 5DZ9A 3I2CL 1QLFB 4FG6D 4M48L 1QNZL 3FCSA 1JZ8A 1A4BA 2IADA 5HHNB 5IBUB 3KLKA 4NQDE 1SHXA 5DA4A 1JGDB 3QQDB 1M7DB 1S78C 3PWPB 1WC7B 4AG4H 1CLZL 4RAVB 2OZNA 1G7QB 2YGQA 3ASNB 4X5QA 4UQ9A 3WKNA 2CXGA 4IU2B 3ABLB 2FH8A 1F6FB 1KCKA 5I76A 1IZKA 3EYOB 4XI5C 3QCVL 1NIDA 3ARED 2P48B 2R0WH 4XN2A 2GSMB 1FNAA 4K23L 2WKOA 2GPZA 3RWIA 1MHEB 4HG4J 1I1AC 3PJSB 5IB1B 4YR6A 4OJAA 3OF6D 3EO0B 1OGAD 1N59A 1UYWL 1CD9B 4Y2DD 3GXDA 4JLRA 4QHNA 2WZPD 2AABL 1NFDE 4M7LH 3WAJA 1BMZA 2W1NA 4NQDA 4HJ0D 3CZEA 5E95B 1FORH 1NAKH 3SE6A 1Q1JH 5C07A 2MPAL 4MXVE 4PP1C 3GSOA 5AB9A 3T0DA 1LP9E 3GMPB 4FXGC 1XIWC 4GFXA 4KO6A 2WVVB 3L6FA 5D7JD 1NLBH 5EORL 3KYNB 3UYRL 1UEYA 4NPYB 4PJFF 2I7SA 1EWHA 2DQ6A 1RURH 4OFPA 3MI6A 5BCAA 1WHOA 2IDSA 1CXKA 1VFAB 4FFTA 4CSPA 4Z7IA 2XNAA 5DMKA 2VDRH 1YY9C 3ESNA 5F9DC 5L4FA 1RK1B 3TBVA 1Q0XL 5T1JA 1SY6A 4J4PA 5TK2A 3FSAA 4OD3H 1NBVL 4I4WA 4PUBL 1QNCA 4D9LH 4ZFZB 4BSJA 2OMNA 4Q4EA 5EPMA 3HG1A 2XN2A 2FNBA 1DSYA 5JW4M 1VOKA 4X83A 4X7FC 1SF5A 1GY2A 1HWGB 2KMWA 4XBPB 2W9DH 4UQIM 3UIZA 5C0DB 2RQEA 4R96B 2VZ1A 3QFJA 1PAZA 1EDQA 4KDTC 1NFDA 2XY1A 4Y4KA 1UUSA 4I88A 2WLMA 3AG3B 2F5BH 4G5ZH 3X12B 1K9TA 3G6JA 2Y69B 5IROD 1IGCH 1TU2A 3P73B 3GSQB 2E7LC 4IBLT 3LNHA 1AZZC 1KBVA 5F8RC 5C0BB 2VLKB 3LZLA 5CR1A 4DIXA 2MEJB 4NZRL 3T4AA 1AGFB 1DFBH 3P3UA 4IMLA 3P4LA 1O5DT 5HI3C 3D2UB 1VRSA 3GK8L 1CL7H 3HVDA 2Q76B 4YHYC 4FQQA 3W9DB 2A6JB 2AEPL 3NOIA 2A7BA 4JY5L 3SGEH 2OCFD 3MROB 4KX7A 5EZOL 1ZCRA 4NO0D 4HKZA 1JYXA 4NSKB 4L8CA 1ET8A 3JVFC 1A6WL 3EG9B 2CSPA 3QUZD 1HC1A 4UV4H 3EJCA 3RX7A 3DVNA 1MI5E 2UX7A 5IF0A 4QI3A 4N0CC 4P3CH 1YQKA 1C7SA 1WLHA 1ZV9A 4K3GA 4WV1B 4OT1L 5G2NA 4JFPA 2MJWA 3CSBA 4OD1L 2P8MA 5I1GL 5GJSH 1VIWA 5FF6B 4WEEA 4PJHF 4N0YH 1UOLA 4A2LA 1HXMA 3NK3A 2WNWA 3PWVB 1FZJB 3VB9A 3MLPA 1EHXA 1UB6B 4NWTH 5KSAB 5BQDA 3MJWA 2G5BB 3H2PA 5EUOF 4HALA 5FECA 2ZOLB 4JG0H 5TGBB 4K7FB 3PP4H 3FSVA 1ZT1A 5EEWA 4NFBA 1PLGH 2IV9A 5C0EB 1MDAA 1DQMH 1OD9A 3B2XA 1F45A 3KDMA 4UTAA 3VXRB 2HLAA 2VLJD 4ZMNA 3BE1H 4I9WD 3BZDA 3MRQB 4PI0A 2WXGA 2V2XB 4P2QA 1MI5A 1OANA 4K3HA 2PABA 4PU2A 2WUBL 2JCWA 1V3LA 1LEKA 2WVTA 2C9AA 4XAWH 3WBDA 4I3SL 3DUHA 2R69H 3HKFA 2R2EA 3NP3A 1Q9OA 5LLIC 1CLYL 4MWFB 4LSDA 1DZBA 2EZ0D 2MKWA 1HHHB 2WLYA 4YSPA 2WBXA 5B1JA 1HNYA 4Z7QF 5EBWB 1OAKL 2VDOB 3TN0D 2H7WA 2WHVA 2AEWA 1AD9B 4ANVA 4DH2A 1XSJA 4XGZA 1M57B 2VZ3A 1A9EA 4JM2C 2G3MA 5FA3B 1A22B 4A7UA 1MPAH 5I5RA 3O3AB 3FHAA 1E5BA 5AW0B 3ZDXE 1FA4A 3ETBF 3TEXA 4AIXA 2YA1A 3SGKC 3NSFA 5C1MB 2BFGA 3APFA 1ZEAL 4PJDF 1P6AB 3V0WH 4KQ4H 4MAUH 2JJTC 4P5TD 3RA7L 4NCC2 4OCRL 1JDDA 4ATTA 2A2QT 1JZJA 2WLKA 3D07A 3MRMB 3VXQB 5I18H 3LN5B 3O41B 2VIRB 5DJCA 3U4EB 3TBWB 3WU1A 2XHNA 1Q9KA 1CG9A 1GHFL 1OXYA 1QLEL 5JMVD 3NJJA 3HZYA 2WP3T 1A0QH 1D5XA 1HN1A 3MLWL 2V2WB 1AKJB 1SVCP 1CGSL 1CU4H 1V27A 2XYCA 2AXGA 2XKNB 5DTFA 5F1IA 3D3VA 2R15A 4IKIA 3RB7A 1TTUA 3BP5B 1KCRH 4MNQE 4PW3A 1ORSA 2Z92B 3ZHLA 4G6KH 1NCWL 5BQ7A 1FYTA 2E7BA 2AI0H 2YC1A 5F71A 2CUAA 5DD0H 3LXAA 1PD0A 4KRPB 4ZNEA 1DBKH 5DDHB 1ASOA 2FGWL 1M3HA 4R83A 1I7RB 2NNXA 4TRPL 1DQLH 4PN6A 4O2EB 5FM4A 5AOIA 4DZBB 2YS4A 1YEDA 4LSTH 4A6YH 2XQYA 4TTGA 4NO2A 3RKDD 4AQ1A 5I19H 4NCC1 2OOXA 3EYFB 4OI8A 3U1SH 1SRDA 2DM7A 3EOAA 3GI8H 2ATKB 3LPOA 3WELA 4BK4A 1UWFA 3P3SA 2WLLA 3UJIL 3C8KA 4N2GA 2DEYX 4LSPH 3HUJE 5TDPB 5AN4A 3HI5H 4C54A 3NT0A 1AHKA 1T2QH 1XXDC 3FSZA 4B0MB 1A2YB 4R8WH 3HR5A 1ASQA 1E67A 3MRJB 4NUGL 4RRPA 1WFOA 3U0PB 4W1TA 4P57A 4FNLH 5DZJA 4EQ2A 1BAWA 4TUKH 2QPDB 4GUQA 2HH0L 2X0UA 3D30A 3ARVA 5TK4A 1UB5B 2EJ1A 2BRRL 2PTVA 3II3A 1QBLL 3IMUA 1NAMA 3HRZA 4TULL 4P46D 3GMOA 4GMTL 4RAHA 1W8EA 1JGUL 1AI1L 4WSKA 1HX0A 3QS2A 3VWKD 4TSBL 4LARL 2Q7YA 3Q05A 3IGKA 1QZNA 2BWDA 2H32B 2PXYA 1DVYA 3APNA 4N8PA 3DIFB 3F7RA 4G5AA 3QZWB 3SBPA 2WWMC 2A6IA 3UTTD 2PO6B 2FX8H 2Z6FA 1A7QH 4XPFH 5DRNB 4M3HA 3QUXB 3ARGC 5EF2A 4HX1A 1R3KB 4KY2A 5EBMA 2NT1A 3CCHA 4FRWA 5DCCA 1L7TL 5F7FA 4MS8D 3AREC 2V5YA 3BAWA 1TJGH 4DEPC 2DQGH 2FJGB 1PLBA 2XQBL 5KYNA 3K46A 4UDUB 4UF7C 4GLRI 1MQKL 1FVEB 1PZCA 4MA8H 4AWJC 2AAVA 4XZUA 5HHQA 1EJOH 5B7FA 1U8LB 3BKCL 4F2EA 1NPNA 2Y06L 3T6WA 4Y2DC 1AY1H 2L7QA 3QORA 5E1HB 5D7LE 5T5NF 2PTTA 1B90A 1MXDA 3ASWA 1TJXA 2J3SA 3AVEA 43CAB 1ODAA 2L3BA 1SHSA 4M1DL 4ODXA 3S4SB 3GRWA 2M8XA 3EHBB 1E28A 3L4TA 4WY7L 1D9KD 3BUYB 1YJDL 1BW8A 3CLWA 4HEPA 3WD5L 5EOCL 1FFOA 3MYJA 4YX2H 2Z93A 2E27L 4OF5A 4NYLB 2DI8A 3GBML 4PP2B 4QG5A 4MJIB 1TT6A 4M03A 5H37H 1KWGA 3BT2H 2YMXL 3ESUF 3K74B 1P4IL 3VFUA 1GC1C 2JKRM 3MKGA 4JFFD 2ITFA 3MRGA 4HGKC 5DD5L 2BNRA 3E1F1 2DMCA 3FQNA 3KPLB 2AXFA 4GAYA 2IALA 2VLME 3GJFA 1Q8MA 4G72B 4UYQA 2JVUA 3MV8E 5D7LA 5I8CA 4N22A 2ALWA 5DD3L 1HINH 1AOZA 2ICEB 1GAFL 1D7CA 1UWGL 3KGTA 1MNUH 2VLLA 4Y2OA 3C2SA 2Q3ZA 5IROC 1HU8A 1NLDH 2VQ4A 1FDLH 1T04A 4HIIB 4JRXA 3D4YA 5GZND 4GRWB 3GRBA 2LE9A 5D4IA 1YNLL 1WBYA 3HE6B 2W92A 5I5JA 1DJHA 1S7UA 4PREA 4YAQA 1A65A 1B3JA 2HJKA 2ZP0T 2XV3A 4FL4B 4M3KB 2R5XA 3O6LH 3L3JA 2KZBA 5I74C 4HXAL 4HDIA 1AG6A 3T3ME 5BMNA 1F90L 2K8MA 1J87A 4NENB 4GG8A 1DQVA 4U1LA 4RFNB 2YQ2A 1JVLA 2BNQB 1RZIB 1XHHA 1FJ1B 4R7NA 2NR6D 5FHBL 1KYUA 4K2UH 1P7KB 4ZMQA 4ZG1A 3QUZC 4H13C 4L3ED 1YC7A 5EIQA 5T5FA 4LU5H 3Q6FB 2C9XA 4HXBH 1YEGL 3MNDA 2K6ZA 1UG9A 1X4YA 4FYTA 3HZVA 4FKHA 3TYGL 1T03H 5JPNB 5B39G 4F8TA 1IRAY 2EQDA 2Z8RA 3IDNB 1ZAGA 1X5HA 4L1BA 5E23A 3RL1A 4NPJA 4PTUA 5A3IC 3WN6A 2BZCA 2DQCL 4OZ4A 1U8KB 4G8IA 1AO7B 2B77A 3GDBA 3VDCA 4GYBA 5HGDA 3DMMA 1ES0A 2ZUVA 3F7VA 3LDBC 5HVGB 1SLWA 1CGXA 1U0QA 3O3DB 3BW9A 3IRCA 4LIQH 3MRCB 5BRPA 4DAGH 1FZMB 1E6JH 4BFFA 2SODB 3BO8A 3QWQB 2YN5A 5FYKE 1JXGA 1A7NH 1QSEB 2YGPA 4MDIA 4JPSA 2BLFA 1YEFL 5E6IC 4FMVA 4PJHB 5H4YA 3SZ6A 4DGYL 4F7MB 3LMJH 1W80A 4BFNA 4IRSA 5SX5K 4B9GA 1INEH 4KO7A 4BRVA 5KYWA 1GZHC 2OR9L 2NVMA 2LVEA 4O02A 1D3UA 3AITA 1L5GA 4R4ND 1VEMA 1X9UA 2WNXA 1A6PA 1H9VA 2I7OA 3ILPA 2ESVE 1IC4L 4ODHH 4FFYL 4M93B 3O2VH 4P04A 5GIRA 2GUYA 3WDIA 4EIGB 5CBEB 3ERXA 3MJ9L 4J5VA 2C8NA 4M6NL 3HPJA 4PLJD 3CTTA 2CHXA 3CHOA 4PWGA 4XP9H 2EC9T 3RIKA 2MPVA 3GSWA 3B7SA 4LLYB 5CP3H 1XGRB 5I1AA 1X44A 5HDWA 5CU9A 5A2IH 3C5SB 4QRTB 3BWAA 3SGJA 2FLBT 5ERWB 3QWRD 2ZXBA 1NCDH 5KYXA 4X9GA 3S2AA 3ABKB 3HZMA 3C5ZA 1Z1WA 3NRPA 4G8GD 2A9DA 2R1XB 4Q9CA 2BSRA 2VUOA 4PJAA 4FGMA 4PRPA 1MRDH 4EZJA 1NBYA 1T21A 1P9MC 4W81A 3CN0A 1KTCA 4F7CB 5BZDB 1F3RB 5D70L 4PB9H 4E41E 1Q72L 2OI9B 5IG7B 4ONGL 5IIEB 1VZIA 1RZGB 3INOA 4YSEA 2A6KB 1MCEA 1OARH 1RJLA 3HLAB 4M8RA 1HL8A 2R27A 2X3BA 4JPKH 4B9ZA 1U8IB 4M7JL 4J3WA 3VD7A 1UM4H 1CFQB 5JHMA 3SJVD 1DUYB 4D7PA 3AC0A 4NP4H 3QJTB 3FMGL 4FQHA 4TNFA 5D6DC 4UINL 5BJTB 4OZHB 1A14L 3GB7B 2FAUA 5I1JL 1EK3A 5BXFA 1A6AA 1FG2A 4Y5VC 4RMQA 3SE8H 4AX3A 1RJZB 2WBJA 1ZVHA 2JTYA 4L0YA 1DSFH 5E6ZA 2W38A 3VH8A 3VJ6B 4XC1H 1CGYA 1OAYH 4H7VA 1L4IA 2OQJB 2XWCA 3ZR6A 5M95B 1UKSA 2BIOA 2FHCA 3RPKA 3TBYA 3BVTA 4L3CB 4N8VG 2PYFB 1VZGA 3BLBA 4C57C 1DJSA 1L9RA 3ULAB 4FQJL 5T3XD 3LNEA 1QFOA 4ZMPA 2H0PA 4KHXL 5FYJE 1G7IA 4E41A 3MRHA 5C6PB 1ZTXL 1XSIA 3EGDB 4BFOA 2GBVA 2Z7WA 3B2DC 2CGZA 3CXHK 3PS6A 2F74A 4ZFOL 1M71A 5I15L 1NH6A 2AJXH 4V2CB 1CD1B 5F88B 3RKDC 4PJ9B 1NBZB 3TT3H 1TQSA 5LVEA 2IQ9L 2BZ7A 4N2HA 3NPZB 3WFHB 2A38A 1WFUA 1FG9C 2IANA 1FFTB 3M1BB 2I07A 4MD0A 2MCMA 1IGJA 3GSUA 3HMXH 4Z95L 2X05A 1SLUA 3REWA 3JTBA 3TV3H 4HOWA 5D7KE 4CMHB 2XWJB 3OQ3B 4ZO6A 4ELKB 3IDGA 1DBJH 3L3DB 1O9VA 5ECJE 4YXHL 2GI7A 4Y9EA 2R0ZH 1E65A 1EUTA 4MJJA 1A7PH 2WD0A 2VXTL 2XWRA 3VD3A 2ENYA 3FTZA 1QLEB 5EEXA 4OGAD 4FQIH 1PKQE 5F6IC 5SWSD 3T9WA 1N2RA 3O8XC 4YHOH 5GRVK 3W82A 1DQJA 3VFTB 4RGNB 5SWZD