3HS8A

Intersectin 1-peptide-ap2 alpha ear complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
FEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adaptor protein complex AP-2, alpha 2 subunit
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 58
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs8A02
1OM9A 1KY7A 2IV9A 3ZY7A 1QTPA 1KYUA 1RM1A 3H1ZA 1GYUA 1GYWA 1KYFA 3OCIA 1NH2A 1VOKA 2E9GA 5IYBP 4RODB 3MNMA 1NGMA 1QN3A 3ZHFA 5IYCP 1QNCA 1TBPA 1YTBA 4WZSD 3EIKA 1VTOA 1TBAB 4ROCB 5CN2A 2DWYA 2VJ0A 1GYVA 1QNAA 3HS8A 1PZDA 1QNBA 3ASMA 1AISA 2D0CA 1MP9A 1QTSA 1QN7A 1IU1A 2YMTA 5IYDP 1D3UA 1C9BB 1CDWA 1QN9A 1KYDA 4BCXA 2IV8A 4B0AA 4ROEB 1QNEA 2A7BA 2D0BA 1QN4A 1KY6A 3VN5A 1TGHA 5CN1A 1B9KA 2MJ7A 1NVPA 4PY5A 1VOLB 1E42A 2DWXA 1QN8A 2Z8UA 2G30A 1NA8A 1QN5A 1PCZA 1QN6A 1YTFA 1VTLE 3HS9A 1JFIC 3OC3C 1W80A 1R4XA 2D0AA 1P4UA
chains in the Genus database with same CATH superfamily
3S35H 1FZKA 3ZE0E 4JO4L 3WN6A 4Z7OE 3MUZ1 2VDOL 2YBRA 1XCQA 3MJ9L 2MOQA 1I85C 4LMQE 1J11A 4QD2E 3QHZL 3UDWA 4KJYA 1N6QL 1CG9B 4M9PA 1IAIM 3CFTA 4XNYL 4AIOA 3SEPA 1FGVL 4HFWA 5EIIG 2Z4TA 1FNHA 4NIKB 4FABL 5IFJA 2YKLH 3NZHH 1NFKA 3MRDB 1Q9OB 2JKXA 5KBDA 4W1TA 3HZKA 4L0ZA 4F80A 4M1CC 4JFZL 3HLAA 4ZS7L 3KWTA 1VKLA 1T1WA 2BSED 3MRPA 1R34A 4KGLA 4I2XE 3QCTL 5DJ0A 3KE0A 5L2JA 3DXAB 3OVUB 3VJ6B 2ORBH 1IRAY 1I8LA 5KANG 1ZVSA 4AL8C 4WW2B 2O6EA 1KCKA 4KI5F 4N2AA 3T0WA 3GSQB 1OW0C 2CM6A 1YHPA 4JQIA 1XHHA 2GJ6A 1P1ZB 2H6UA 5DVOA 1MFAL 2IH9A 2EICA 4OCMC 5GGTH 5HHVL 3BGAA 3NRPA 2JJTA 1S7UA 2HX9A 1ZXKA 3HNSH 4F37K 4LCIH 4KVPA 1UM4H 4RFOL 1SDDA 3AROA 3EO0B 4LP5A 1OP4A 2P48B 4P46D 5E2WH 3ISYA 4N5UA 5C09D 2JIXA 2Z0FA 1U33A 3AT8A 3H9SE 4MAYD 1SM3L 1OOWA 4NZ8A 5CD5C 1JPEA 3B9KB 3VD4A 1G0XA 2VN7A 3EJZD 1G9HA 3LQZB 5J6HA 3T4AC 3UO1L 2CJ3A 1MH5A 3V55A 4AKPA 2OKMA 2OPCA 4AUYA 2AS5M 4DVBB 4NN6C 1T0OA 3BKJL 2NOIA 4NZUL 4OY9A 4GAYB 4WCYH 3BESR 1EANA 2BVQB 3GI9H 1QZNA 2DWEA 1VAHA 2TRYA 5ISZE 4LFHG 3TF7C 2XYBA 3S6CA 4N90E 5FCUL 1H3PL 2DQEL 2WCPA 4YDLC 1SXBA 3G08B 3HC2A 1BVZA 4L5FH 2EE9A 1O5DT 4G43B 1JG9A 1VKXB 3K71A 1K72A 4A2FA 3G5YA 4Q6IB 5DQJB 3U4EB 2DQGL 4AQEA 1YQVH 3QWRD 1DQMH 1H6EA 3NSDA 4UILH 3RPBA 1F56A 2OV0A 3DX9B 5KVGH 1W0WB 5I17A 1TVHA 3X1BA 1F4XH 4P4RB 3MJ7A 2ENSA 3VU1A 5IV2A 2FO4A 5C0AD 1T4WA 5KUKA 4FP8H 2IV9A 4M7LL 3NIGB 2VUOA 1KYUA 4W6XB 3VH8B 3UEQA 2I07B 3WFZA 5L88H 3N42B 1BQHG 2KDYA 3O2DA 4OGZA 3P40A 3VFNA 4G5AA 4YX2L 1ZIBA 2UX7A 4PJ9A 4U1HB 3ZHKA 1A9EB 5HGHA 3DVGA 2XVBA 4EUPA 3F7VB 3LCYA 4RH4A 3UYRL 3EDEA 3ELAT 4UYQA 1LEKA 1GH7A 1KXTB 3SQBB 3WTTA 4R96B 4FGMA 2AAAA 3GO1L 3MLTA 4ZS6D 4E41A 2CHZA 2A74B 1J9SA 3GSWA 5AAMC 5MENB 1MIMH 3MRGB 2BS71 3RDTC 4XODA 3GUTA 2NOEA 2WXNA 3SDDC 1UD2A 3FN3A 4R7VA 4JM4L 4XPFL 3LRMA 2NYKA 3EKCA 3FB5A 2X4RB 4RQQB 4TVSa 2VXQL 2R1XB 4P57A 4DZBA 3EIKA 3V5DA 3Q5TA 1MCHA 1S3KL 5BV7C 3CUPB 3OAUL 4S1RL 1Q9UA 2KLRA 2WZ5A 3BP7B 3BIAX 4KHTH 1A66A 4R84A 3DK0A 2FIRT 4R5TA 2CLRB 1AFVL 2UY7B 4GIPD 4IJTA 1RPQA 3PJSB 5D1ZC 1DVSA 2R2BA 1J9TA 4P2OC 2EABA 4FFZH 2UXVA 2OMVA 2EXWD 4NFCA 2GEQA 2AQSA 1AQDB 1EA9C 4HKXA 3T3MF 5F89A 4OGAC 3FQYA 5DMIL 1TTGA 3MBWB 4DP6X 2R0LH 3B2VL 3DI2B 5DJZB 2EYSB 1RFDH 1I9JH 1NC2B 3FXIC 3H56A 4M02A 3V0DA 4G83A 1M1XA 1XGPA 1GZHC 4D9QD 2XETA 3W2DH 1KIPB 4JFEB 3TO4D 3UTZA 1DBBH 4H4NA 3UTQB 2GT9A 4JLRB 5FYJU 1COBA 4G8FB 5CIPB 5GGUA 3S36H 5CCHE 2JCCF 2KH2B 2ZOLA 2FL5B 3FRUB 4JZNA 1PG7H 4L9DA 2CSPA 4IRJB 1D5IH 4NI6A 1E40A 1G94A 2E6JA 3E1F1 3GSNA 3IU4L 4E9LA 1F90H 3SN6N 5FECA 3QXAA 2JB6A 5IT2L 1JTOA 4KKAC 4YHLH 1A5FL 4D7BA 1MKFA 3HRPA 1RHHB 2Q7AA 5IF0A 4C47A 3JT0A 5EO9B 4P23A 2A9BA 3GSXB 1SVZA 2F53D 1KSRA 1F5WA 4MJIA 4L3EE 1AGEA 2BFVH 4YH6A 4WY7L 5JIQA 2AXGB 1KIRB 3MOAL 3WKQA 2CR6A 2N7SA 5CR1A 5CHNB 4BV1A 3L81A 4AQ8C 4P5KB 1AKJA 3P54A 1BD2E 3BIBX 2YA2A 2CCLA 1B0GA 3MI6A 3O3UN 1JD9A 4GRMA 2XJKA 4XXDA 3VFUA 4C8XA 3MRHA 2TSBA 5JIMA 4Y5VB 3B37A 4NQDE 5D72H 5I1EL 2VDRL 5SWQA 5GJSH 3FOMA 5SV4A 3X13A 3LEVL 4Q52A 2WZ6A 1DIZA 1R0AH 1G84A 5I0ZA 2YD4A 1XF1A 2XTSA 5EV7A 2WWKO 2EH8L 3U2SA 12E8H 5IYBP 1MG2C 4YSSA 3C6LD 1KCBA 2Y5TA 3PS6A 4LRNL 4PGZA 3RVWD 2GCYB 1XF4A 3PHOB 3D4YA 4XI5D 1MNNA 3GXMA 4XAWL 3PWNA 3BUQA 2Q9OA 4JGMA 4RMRA 3QCVH 1DEEA 4AL8L 1AZBA 2W38A 3BI9X 4MA8L 1IM9A 3VGGA 1E4JA 1K4CA 4JM2D 3JV5A 2EEFA 3PP3K 1OZTG 1B2WL 2PO6D 1AIFB 2NMSA 3NAAH 5EZOH 5M95B 1X5LA 4LAJH 4GG6E 4XCNB 5KSVA 1MFBL 5CEYA 4JDZB 1QFWI 4LXFA 1YYMH 2KC0A 4X0KA 3CBKB 4FTVE 1HAWA 4YBLC 1QKZH 2HRHA 3T04D 1EBPA 5JA9A 4J39A 2DEWX 3PWUA 2WPGA 1F6AA 4H7VA 1VZGA 2X42A 4N4YB 4N2LA 4EBQL 1UT7A 5IVZA 5ICXA 1FBIH 1RURH 4JJHA 4QYOB 4XP4H 2FQGA 3MV11 3PPEA 2PN5A 3BZFA 4QTIH 4UUJA 1LDPH 1G1YA 2ICWI 1QNZL 2VNCA 1SBSH 3O3EA 5F0MB 3MUY1 1J87A 4E42A 5HDQH 3MXWL 4UMGA 2NY0D 4KK9D 3DBSA 1UHVA 1AZUA 5FGRA 1N18A 2ROXA 1YEKH 2IG2L 2NXZB 3AREC 3KWWA 5DZPA 3U0TB 4NC2B 5DSCB 5C09B 2CLVB 1SFDA 2DLEA 1SJEB 3H3PL 2XA8L 2R0KH 4X5RA 1P6AB 2Z0BA 4L1SA 5FHBL 1J1PH 3U36B 3ZYZA 4AV5A 2GJJA 5DFVD 4MDRA 3BW9A 2DD8H 4JDEA 3VB8A 3VAEA 1CN4A 3CFDA 3ARBD 3IWUA 1PY9A 2BDNL 5E9DD 3WFDL 1T03H 6TAAA 1FRGL 5BCAA 5IW1B 4M1DH 1ML0A 3FO2A 4IKKA 1SDAB 1VSCA 3OJDA 1QYGL 1DVXA 2WTRA 2WLIA 3BH9A 2QLVB 4MVBD 3RWHB 4M7ZB 5F3BA 4GMTL 2AEQH 3CNKA 4AEEA 1VFMA 3EJYD 3K6IA 1DVQA 4Y9GA 3M1BB 5FW7A 4Z7QE 1DQDL 3TA3D 2R1WB 5DVNA 4NN7C 3CN2A 2A83A 4PRNA 3CFBB 5IJVA 1CF1A 1KGCD 3FB6A 4HHGA 4WLCA 4JFQB 4WFHD 3BKYL 3ILQC 3RNKA 5MERA 2QMJA 2F7OA 1OE3A 4KKZA 3HR5B 2FWSA 1CE6A 4ZMVA 5C0AB 1ZWIA 4Z7IA 5K59E 1D9KC 2ZWNA 3FTGA 1ASPA 4NT6A 3SGKC 4XN2A 1CLYL 3O2VH 3N5AA 4YC2C 2EDOA 4PRHA 3MU3A 4WI6A 4WFGD 3TEUA 3RG1C 5BV7L 4LBAA 5LQBL 1DQLL 2OL3L 4Y2DA 1EXUA 2ZD0A 4NCC2 5E6IC 2C9VA 5D6CA 2HT3D 3I2CH 4ENZA 1I7RB 3MV8D 2DQMA 2ENJA 1AGDB 3JWNE 4K23H 4PUBH 1ICTA 4JJ5B 4NKDB 3X1GA 5LKNA 1E4WH 3QXVA 3GXFA 4OJFL 3QI9C 4IBYA 3D7PA 2R8SH 1AQKL 1XL4A 2IGTA 5BS0E 4AVIA 4AOFA 5DHVA 5EOCL 2V0AA 5IM7A 4MZIA 3UYPA 2HJFA 2YSTA 3APCA 4KDWA 5JIPA 1PZ5A 3RIAF 4JRXD 4G59C 4JFDE 5SX4H 2YD9A 2B9AA 2CJUH 3UTTA 1XGQB 4IMLA 3DOIA 3PQYD 5C2BL 2V7NB 5D93C 3IS0X 1OGTB 1AS7A 1PD1A 4XPAH 4X6CA 1G7IB 1H3XA 2PKDA 3ARFC 4U1LB 4LDLB 1S5IL 3RX8A 5E4EC 2VH5L 4DFHA 4U1IB 2AHIA 2E7LA 1SHXA 4FQHA 4HKBB 2ZPKL 3MRRB 5K9OA 5KWYC 3LEXB 3MYJA 5EU7E 1PGRB 5IIEA 4HVBA 2P8PB 3QFJD 4ONFH 1WSST 4F7KA 2OJ1A 3VA6A 1K8DA 2P42B 3A24A 3DECA 3QEQE 2AEPL 2VISA 3ESOA 3IDJB 3QW9A 3NIFB 1WIUA 3B43A 1CMOA 4ATTA 5F1IA 2EZ0C 5LHDA 2F15A 3LIZA 3AS0A 3WD5H 4OLXH 4A55A 1I3UA 4G42A 3IJ9A 1FGNL 2OMYB 2WD0A 5E2UH 3WTWA 1MI5E 1E2WA 1TLKA 4PJIE 3N3EA 2YLKA 3WEBA 3NCJL 3QR0A 2QL1A 4XN4A 4XX1G 2KUTA 1P4UA 1CDBA 1E27B 4IBVA 4RMUA 3DX7A 1I7UB 3VRJB 1P1VA 3UJIL 5GSVB 2AQRA 2GVYA 4IOFD 1IAIH 3PU7A 4RX4D 3X17A 2NSMA 3I3EA 2JI2A 3PUCA 4BFIA 5FDWA 2VLRA 2LU5A 3CPUA 2RAMA 4K3GA 1PKOA 3FH7A 2H0JA 3CSFA 4X9IA 1AANA 1JHTA 4MX7B 1NCWH 2OI9C 4IYKA 3FU7B 5CU9A 2AMUA 4ZX4A 2F53B 4OLUH 2HRLA 2V5SA 3RWGA 2MPVA 1MREH 5EULV 1S3RA 1TCRA 1JPTL 4Y19E 1J9RA 3IPEA 4PJXA 1E7VA 2EDLA 1F3DH 4HK0B 1TQCC 4L1BA 4XP5L 4X6DA 2VLKD 4MNGE 3JWDH 3UO8B 3Q3GB 4F7CB 1ZHLA 4X4ZA 3B2XA 3MREB 1JK9A 5FW6A 3DIFB 4PLJC 4NZFA 3ZX1A 4K8RC 2GBTA 5TPWL 4AENB 3TFKC 3SDYL 1TJGH 4YSUA 1U8HA 5JHAA 4IRSC 2PP8A 2WLZA 2RFXB 5F3HB 1FHNA 3BEWA 3C6LB 5CZXC 1XGUB 1G4RA 5D71L 2WOBA 1JF6A 1RUPH 5DJ8B 4MLSA 1UEYA 3V8OA 4AV0A 2FECL 2O26U 4PB9L 1W8EA 3WJMA 3WS3B 3V4VB 5A16B 3ZL4H 3NH7H 4DGUA 4MMZA 4JM2B 5F8QC 2WXKA 4ORZC 5ALBH 1Q72L 4GSRA 2PO6B 5FKPA 1U8NB 4U33A 2K78A 3BP4B 4JO4H 5I2IB 3APDA 2VDOH 5JXAL 4WWKA 3MJ9H 2CBMA 3OKEA 4C4UA 4OZGE 3NABL 2JJSC 5CGTA 3QHZH 2H4EA 3BSZA 3BVWA 3HBPA 5DZ9A 4Y9BA 1QA9B 1N6QH 4MXVE 3U82B 1H8SA 4XNYH 2YIHA 1NJ9B 1UATA 4GT0A 2DPKA 4PY8I 1FGVH 3VFTA 4MCYB 2NOBA 4MCNA 4A04A 4DULA 1UTDA 4P2RA 1HXMB 4TUOB 4Q97A 5I76A 4FABH 3VI4E 2LTQB 4GEJA 1G7QA 1HL4A 2HVBA 2HYMA 4Y8AA 5AZ2H 3NZSA 4JFZH 4BKSC 2XQYK 4ZS7H 2VM3A 5FWQA 4KXCA 4Q11A 1U95A 1KUMA 4FNTA 1QWUA 2LAGB 3QCTH 5I6KA 1NEPA 1U3NA 4O2EB 1G1OA 2VRKA 2X88A 2CIIA 2VKWA 2FT6A 2W91A 4K7PX 1A1NA 3BO8B 3C8KA 4XBPA 5FC9A 3FT2B 3TEZA 1FPTL 2N01B 1SZNA 3DLQR 5A6IA 5CP3H 4I4WB 2D03L 3GS0A 4G1EB 5FFGA 3MUHL 3MO1A 5D1XE 3MLZL 2WBJB 1CLZL 1MFAH 1JD7A 3B2UD 1L9OA 4Z3JA 3X11A 5HHVH 1KDIA 2HTKD 3SDCD 3WLBB 1AH1A 3VXSA 3RZWA 5EN2A 2NYYD 4RFOH 3FU6A 5K1JA 2R51A 3ZTCC 3BWZA 3ESUF 3VD3A 4ADIA 3SYPA 2FQEA 3ARBB 5J89A 1UB6B 5E9DB 2IH3A 4JPIB 5D5ME 4PPTA 5I74C 4TV3A 1MFEL 2WSPA 3LRSB 4HDIB 1G6RL 4KKNA 3HNVL 4X6BA 5C0JA 1SM3H 1UXLA 3LN4B 4QRPE 5C08D 5J1TC 3GEFA 1ORQA 3OWEA 5E8NA 1YQMA 3DROA 2X0UA 5AZEL 5KVFH 4MS8D 4OKDA 3FF7A 3GLAA 3BKJH 3BPLC 4DGVL 1KG0A 4NZUH 3JTBA 3O4OC 1V55B 2UZYB 1N3AA 1U8LB 3QUYC 3QEHB 5AW1B 2WJ5A 4J8RB 3GZQA 2H8PA 4PJCE 5H4ZA 5FO8A 5MHSD 3ZK0A 5FCUH 2DQEH 3H4FA 3D33A 3BIKA 1JP5A 3V79C 4EALA 2H0FA 4JRYE 5MEQA 2B1OA 3IDMA 2Y2TA 3MLXL 2DQGH 2MJWA 4X5WA 2C7FA 4IKJA 4BCYA 3DTDA 3SKMA 5HVWA 3MNZB 3BUYA 1GSKA 2C5DC 2PETA 1X7QA 8FABA 3VXUA 2D7MA 2ICEB 1DL7H 4FXKA 4QRSA 2WVTA 3JXAA 1DP0A 1UZ6F 5JTWA 1JXFA 3IF1A 1YNLL 5D7LD 4K2UL 4ZUWB 2H2PC 2OR8A 2OSLA 2QADC 3J2PA 4KK8C 3O8XA 2C3WA 4M7LH 4OF7A 2PW1A 4NBZB 4DETA 4F57L 4YX2H 3EHBD 5DD6A 5HI5D 2OULB 1LLAA 4JRXB 3N44B 1A6ZB 4NGHL 3UYRH 3S35X 4YDJB 4X50A 2RIKA 4GAFB 2HPOA 1ZEAL 1VADB 2OMWB 2WLHA 3AAZA 3GO1H 4ODBD 5INDB 3PQYB 3SGJA 4O2FA 3P4NA 4IK7A 4LEXL 4YSOA 1PCSA 3QZWA 2IMMA 4YGVB 1C5DA 4MA3A 4XPFH 4JM4H 5TK2A 3T3PF 5F0LB 1SXSA 5D2LE 1TZAA 1NDGB 3NJLA 3TBSA 3WOVA 4KPHL 4F91B 3ABLB 1PU0A 3VVVA 3B5GA 4G6ML 3QDGA 3CWTA 2X4TA 5ADPL 3OAUH 4S1RH 3L7EB 1ASOA 1AZNA 3HMXA 3Q43A 3SBWC 4MRCA 1AFVH 2OR9L 2YPKA 3CC5B 5F88A 4NXKA 4ELDA 4H8PA 2NNFA 5ALCL 5EU3A 2ERJB 1FP5A 2V2WA 3DTXA 4EJ1C 5D1XC 5DMIH 1KWGA 3MMEA 2PWDA 2VITA 4YO0A 3B2VH 1IJNA 1NGYA 4OD3L 4C56A 1JMXA 5E4IA 1X5FA 2XYCA 4PRDA 3FTVA 4I87A 4X80L 3H3BC 3W0WD 5IESL 2BNRA 1FFOA 1IQDA 2A6IB 3BP6A 2C4XA 3CFKA 3RKDC 1N19A 3V52L 3FTXA 5JMVD 2ZUQB 4UM8A 4GW5A 5B1CA 2Q3XA 1NGZB 1CD9B 4NN5B 2QLYA 4K8RL 1VACB 2WOYA 2WQRA 3ZHFA 3IGUA 3QZLA 1IKNC 4N6QA 4WGKA 1A3QA 1P53A 1EGJL 3QUZA 2E75C 4PJBE 1TQBC 4GLRI 4YFEA 4GMSL 2NCMA 4L05A 5JDSB 2P47B 2D3JA 2P5WD 4HJEA 1Q94A 3IU4H 5I8KL 2YK1L 3KPRE 3EYVA 5A3ID 5IT2H 4KK5C 4E68A 1NBQA 1A5FH 2XY1A 1S7VA 4L9LA 5DGRA 1SEBA 3CVHA 4WFFD 1KEGL 1GOFA 4MJ6B 2FD6L 2YEVB 1UVQB 4PQXA 4WWPA 2VABB 1JYVA 3FUKA 4WY7H 4O5LL 3MOAH 4KMTL 2AXWA 1ZJBA 4JFFA 5C07B 1P5DX 5KSAA 4D7PA 2ZG2A 3GRWL 1RK1B 4AXWA 4K7PY 5F44A 1R5VA 2V3EA 3QPXL 5F96L 2FIKA 2VDRH 1J86A 3LEVH 3SO3B 4NYLA 1I7ZA 3K5SA 4OZHF 2PTTA 3CSTA 3DV6B 2VMFA 2EH8H 3DX8B 4L4TA 4M9OA 1D6VL 3RY4A 5DJDB 4FCAA 4LQFL 4JFHD 1FFQA 1Y0LB 2ICWB 3H85A 5DEFA 4LL4A 4LRNH 4S1SL 2YRPA 4LBEB 2YUXA 3DPDA 1R33A 3D3VD 1FIEA 4YR6A 2CHDA 4XAWH 1QO3A 1L9NA 1JGDA 4PMEA 4N86A 4J23A 4OZ4B 4NAMA 3NMEA 1XIWA 4HOMA 1B2WH 3PCYA 4M5ZL 2A1WL 3NCFB 1U3HC 1DJZA 3CCHB 3QG6A 3NPZB 4DEPC 1P5GX 4HV8A 4TOYL 4U3SA 2H2SC 3VI3A 1MFBH 3HIZA 2H9GA 3KPLA 5EF1A 3BD5A 5T1MA 4LO9A 3AY4A 4L1LA 1ZT1B 5E94A 2CDFA 3QZWG 4L8BA 5G4MA 3NG5A 4RA3A 3CVSA 5LGJB 3VXOA 5SWZA 1UA7A 3KPQB 4WUUB 1DANT 2BM3A 3ARGC 4I5BB 3ZMEA 4CMHB 4EBQH 2BIOA 1LE5B 1NGWB 2GJ6E 1ND0A 3T77A 4Q7DA 1K5NA 2FJFB 4R7LA 4YIQA 1ZHNB 3RNQA 2XXGA 3WS6A 2KERA 1QNZH 4BKTC 3PWLB 3ULVF 5D7JC 4AH2A 3S5ZA 3MXWH 4P0DA 1F58L 2IC2A 2E4FA 2IG2H 3DOHA 1ZT4B 4OZIA 3KS0H 5TQ0L 4F8LA 1BZEA 1S7SA 2AJXL 1BJ1J 5GS1B 2BZCA 3H3PH 2XA8H 5C08B 1U8PB 4JDTL 5FHBH 3K46A 4XHJC 2QQNL 4CRPA 3CFEB 3S36X 3LKRB 4GW1A 3T6QC 1UOKA 4ICWA 3WFDH 2BDNH 3GI8L 3V9EA 3E9TA 1FRGH 3BZEB 2R29A 1R3HB 2Y9RT 4ZUTB 4IDJL 1QYGH 5AW7B 2AVFA 5D2NB 1Z5YD 3E7JA 4JQVC 4Q9RL 3GXDA 5H37A 2J55A 4GMTH 3CH1B 4MJHA 3JTTB 4Q74A 2O5XH 1HOEA 4OFKA 3ARXA 4HUMB 4EJYA 2Z0UA 4HULB 1TKWA 1V05A 2C3GA 2AV1B 3HHSB 1QBLL 15C8L 2HFFB 3HBQA 2D31A 3ZTJH 4UTAA 3Q8CA 5J11C 1BJMA 3BKYH 1S7TA 3K1DA 3L1EA 3L95B 4OBRA 3BZDA 4AM0Q 4FYSA 2VDPB 4LOFA 2MJ7A 2ATPB 1MN4A 4P5RA 5AEAA 1CXFA 2Z65C 4YLCA 5DK0A 1N0LA 1YEDB 2FZ3B 5DS8A 5IHZA 1CLYH 4HKJB 2P80A 4NO5A 3K6FA 4BQ6A 1OP9A 4A66A 1XQ4A 3GKWL 5DMKB 1NA8A 2B59A 4HH9B 5BV7H 5GXBB 5E5RB 5LQBH 1DQLH 2OL3H 2Y2YA 3EHBB 3FUIA 1HU8A 1YG9A 1KTBA 1WP6A 4PREA 4YHKL 1TNMA 3O81A 5JW4N 1TFPA 2NUPB 3FONB 3HG1D 1DUYA 4HWEL 5FUCE 3UZVA 1SVBA 4UDUA 1A47A 4HJJL 1QZ1A 2X4PA 4OJFH 4E41E 2X1PA 2ZP0T 2F54D 1ZTXL 3UDWC 1MPAL 3OBAA 1AQKH 1EUTA 4HS8L 3ZKMD 1BPVA 1OVZA 2WQUA 3PWVB 1X5KA 3OR6B 3ZDWA 3BHBA 4IEFB 3E8UH 3P77A 2J43A 1E9PA 4R3SA 5EOCH 2KQMA 3RPKA 4L8SA 4F5CA 1MVUB 2E3VA 1CQKA 1KPRA 3IETA 5IQOA 2Q76B 1K2DB 3CZLA 4Y89A 3QQ3A 2QSCL 2XWTA 5C2BH 2A2QT 2Z92B 4QTHB 5CEZE 4NQCD 5D96B 3K6NA 4MMXA 5HGAB 43CAA 3ARVA 5A2IH 4AYGA 2YGOA 4OD2A 4F24A 4HUWA 4NM8L 1HINL 1Q9LA 5FV1L 1E6JL 2VH5H 1I8LC 1JL8A 3KHQA 5INCB 2R9HD 1XX9C 3UFIA 5L2KD 4WI8A 2ZUVA 1EX0A 1JERA 2BIHA 3QNZB 2ZPKH 1VFAA 1MZYA 2DKDA 5I0YA 1GY2A 2E6PA 1JXJA 3RL2A 1NFDF 4HHAB 2EE6A 2EKJA 3KG5A 2AEPH 2A38A 4J3UA 1E9OA 5CN2A 1S9WB 1YNKL 2JJTC 4TULL 3IFLL 3TYGL 4KO6A 1UXWB 2BNQD 4F7PA 5LBGA 1QFPA 1EXHA 5HSFA 5F6IB 3PNWA 3MQIA 3UIZA 5IB4B 1EEYA 4N8VA 1WTGT 2I85A 4LCYA 4OF0A 4OCYL 1QN7A 4PRAB 5EU5B 1KLFA 3NCJH 2VL5A 2OJZL 4PW4A 1FYTD 5LGHL 2X4QA 1B3IA 1T1YA 3FOLB 3L3OA 2C1OA 2P5WB 3AUWB 3UJIH 3RIKA 3C04A 1KB9J 1T0PB 3SY0B 2UYLA 1OLZA 1QQDA 3DARA 3TO2B 1WCBA 3NFSL 1RU9L 3PP4L 1CGSL 1CDWA 2EXSA 1M3JA 1NMCC 4ZXBA 3UROR 3L9YA 5JORB 2OZ4A 3RE0A 3UCRA 4QF1B 3II3A 3T0BA 2QFPA 4DUVA 4I0PC 4BK4A 5DC4B 5EN3A 2AFNA 1JPTH 1GL4B 3L5IA 3KGTA 5F9WB 3QNXA 5EMYA 4HCRA 5H37G 4DKEL 2P46B 3G04B 2GUYA 4XP5H 4EI6A 5IMLA 4OQTA 2QJDA 1BZ7B 3DRTB 1VESA 1XF5A 3L3JB 5IMMB 1G0YR 4PBVC 3ZTNL 1L3WA 3WEOA 5L4FA 1KZQA 1RUKL 2DTML 5I9QB 5TPWH 1VTLE 3NJMA 5B8CB 4FMKA 4JZOA 3SDYH 2VDQB 2C3VA 3NEOA 1UCTA 1XZ0B 2XQBL 5ACZA 1A4JA 4AQ1B 3U30C 3QIWD 1UG9A 2N59A 2XZAL 3FSZA 3O11B 3O45B 4NENA 1A4CA 3D18A 5D71H 5I6OA 4EZMA 1CL7L 3MBEA 4ZSOA 4PB9H 4OJEH 2ZYIA 1IAOA 4HGWA 4PJDB 3M1CA 1DVZA 2AJ3A 2NY5C 2R2HA 5FUCC 3L5WB 1U8QB 1GOHA 4GW4B 1Q72H 4KROC 1S78D 5AW5B 4L8DA 1R3JA 3BUBA 3VE0A 1A1MB 1X9QA 5JXAH 4LSRL 3H9SD 3LZLA 3OZKA 4IMKA 4Y4KD 4PIBA 4OVUA 3C5JB 3P73B 4GBXD 3ZTDC 1D5RA 3TH3T 4FFVC 1CG9A 3Q2CA 2WLKA 2E9WA 4LESA 3WFBL 4PJAB 2QQQA 4LCWD 1A6VL 1PCXA 1NKGA 5C0DB 1MVYA 4RFNB 3PAZA 1H3GA 1Q9OA 3D52A 3MRDA 5IHHA 5HHME 5AYTA 1HVXA 3H2PA 1NKOA 3QPQC 4FNLL 1GYVA 4MBRA 1CDCA 3HN5A 1HHGB 3MLPA 2VN6A 3SE9L 5KBMA 2RBLA 4E9RA 1FPTH 5CGYD 5DI8B 3VJ6A 3TA4D 2D03H 3MA7B 5I71C 3U46B 3QJHB 1ED3B 3IEAA 1T22B 4WW2A 5E4AA 3MLZH 3Q5OA 4B60A 3ETSA 3FB7B 3ASWA 1CLZH 3GSQA 4S0HA 2WNWA 3D4GA 3M45A 4XX1E 4PJGF 2GB2A 2ZAGA 5CNHA 4PP2B 2UX6A 3U4BH 2WB1A 2TAAA 3S3JA 5DJXB 1NOFA 2J8UE 1S6NA 1OE2A 5F8RC 5FM4A 4KTGA 3B83A 4YUEL 4RRPA 4E36A 4TM9A 4HSCX 4NZRL 3EO0A 3GDCA 1OTTD 1MFEH 2HP4A 2PCYA 3EYOB 1G6RH 3OKNB 3HNVH 5HHPA 5JMRA 1KELL 1Z9OA 3IRPX 2ZKWA 4R5XA 5AKSA 1JUFB 3R8BB 3D39B 3CAFA 4C4KO 3D85D 3A4EA 3KPNB 2DWXA 1TFHA 3B9KA 5AZEH 5HDBF 1XTLA 1W9XA 3LQZA 4PWHA 4P23C 5DMGC 2VDKB 3HZMA 1HSBB 1CF8L 4DGVH 4DVBA 3CWSA 1R75A 3ML8A 1VZHA 1PNCA 1MJ7L 1YAIA 4W9DC 1WAEA 2C3XA 5DO8A 5EEWA 4ZPVB 1YPZF 2VQUA 4GAYA 4D0DB 3G6DL 5I8CB 5LWYL 1NANI 5DVMA 2BVQA 3EJCA 4KU1A 1PFCA 1WC7B 4JFOB 4KVNL 5LGYA 5JIKA 2AK1L 1IO4C 4J3BA 1PPIA 2H3XC 3D0VA 3G08A 3H9YA 5TH2B 5C3IA 4IJ3B 3AB0C 3MLXH 4ZTPL 4G43A 1TYRA 1QTPA 1VKXA 2Y1AA 4X8GA 2QV2A 4X7FC 4PRHE 4Q6IA 1BBDH 5DQJA 3U4EA 1H15B 3KWXA 1J1OL 4ELKB 5BZZA 3N1FC 1KCLA 3CC1A 3VGHA 2OQJB 5E8DL 1W0WA 3DBXB 3ZKND 4DKTA 1YNLH 3DRQB 4K2UH 4P8QA 4P4RA 2HTLC 2YGNA 2WQAA 4M00A 2DQUL 2F54B 3A47A 4J3VA 3VH8A 2I07A 1P6WA 5CMAB 3ABGA 4H0IA 4KBPA 1N9PA 5DLML 4U1HA 1UKSA 1KCWA 1TU2A 4NGHH 5IEKB 1A9EA 2JKWA 3UTTE 3BGMB 1ZEAH 3F7VA 5B1BB 3SQBA 2FJSA 1KXTA 1IEAB 4R96A 4NQCB 1Z5HA 1JIBA 1MHPL 4LEXH 2A74A 2X70B 2X53A 4WEBL 4X6CE 5DUPL 4UINL 5DD1L 3S3PA 5MENA 3MRGA 1MCBA 4UQBA 5L2KB 2OFQA 3ME0B 5AD0A 3MJGX 4KPHH 4G6MH 3N0AA 4LPVA 4AGPA 1IGJB 1UKQA 2X4RA 4RQQA 3ETBF 5ADPH 1ZXQA 2R1XA 4L3ED 1BA9A 4MHHG 3CUPA 1SRDA 1TTFA 2OR9H 2BP0B 2AQ1A 3BP7A 3HJEA 1FC2D 3ESPA 2X38A 2EKSB 2CLRA 5C0FB 2UY7A 2BCMA 3PJSA 4WTXA 5CF3A 5ALCH 2VC2L 2BNQB 2VN3A 4YFDB 2X3CA 1DO6A 1AQDA 1DQKA 3FSWA 3PDGA 1KOAA 2CZNA 3ZE2B 4OD3H 3MBWA 3HG4A 1LEIB 4G7RB 4IBSA 5GZOD 5DJZA 1AXTL 1NOLA 1FYTB 3V52H 5HYJA 2EYSA 3P2TA 1PLAA 2HVKB 4U1SB 5B39G 3SQOL 1NC2A 2Y23A 3CVDA 3NACL 4F15C 5I18L 5BJTB 1KIPA 4JFEA 2F1AA 4J3OH 2ICCA 1JCVA 2VLRE 3UTQA 3NGBB 2N4IA 3FQ4A 3T3MB 4G8FA 5IHWA 4N2EA 1S7WB 5CIPA 2IOOA 4XTRC 4RRPG 1KZYA 2FL5A 3D48R 3FRUA 3HS9A 4GMSH 5D7KD 1ZKAA 4IRJA 5JPMB 4TNWF 3O2DL 3IRCA 1A8ZA 2YK1H 5I8KH 3BQUC 1DCLA 4NJ9L 4BWTA 1DVFC 4GKSB 1R3KB 4PJXE 5GGRY 1KEGH 3F10A 1HNFA 3PRZA 3IMWA 2FD6H 2VR7A 4LSPL 5TFSH 4DQOH 4X6DE 1IGYB 3JWNH 5AVYB 3HB3C 2CU9A 1H9DA 1EHXA 1RHHA 2WYTA 3D51A 3PV6B 3C5ZD 2APSA 5F21B 1D7FA 1UGKA 5IROC 2JCCB 5EO9A 3W3BA 3GSXA 1KJVB 2EXTA 4O5LH 4EZLA 1WH0A 4KMTH 4NWTL 1F02I 2AXGA 1KIRA 1QFUL 2B3IA 1L0XA 5DJYB 1QHPA 2NOHA 1HOCB 2GYSA 2E59A 2VXTL 1SJHB 3QPXH 5F96H 2UVFA 3GM0A 5IOKA 3S3CB 4Y2DC 5CEZL 3DIDA 3MLYL 2XKSA 4Y5VA 4Z7UE 2PCFB 4FADA 2W0PA 1T2QL 4D8PB 3B8YA 4KKPA 1NCAL 1D6VH 4YSEA 3ZKXC 3O0RL 3BAXA 4FLRA 4LQFH 1ZGLB 3SY6A 1TO5A 5DHXB 1J5HA 4XPTL 3KLSA 1RZKH 3H9SB 3JSSA 1UB5B 3ZOAA 5B3SB 3FT1A 4MNQD 4Y4KB 3PHOA 2Z34A 3BAIA 3CZFB 1AKPA 3VH8G 4KY2A 4GBXB 1P84J 3F04A 4FG6C 1ZHBB 4XNUL 2HLAB 2IAMD 4M5ZH 2A1WH 3OL2A 4TVUA 4OFVA 2WV3A 5FGCB 4OF3A 3WJLC 5BZDB 1NLDL 1YMHB 1AIFA 4K9EL 3EFDL 4LCWB 1ZMYA 4YXKL 3TU6A 4TOYH 4OF5A 3EH2A 2O3OA 1MJUL 4XCNA 5L8LB 3QYMA 1OAZL 5D8JL 1TSRA 4JDZA 3B3BA 1SMAA 4BSWB 1K8IB 1MZZA 1RZIB 4LKXB 2JH2A 4ANKA 3GSNL 1DJWA 4OUUB 2EDFA 4YBQC 1EPFA 1W15A 1OWWA 4LLAA 3WU1A 1F3RB 3IXTB 5BMFL 2C9AA 2OR7A 4JN2B 3ZMNA 4BUGA 3HPJB 4FS0A 5HI3D 1UENA 3UJJL 4J3OD 5IEHB 2KMWA 5M7QA 1T21B 5FXCH 3VQMA 4QYOA 4ZMZA 3HG0A 4XVOA 1KBVA 3VXSE 4U7KA 4UI2A 4RSYA 1J7VR 3CQPA 4N20A 3K2MC 4BWUA 1F58H 1FL6B 2C9QA 1PBYA 2XRAL 4A38A 1KXVC 4U0RB 3OKMB 5TQ0H 3SBQA 4CBPA 4QHNB 4M7KL 2AJXH 4ZFGL 1CVSC 3U0TA 4P46A 1WICA 2X40A 5DSCA 5C09A 1JVKA 3LB6C 4JDTH 2CLVA 1NAKL 3KGRA 3ZE0F 4MAYA 3BP5B 1SJEA 3BQVA 3D85B 2EIZB 4AJ0A 1II4E 3FU3A 3KLAB 3HVDA 1CLVA 4UF7C 4DUXA 3U36A 1OTUC 4MB3A 4HWZB 3GI8H 3ZY7A 4XVSL 1C8QA 2J2ZB 1NM9A 1KFAL 4MZ3A 1QSVA 2NLJB 4YDNA 5HJGA 1CT8B 2JKSA 2X1WL 4G5ZL 3MPCA 1UA6L 2ARJB 2H32H 5IW1A 4FQXD 3MVSA 5T3ZH 3DUUB 4YSCA 3R8QA 4KOBA 4Y5YA 3GFUA 3RWHA 2QLVA 1VFOA 3EYSL 4WV1B 2V5YA 3QO0B 4X7CC 3GYRA 2BOBB 2G5RA 3LNHA 4Y4FD 2WCGA 1QBLH 15C8H 3M1BA 4DT2A 5IHUL 1HEZB 4B0MM 4WTWA 4NP9A 2R1WA 4NKMB 3GZOA 1IE5A 4UOW0 4MQSB 4OZFH 3WKML 2YHGA 3CFBA 3QWRA 3VXUE 2D7PA 3O3DB 3INUH 4JFQA 3DJ9A 3W11C 4PWJA 4ACTA 3HR5A 4RFEB 5EFIB 3K91A 4PG2A 5C0AA 1OALA 2LFEA 3GKWH 5I23A 1SHSA 2YMOA 2VO5A 1TENA 3ZDYB 1ZTMA 2D0FA 3LMJL 3IRZA 3WIFB 3QZMA 1JZFA 4YHKH 1MI5D 4WWKC 4HWEH 1I7RA 2HVJB 3V7MA 1LO4L 1MAKA 4WU5B 4HJJH 1AGDA 4KUCD 1CI3M 4JJ5A 1MCRA 4NKDA 1ZTXH 1AD9B 1MPAH 3P9LB 4HS8H 3OSMA 3WCYA 4RGMB 3N50A 1F86A 1CDUA 2BH0A 3FN0L 4KUZH 4NZDA 4PJ8C 3RPIB 4M5YL 1FLTX 1N2RB 4GQ9L 4M93C 4HD9A 2PP9A 3UTSB 3IDUA 2OSYA 2QSCH 4AEFA 3Q2VA 1HDMB 4FRWA 1U8MB 1S4IA 1XGQA 2EC8A 2NX5E 2DLGA 3DETC 2VWEE 2EDMA 5EBLB 1JXGA 3L4YA 1OGTA 4NM8H 1CE1L 4N8CL 1E6JH 1G7IA 4UQEA 4U1LA 2MQ3A 2FT8A 2OLDA 3P1VA 2WC7A 1HHHB 4U1IA 2D73A 2XPGB 5DHMC 1MFDL 4QLRA 4LLVB 4M8RA 4HKBA 1C5CL 4WHTB 4C56E 3LEXA 1DLFL 2YA1A 4JEGB 3QDMD 2P8PA 3CX5J 4FQLL 4QHLB 4KJPC 1CZ8L 2BNRE 4U1KB 1YNKH 1R4XA 4TULH 3IFLH 3Q2LA 1J8KA 3IDJA 3WSQL 2P3YA 4ETYA 5HVHB 3RZCC 2D0GA 5A2LH 2ZSVB 3SZKC 4OFPA 1Z9PA 3BOVA 3TO4A 2ZUYA 4QRBA 2PTVA 1EZVY 1HQRB 2A9CA 2VGLM 1FN4B 4OCYH 4N0YL 5T3ZD 2OMYA 4PY7B 3WNOA 2OJZH 2ZX7A 5LGHH 5GS0L 2AXHA 4HC1H 2AJZB 1E27A 4J8QA 3L8QA 5C0EB 3L9EA 5KL0A 3F85A 1I7UA 3VRJA 5GSVA 1M05A 3NFSH 1RU9H 1PJWA 1CGSH 3PP4H 4JX0A 4IHOB 3V0FA 2H26B 3DX6B 1IFHL 4RDQG 3HHRB 1WT5C 3C5ZB 3FQNB 5GSRA 2X6AA 4MX7A 3FU7A 4OKVA 2F53A 1S8DB 5DYOB 3ECUA 4NHUB 3VWKD 2EEAA 3KLHC 2K4WA 3DC0A 4KXDA 4DKEH 4JFFE 1X5ZA 1E4XI 2IBZY 2W94A 4XOBA 3IJYB 4HK0A 3FTYA 3ULUH 1RUQL 4Z7VF 1DN0B 3ZTNH 2M83A 3L5HA 3Q3GA 3QRLA 4F7CA 4NRXB 1RUKH 1XBDA 4JVUA 4YHPB 3MREA 3MDJA 3U9PL 5E08H 3DIFA 4ORGB 3I3DA 2QELA 3BDYL 4ANVA 1UACL 2A4EA 2YAHA 4L4TE 4OLVL 4AENA 2YJLA 3D4CA 2F68X 3QULB 2GK2A 4Y4HD 2XZAH 3VGEA 2RFXA 5F3HA 5G5DB 3QEUA 1CL7H 3C6LA 5I6LA 5GRVL 1XGUA 4H25B 4MNQB 3L1GA 4XRCB 3RB7A 3AQYA 3VX1A 5DJ8A 2MNJB 3QXTA 4LKCB 3V4VA 3OB8A 3JYCA 5A16A 2IAMB 4JM2A 1NCHA 3SGJC 4JAMB 1JPFB 5BRQA 2DQTL 2PO6A 4N22A 2WNXA 4LSRH 1U8NA 3AMLA 3UBFA 3VI3E 5I2IA 3BP4A 3PGFL 4QRPD 1YCSA 2J1ZA 4GRWE 1PG7W 2W5PA 2GBVA 3U2IA 4FKHA 1QA9A 4XNDA 1BM3L 2M1KA 5SWZE 2UVEA 3OZLA 4Z7QB 3WFBH 1NJ9A 3RVXC 3WUZA 4PGBB 1U6AL 1OZUA 4MCYA 1OP3H 2BIPA 2VWEC 1A6VH 5JIIA 3N1PC 2MHAA 4JK0D 1HXMA 1MFMA 4TUOA 4GS7B 1U8CB 2CKBH 4F8NA 3D34A 4P5TD 4CGUB 1QSED 3EJQA 3HC3L 2KZWA 4FNLH 2WLLB 1YDPB 5T1JA 2XIIA 3SE9H 1QBAA 1YN6B 4O2EA 4ODTL 3ZHNA 3FFOA 3TURA 2UZXB 3BO8A 3FT2A 4PGEB 4HSQA 4DPBX 3RWDB 2D9QB 1IC1A 5JYLA 3LEYL 1ZA3B 4G1EA 5E9AA 3Q1EA 4XNMB 2IDUA 3WTSA 1HKLL 2WBJA 1QSFD 2ZXQA 4JO5A 4YSQA 3RVVD 4NQUA 1CLOL 1HCZA 4PLNC 5DGQA 1F45A 2GBAA 3H2QA 5C0IB 4PWFA 1H3UA 3IH7A 4PW9A 2BVPB 3QA3B 2NY4D 4UBDD 3WLBA 3QUZC 3G5XB 1GZQB 4F9PA 2WXMA 2NXYC 3FUEA 4YUEH 4NZRH 4FG4A 1JZEA 3GXTA 3RU8L 4F27A 1M2OA 4HOWA 3ARBA 1UB6A 4NM4L 3BKML 4WI7A 5E9DA 4JPIA 5JXED 1KELH 1RERA 4HDIA 3LRSA 4FQXB 3ULUD 2FH8A 5AZUA 3S5LA 1ET7A 4WFED 3QC5X 2R15A 3UAFA 3VXRD 2AJYL 4NC1E 5AB9A 3ULVD 1CF8H 4C55A 1OAKL 1MJ7H 1NPJA 2GI0A 4Y4FB 5F1OB 4M6AA 1FNFA 1UA3A 2DQDL 3TA3A 1QRND 2V33A 2UZYA 3G6DH 4F2FA 4JDVB 1MDTA 1U8LA 1E2VA 5LWYH 2Y1VA 3QEHA 5KSAC 2APXA 4L2YA 5I1IH 2EDHA 4AGQA 3B5TA 4Q89A 2Y6SD 4JRWA 2NY3C 4KVNH 4Z18A 3CU1A 1JYNA 4BCZA 2NTFA 1X5HA 1JZHA 3D2TA 1D3UA 2NSXA 2ZXEB 2RGSA 3BPOC 3VDCA 1N3CA 4ZTPH 1UFGA 3CPLB 3DV4B 3RFZB 1V7ML 3WY4A 3J27A 3P11L 1J1OH 4UT6A 1MJ8L 3MNZA 1T6AA 3KW8A 2OJEB 3B6SB 5E8DH 2B3RA 3WE6B 5ECGA 4P04A 2GABA 4HU2A 2DQUH 3HW7A 2V9JA 4ZUWA 3VWJC 4DOHE 3E3QE 3M1OA 1MWOA 3LPPA 4LLYB 1XIWC 1ZVNA 4HIIB 4DP4X 2FX7L 4ALAC 4GUPB 1YJDL 4PP1D 4F5CE 5DLMH 3IVKB 5L4MA 1DUZB 1AMYA 2A0LC 2EJ1A 3U6XS 5I73C 2YC1B 4JRXA 4WNQB 1A6ZA 4YDJA 3AY4C 2Y1ZA 4M8UA 4XWGL 1VADA 2OMWA 5INDA 1MHPH 3DHMA 4WEBH 3PQYA 4LOUC 4KNQA 1BWWA 4GP5B 4PTUB 4W4OA 5DD1H 4LDCA 5DUPH 4KJQC 1OV8A 3BGFC 3M46A 3E0GA 4YGVA 1HL5A 1EAJA 3MX0B 1IC5H 5T1KD 1ES0B 1NDGA 1YVLA 3AC0A 1IC7L 3WUWB 1GCFA 4XCEA 2IWEA 3AG3B 3QDMB 4R4BB 1NAMB 3L7EA 3WS6C 5CS7A 1BMZA 2AVGA 3Q2NA 4UAHA 2DM7A 3VUAA 2IGFL 3CC5A 4MKTA 2VC2H 3ZO9A 3TBBA 3LZQA 3U1PA 4B50A 3GBML 4FJ6A 4NQED 5AVUB 3SPVB 4BQBA 3QRBA 3T3PB 5GGVY 2YS4A 1AXTH 3MRLB 4Y7MA 1YYLL 1PZAA 4PS3A 5C92A 1XSKA 3SQOH 5EPCA 3FZUC 1TBPA 1EBMA 3NACH 2A6IA 3WGUB 5I18H 4U05A 3KGSA 1A4KB 4KXBA 3KEDA 3VB9A 1OP5K 4RX4A 4WTZA 1NGZA 3LZFL 2OA9A 1VACA 3RILA 3DUHA 4OZFB 1TTAA 4NKQB 1YZZA 2XWEA 4N1HB 3TV8A 4LPXA 2CJTA 1DBJL 3O2DH 3OF6D 3GLEA 1MIEL 4NJ9H 3VWKB 3IDXL 5DJAB 4NC1C 5I1DB 2EXYC 2FAUA 3S5LG 2DL2A 4XBGB 4LSPH 5BPPA 5D7HA 4EUPH 2XVLA 3F6IA 3OQRA 1YQRA 4MJ6A 3G5WA 1FUNA 1C9BB 2WO2B 1UVQA 1SDYA 4BCXA 4X8CA 2K8MA 2IQAB 2NR6D 1FNGB 1BQLL 2VABA 3MV9D 2ADYA 4ROEB 2FEEI 3FCGA 4GYBA 3LDBC 1QFUH 2OAAA 4OCXH 2PWWA 4YWGL 3QJZA 4TQPA 2IDFA 2QSVA 3HZVB 4Y4HB 2GJ6D 2VXTH 5C07A 3W9DB 2E74C 4YHZL 4M7JL 4MCMA 1RK1A 4CDHA 4QCIB 2G0LA 4Y1SA 5CEZH 3QDJD 4ZSOE 1MW3A 3MLYH 3MSPA 2XA3A 3W82A 5JA8B 1BEYL 4X5QA 2UY6B 1NIBA 3HMXL 5FF6B 1X9LA 3OHXC 3F7LA 1OTSC 1T2QH 1T7YA 1S9KC 1FDLL 3TH2T 1NCAH 1WTLA 2YFNA 4PJIF 3DV6A 3O0RH 1C1EL 3DX8A 4HWBL 2LFGA 2L4OA 3E3QC 5D5MB 3AITA 5DJDA 4JRFA 5JNYB 2JIXD 3LD8C 4XPTH 1Y0LA 5C0ND 2ICWA 1A65A 4HK3N 3D09A 4LBEA 4L8SC 4MJJA 2EC9T 4N0FB 3OHMB 4TKWA 2VQ4A 5AN4A 2DM2A 2E7CA 4Z6AT 2ZUTA 2A6JB 3SHSA 4BH7B 4XNUH 4BQ8A 4KXZH 4Y1AD 5HHXL 2MQCA 4OZ4A 3PL6B 2ZX8A 1CFNA 1M2VB 1NLDH 4OZHB 4P3CL 5CSZB 2C9XA 4K9EH 1MOEA 3EFDH 4MMXC 2FHCA 4YXKH 4FNQA 5IY5B 3CCHA 2GJZB 1MJUH 1OAZH 2G0KA 2Z3FA 4FFYL 4LLDA 4P5TB 2WBXA 2NZ9D 1QSEB 3FRPB 4O00A 5D8JH 3FBQA 4MB4A 5CKGA 1LWVA 1U2CA 5E9NA 3D25A 1HEHC 3G6AB 1ZT1A 2WVUA 1A3LL 3GSNH 1N8ZB 1IAKB 5LGJA 4IKNA 3DXAE 4J7RA 1PY0A 5CN3A 3CVHL 3KPQA 4WUUA 4YZFE 3UG3A 5BMFH 2DS4A 1J0HA 3IMRA 3UJJH 4F33B 1PJ9A 1YTBA 1LE5A 1NGWA 2EO7A 1QSFB 2P1YA 4HPYL 3EYQD 4O02B 4WO4D 1OANA 2FJFA 2GG1A 1ZHNA 4PGDB 3Q44A 5E2VL 4NZJA 4Z0XB 1I3RA 2D2OA 3DMMD 5IZ7A 3PWLA 1NGQL 2NY1C 1E5AA 2XRAH 2ZSWB 5F93C 4TNEA 2QMKA 3L3OC 4AQZA 4M7KH 2VYRE 4UM9D 1LDSA 1JZGA 4ZFGH 3KPPB 4PTTB 1TQVA 3ZQ9A 1SY6A 1MLCB 1OL0A 4Z76B 1E8ZA 1NAKH 3EJSA 3QGVA 4P9HC 5GS1A 3UIYA 4WXAA 3OKYA 2Z1PA 4ZXBC 4FQIL 5C08A 1U8PA 1RZ7H 3STZB 1PCMX 3B7TA 2DJSA 3VXRB 1KT2A 3CFEA 3ORJA 4MD5B 4N0RA 3LKRA 4PWEA 4XVSH 4U6YB 3LHAA 3QHFL 1KFAH 3EAYA 3PXJA 4G5ZH 1UA6H 3GGWB 1OAJA 3OPUA 4PJ7F 1QRNB 3S34L 4BIKA 3BZEA 1ILSA 1CK0L 1TTCA 4ZUTA 2AAVA 5HVFB 3QJQB 2L04A 5D2NA 4JQXA 3GBEA 4CJ0A 5CEZD 3EYSH 2WYHA 3CH1A 1NPNA 4FKKA 3WKNA 4M29A 3JTTA 1Z9MA 3BWAA 3MUGB 3CBRA 4N6RB 3WTYA 4LE8A 4AK2A 4JKLA 2AV1A 3WFEL 3HHSA 2HFFA 1PD0A 2YRBA 4Q58C 3WKMH 1UUNA 4EXPX 4DP2X 5L0QC 3L95A 1MELA 3B7RL 3MJ9A 4G1MB 4AYFB 2ATPA 3MBEC 4GKOA 5B7EA 3ZUNC 1GMIA 1UWEH 3T0DA 1SMOA 3QJRB 1OCWL 3CTTA 5L8JB 1YEDA 2FZ3A 3NIGE 4HKJA 2NLVA 5JHDD 3IS1X 3LS4L 5DMKA 4XMTA 2UUDK 4HH9A 2W9LA 3BDXA 2CO2A 4JG1L 4AC2A 3H8NA 2CKBB 1WZMA 1D7CA 2YEQA 4IMKC 1QPPA 1LO4H 2BOLA 43C9B 3H9ZA 3SCMC 2NUPA 3FONA 2K9UA 1BZ9B 1XZWA 3BPNC 5EF2A 2D3LA 4O51A 2FATL 5IREA 5MENE 3FN0H 3PWVA 4MQXD 2H45A 1BAFL 2KS0A 4M5YH 4GFXA 3OR6A 3OV6A 4GQ9H 4IEFA 4N8PA 4TPRL 4CKVX 4UTBA 5D6DA 5CP3A 1MVUA 5K5YA 4LMQI 5T1KB 2Q76A 4W9CC 1K2DA 3JUYA 3Q6FB 3I02B 3UERA 2HT4D 2YQ2A 4X0NA 3RTQD 3C2AL 2Z92A 3CZEA 4QTHA 1M6UA 5C3LD 1CE1H 1RSYA 3L3GB 4N8CH 4IK6A 4YNYB 5HGAA 3CFIC 4ADGA 4ZO6A 2D3VA 3PHAA 5INCA 3TPKA 3ZJAA 1FL5B 3QJFB 1G9NL 3F05A 4GFTB 4HA1A 2D7OA 1MFDH 1L0YA 4WW2C 4XVJL 2H1PL 4NQEB 3V5KB 1C5CH 3QNZA 3ASMA 4B9KC 2LR4A 1DLFH 1OD7A 3PV7A 1MCIA 4M1GL 4FKEA 1XH3B 4FQLH 5A2KH 4YE0A 1JN6B 1CZ8H 5D1ZI 4Z3HA 5L8KB 4HHAA 1XL6A 2ZYSA 3W0WA 1A14L 2FQFA 4HCFA 3WSQH 1S9WA 5J57B 4R26L 1E30A 2V4LA 1K3ZA 4QYAA 1EDYA 4TMPA 5A40E 4JFEE 2P43B 2GSMB 5GRVK 1UXWA 4DKFL 1ZLSL 5CUSL 1WBXB 1FZJB 2W0FB 1U91A 5ICYB 1NICA 2UUDH 4BDVB 2ZX9A 5IB4A 4AI7A 4RGNB 2EEXA 5GS0H 4PRAA 4CADB 5EU5A 3DOSB 4AUJA 1T20B 4JPKL 1Z5LB 3IXAA 4FULA 4X9HA 3FOLA 2X9ZA 3TXAA 2P5WA 4QR7A 1HESA 1XSOA 2DJMA 4JRLA 5H94B 3KXFB 4JMNA 3FUHA 3QR2A 1UH3A 3TO2A 1IFHH 1LK3L 3K8LA 2GBUA 1KCSL 2WMPB 4NO2B 4G6AC 5JORA 5L9DH 1W8OA 3QG7H 4A2DA 4QF1A 3VFSB 1X9UA 2GSGB 4DP1X 5IQ7H 2ILLA 3MV9B 1M3QA 4YHOL 5DHVH 4QRFA 4YHYC 2XI9A 4QHUB 2K9FB 4FA6A 5JLZB 4BRVA 3AS2A 1MCFA 2BWIA 5HHMD 1RUQH 3G04A 3L48A 1I3VA 1MCWM 2WGXA 2X4OA 2H0EA 5E03A 4Q6IC 1BZ7A 3L3JA 3MV7D 4AMXA 2ICWJ 5IMMA 4FI8A 3U9PH 3QDJB 3OM3B 1X7TA 4HUVA 5KAQF 1BQUA 3BDYH 1UACH 4EQ3A 5B8CA 5HHQB 4OLVH 5K1NA 4ZX6A 3NJNA 1T04B 1XZ0A 2CBPA 1NC4B 4AQ1A 3QQ4A 4AYSA 2Z6FA 2CR3A 3GXPA 3O11A 2DI7A 3O45A 3D3VA 2I26N 1HZHL 1PDKB 4A2GA 4H5SB 1WS7A 1N68A 2NUTB 4PJDA 4Y1AB 4LVEA 3HS0B 2GC4C 1YAZA 2FWOB 1U8QA 3L5WA 4GW4A 2DQTH 2L3BA 3WFHB 1ZDSA 4FL4B 4PRPE 2A74C 2PWGA 2VAAB 1Q9KB 3MNVB 2CPUA 3PGFH 4XE0A 1A1MA 5HXMA 3VD1A 2J57A 3C5JA 3P73A 4XPBL 4TNFA 3NPSB 1BM3H 2DWDB 4BSVB 2ZQKA 1U6AH 5D4JA 1AACA 1MJJB 3L4VA 1AISA 2NT0A 4P9HL 1GGTA 4PJAA 3LRGA 1ZV9A 1KC5L 2OZ4L 1BVNP 3UZQA 4DN4L 2XWBB 3HC3H 3H0TB 4WO4B 2DF3A 4P9ML 3ARDC 3SDAC 4ODTH 1HHGA 3BLKA 2Z9TA 2FECI 5CWSB 4I3GA 5GS0D 4HCRL 4XO9A 2BERA 3DMMB 3RIFK 1BFSA 1U3YA 2E8YA 3TASA 1GXEA 3AJ7A 1AO7B 4TNGA 1DSYA 3MA7A 3LEYH 3U46A 3QJHA 5IMKB 1ED3A 1T22A 1HKLH 4UM9B 1BFTA 4KTEL 4PVNA 4TS6A 4AUUA 3QBTB 5C09E 1CLOH 1GHFL 1UXSA 2WXIA 4AIZB 1EAPB 2L0DA 4PP2A 2C4FT 5DZAA 1JF5A 3DSFL 2HFTA 1TMQA 3EZJB 1OB0A 1G7PB 5DJXA 4OT1L 2VN4A 4TTDD 4IRJC 5EF0A 3GTVA 3RU8H 1VPOH 1HJBC 4NM4H 4K73A 2VJ8A 5ANMB 1IL1B 2O6PA 3EYOA 3OKNA 1U42A 3C08L 3DWTA 3QUXB 5CU5A 1Y07A 3UTTD 4OFQA 5J1AB 1RP9A 2X9YA 1JUFA 1R47A 3D39A 2AJSL 1A4AA 2D7TL 4POZC 1NCCL 1NIEA 1IZKA 3D0LB 3ISWA 2AJYH 3KPNA 1WF5A 25C8L 2WAQA 2A9ML 1TPXB 4KK6C 4V1DD 1OAKH 3N91A 4KKBD 2GTQA 4KO7A 1HSBA 3C2SA 2ZG3A 2WWMD 1DJGA 1TUOA 2DQDH 1GGUA 2E27L 2YXFA 2VQ1B 4DPCX 2M26A 1N3NB 2LLNA 2Z7YA 4JPQA 4ZPVA 4Y5XB 4D0DA 5I8CA 2YLHA 3OCIA 5F9OL 3GSVB 3BX7C 4L37B 4JFOA 4ZMTA 1Z66A 2I9LB 4H8WC 4APQB 5HDBB 5C0AE 4G6KL 5AVSB 4N9GB 1YNTF 3VFRB 1L9MA 4BZ2A 1RK7A 3IDYC 1Z0NA 2FT7A 3CZGA 3OAWA 5TH2A 3OR7B 5CSGA 3AWEA 2AC0A 1V7MH 2XN0A 5DUJA 4OTXL 3HKZA 5JHDB 3P11H 3AM8A 1MJ8H 1PEZA 4ZMOA 4WSKA 3BWSA 2YD0A 1QLEB 1YPZB 3RA7L 4ELKA 1PLGL 2ID5A 1G43A 3CVTA 4QJ4B 2Y3AA 1CD8A 4BE6A 2OQJA 3DBXA 1JV2B 3FCTB 3DRQA 4KRNA 4B0MB 5GIRB 3LH8A 1XB8A 1F3JB 2EDEA 1BX2B 4LLMB 4JJOA 4A7QA 1ETJA 2F54A 4ZZFA 2FX7H 4UAOB 1YJDH 2AI0L 3LZNA 4JHBA 4DEUA 4LQ1A 4P2OD 1A0QL 5CMAA 3V4PL 1UM6L 4F1ZA 2K7QA 4XO5A 5IB1B 5IEKA 2NOZA 3A5VA 5KG9B 2VSMB 1NUNB 3WLWD 3BGMA 3RTQB 4FFWD 1IEAA 4NJAL 4NQCA 4EQ2A 3G3LA 2X70A 4HZ1A 3ULSB 1U58B 5I8EB 3VFOB 3KVPA 5FR3A 5L2KA 1CFQB 2CWRA 3ME0A 3L3DB 5KYYB 1IC7H 1QUNB 1CDGA 2WNGA 1IGJA 3ESMA 3IBEA 4Y7OC 1KDJA 3VXQB 4FDWA 1Z9NA 1BJ1H 1N5AB 1V3LA 3NA4A 2BP0A 1QRKA 3HE6D 2IGFH 3NIFE 1RH8A 5LBVA 3MLWL 5C0FA 3CZKA 2KL6A 4D9QE 3GBMH 1KV7A 2ZXDA 3UADA 4H88L 4D3CL 2BNQA 3RX7A 5CBEB 1JDAA 3IT8D 3JWOL 4GKLA 4JPSA 4ODXB 1PVSA 2QRCA 2O61B 3F7QA 4P46C 2ALWA 1XCWA 3NESA 1YYLH 2G30A 4G2AA 2HFGL 1LEIA 4MAYC 3V6FB 4O58L 1JWSB 1FYTA 1VERA 2EIKB 1BYPA 2HVKA 2GJRA 2JKJA 3II1A 3EJZC 4U1SA 2HKPA 5EA0L 4JFPB 2O5NA 2IALB 3QEGL 5BJTA 3LNIA 3LZFH 3UMTA 3LNGA 4I18B 3ERXA 1GKEA 3O0LA 1QR4A 5ILTL 2GHZA 4PY8J 1S7WA 3P4MB 2PCPB 1DBJH 5AVVB 2YGPA 3GT6A 3NZUA 3HJ0A 2F53E 2PF6A 1MIEH 4Y5YC 3IDXH 5JPMA 2V9UA 4PRIB 1F97A 4GKSA 1R3KA 3FC8A 2V37A 3EO9L 2EACA 1MY7A 2CO6B 4E9YA 4GG8A 1IGYA 4L1HA 1H6FA 4RCAA 3MV7B 4OIBA 4K07A 3PV6A 3K6SB 5B38B 1BQLH 4OI7A 2JCCA 3FO0L 5CJXC 4XMWA 1KJVA 2Y22A 3LH2L 2CRYA 2WXFA 4YWGH 4PG2C 2B2XL 3WMPA 4AYBA 1P7BA 1BVKB 1UWXK 5DRNB 5DJYA 4YHZH 4PBXA 5C0GB 3FU9A 3ZDXB 3PJNA 4M7JH 5FHAL 5GZND 3RKPA 3AG4B 1HOCA 2XX1A 1PZ3A 1J8SA 1SJHA 1VGEL 1KB9K 2JE8A 4JR9H 1BEYH 3PG2A 3HMXH 4QHKI 4CU6A 1WFUA 5BMPA 1FDLH 2PCFA 4QJ5B 1QNBA 1F4HA 3HZYB 4BKLB 2Y5EA 4QXVA 1C1EH 4HWBH 1N12A 4D8PA 4YOKA 4IU3B 4TQEH 1ZGLA 5D7IF 4ZS6C 2YMTA 5DR5L 5L7XL 1EEUA 3HHMA 2XXMB 3A21A 3L7FA 3WAJA 2JK5B 4QG5A 1AP2B 3H9SA 2FWUA 1UB5A 1PAMA 5A2BA 4Y4KA 4DGIL 2DEYX 4LLQB 1GGYA 2W60B 3CZFA 3FT0A 2WSKA 4GBXA 3OKKB 4NNYB 5HHXH 1JK8B 1ZHBA 1DBKL 2CE6A 4P3CH 1QHQA 2HLAA 2WBWB 1ZLVK 1J8HD 1HI6B 2X10A 5BZDA 4CC0A 5B3JF 2AK4D 1YMHA 1H5BB 4PFEA 5E7FA 5ABDE 4LCWA 3ECVA 4JBSA 2P45B 2JPIA 1MWAB 4FFYH 5T33H 2B77A 3SD2A 3GXUB 2EEBA 1QASA 2EXWC 4YN3A 1A3LH 1VCAA 4BSWA 4N5ED 1K8IA 1RZIA 4J3TA 4LKXA 2C34A 5BZWB 4K9JA 2GSIB 4OUUA 5T1DL 2YOAA 3IAGC 4UNUA 3OX8B 4NN6B 5DZOA 3CZNA 1Q8MA 3IXTA 5IOPB 3IPFA 1TZOA 2Y5QA 3VXUD 1B0RB 3NSJA 4JN2A 3HPJA 1F1GA 1I1FB 2YQ3A 3TO4C 5IEHA 1EZSA 2IOIA 4LK4A 1H6UA 1T21A 4XBEL 5E2VH 1BZ8A 2OCJA 3O8XD 1N39A 2UWEB 4KRPD 1NGQH 2E9BA 1UCBL 4UNTA 4CN1A 5AVXB 3H7BB 2VUYA 4UV7L 1QHOA 1FL6A 2AQPA 1BXUA 3WO4C 3OKMA 5E9DE 5I1KL 1KJ3L 4QHNA 2FEDD 4H8WL 1AHWB 1RJZB 1KTJA 4ZDHB 4FQIH 3ZT6A 4LLWA 3BP5A 3D85A 2EIZA 2CK2A 2UXFA 1AZZC 3KLAA 3US0A 3OLPA 4G9DB 3ARYA 3QHFH 4V1DB 5FFOA 4HWZA 1JDDA 4PJEF 4D0CB 3KM2A 2ZCZA 1E28B 2J2ZA 4WJ5B 1KYAA 3S34H 1JZ7A 7PCYA 2W59A 2CCVA 1CT8A 2GI7A 3WN5C 1CK0H 1TTBA 3RVUD 4GPVA 2ARJA 3GB7A 2F7PA 3DUUA 5E6UB 1BF2A 4MDJB 4WFHE 5JHBA 3KBPA 2NX5D 4UOJA 5B1JA 1QI4A 4B27A 2IFFL 4WW1B 4WV1A 3QO0A 3CZSA 4EJZA 2BOBA 1FNAA 4LGPB 3WFEH 2X6MA 4PBDA 4GRWH 1HEZA 4I9XA 2PPAA 1SMDA 5E1QA 5DTFB 4EAKA 2OSXA 4LNRB 1T7WA 3UBXB 5IHLB 4KWUA 3T65B 4C56D 1IGCH 3SDDB 2IF7A 1QTSA 3BAEL 3C6LC 3O3DA 3RVWC 2BNRD 2MOVA 4XI5C 5EZJB 5EFIA 4RFEA 4ZZKA 1HCYA 1OCWH 1JXKA 4Z23A 2W80C 2XVKA 3LS4H 3D9AL 4JM2C 3TF4A 4LSVL 4P2OB 2PO6C 4TNVF 2WLMA 2VL4A 4ZUUB 3WIFA 4LRIA 5DUML 1KIQB 4KX7A 4JRXE 4K3DL 4W6WB 4U3CA 4GUCA 1FNSL 2HVJA 1Y6MR 2JQZA 3WE1A 2A3TA 3PQYE 1AD9A 5EBMB 3P9LA 2FATH 2ISDA 5HYQB 2MWCA 1BAFH 3LSOB 5KS9F 4E9XA 1NBCA 4TPRH 1E42A 1JGLL 3RURA 3RPIA 4U4BA 2VMJA 1N2RA 4HS6B 3UTSA 2LTQC 1C12B 1IBFA 4W9LC 2FHFA 3A67L 4BWWA 3NIDF 3ETTA 5I1AB 4FA8A 3C2AH 5AW4B 3QUGA 5JUEL 1JGVL 1U8MA 4I77L 5EBLA 3GBNL 3U25A 3FFCD 3HE6B 3QAZB 1N6UA 1G9NH 1JI2A 3L2MA 3K2UL 4OLZL 4XVJH 5H37H 2ITFA 2EYRB 1HHHA 2H1PH 3QQ9D 2NY0C 4HUXB 1KB5B 2XPGA 1PLCA 4KK9C 4QHMB 3VG9B 3VXMD 4LLVA 4M1GH 4WHTA 1DR9A 3CXDL 5IBLC 2ATKB 1CGYA 3QJVB 4HH8A 4LL9A 4QHLA 5E6ZA 5GZOA 1A14H 3PGCB 4OCLC 4U1KA 4R26H 2HCZX 4F9PC 2G4GA 4DKFH 4QPEA 4XNQB 1ZLSH 5CUSH 5DFVC 1HZLA 2ZSVA 1BXVA 2ZXBA 3RVTD 3Q8BA 2HZSA 1B6UA 1HQRA 3B4NA 1FN4A 2JQMA 2O93L 4PY7A 4JPKH 4PLJD 2WZPA 1YYCA 4MVBC 1QACA 5D9SB 1V8HA 4AK1A 4B9JA 2AJZA 4G6JH 5KYXB 5C0EA 2XJLA 2PYED 5DFTA 1A2YB 3EJYC 1J88A 4X6CF 2PR4L 2YKLL 4XMVA 1LK3H 5I1HL 5CM1A 4IHOA 3GMQB 3TA3C 2H26A 3DX6A 1KCSH 5AAWA 5I6NA 1TIUA 3I9AA 4XB7A 2VIRB 2VR4A 3C5ZA 3FQNA 3NJJA 3OH9A 4YHOH 3GRBA 5LB1A 3VXNB 3B2DC 5I5MA 1S8DA 4IW4C 5DYOA 4NHUA 3HI6L 4HJSA 1Y6NR 3WXVL 5K9KB 4ZMPA 5C07E 3RY6A 2Q3AA 3IJYA 2O5YL 1Z9SA 1T5WB 3T09A 1DN0A 3THML 1UOLA 4ANUA 2AQ3A 4NRXA 4XBMA 4YHPA 3L17A 2Y24A 1P5VB 2BCKA 2HT3C 4ORGA 4YBLB 1UM4L 4G80B 3JV6B 3F12B 2X0WA 3QULA 4F8TA 1MPGA 5G5DA 1CTOA 2IADB 2J4WH 2ZUSA 2R2CA 4R7NA 1SGKA 2J56A 1CCZA 4Z7VB 1HZHH 4H25A 4K3HA 4MNQA 4XRCA 2OMUB 4IRZA 1UWFA 5FYLD 3GMPB 1N64L 1Z7JA 3Q6GH 4R9HA 2DOCA 4HAKA 4LKCA 5F7YC 4FFTA 3V0EA 4B96A 2IAMA 2WQ8A 1J8HB 1AOZA 4JAMA 1JPFA 4X4YB 2AK4B 1F2XK 2DIEA 2ITCB 4WCYL 1BVLB 4PJXF 3AREB 3NCXA 4JVWA 3L45A 4XPBH 4X6DF 2XZQH 5E6SB 3R06B 3FCSB 1VFBB 5IB2B 2BZ7A 3K1KC 4FHBD 4P9HH 2BNUB 4WUUE 4PGBA 3L54A 1KC5H 2OZ4H 1BFVL 4ZX5A 1IVTA 4DN4H 1NCTA 1U8CA 5KANI 4ESKA 3MJ6A 4OCWL 1PMYA 1KIUB 2ERJC 4P9MH 3JV0A 2WLLA 1YDPA 1CLCA 2OBGA 1YN6A 4HCRH 3COOA 4KRPB 3WAKA 2B0SL 4FE9A 1K4DB 2UZXA 3FB8B 1LXTA 4PGEA 3RWDA 4MAUH 2J5LC 4F3FB 1XGYL 4KTEH 1ZA3A 3DI3B 4XNMA 4B5ZA 4GXFA 1GHFH 2AV7B 2DMCA 3TP4A 4IOFC 1EK3A 3ARUA 2LW3A 4NN5C 4UNIA 2R0ZL 1GMEA 5FB8A 5C08E 3AWFA 3RHWK 2IXQB 4JO8A 5C0IA 3DSFH 5ANHA 2DKAA 4HZAA 2BVPA 3O9WD 3QA3A 3CHQA 5IK3B 3G5XA 4OT1H 1GZQA 3OGCB 1D9KB 5LCVL 2W65B 4YC2B 3KJ4B 2F7RA 4YDKL 4U1NB 5ES4B 3C08H 4JG5A 1V3JA 3FTWA 1GZPB 3A3YB 4FQXA 2I27N 2BXYA 2X2YA 5D2NE 1HEJC 2AJSH 1X9RA 2D7TH 4JKPL 1NCCH 4GXUN 4XNZC 5E6IB 2BJML 3V4VL 5KYWB 25C8H 4UU9B 5MHSE 2A9MH 5GS2H 4MD0B 2DEXX 1VB9A 5KZCD 3BMWA 3V4UL 1O6TA 2R69A 2Y36L 5TDPB 1M7DB 4Y4FA 1WQAA 4XB3A 5HHNB 5LAPA 3LN9A 5FV2A 4LSUL 1ODAA 5BUPA 4NQXB 2BP3A 3KL0A 8FABB 5JMOC 4JDVA 4FJZA 5F9OH 4AGOA 2JWYA 2PXYD 1U8KB 3QXWA 4DJMA 4NC0B 1H9VA 4G6KH 3MKKA 1I9JL 4N25A 2QR0A 4FQ1L 5D93B 3SO3C 4OTXH 4WI0B 1A3RL 3W2DL 3CPLA 3DV4A 4TYUA 3ARFB 3RFZA 1FCCA 4GSQA 1DBBL 5FUZH 5E4EB 1J5DA 3RA7H 1PLGH 1UQSB 3LV3B 3POCA 3KNBB 5E24E 5F7FA 4YS4A 1MI5A 2OJEA 3B6SA 3GHBL 5HI4D 1PG7L 3WE6A 1PD6A 3G9VA 4XMUA 1DJXA 3L4ZA 1NUFA 4PR5B 3DX0A 1JGUL 3LPFA 2AI0H 1RPKA 4M5SA 4L0PB 4HIIA 1A0QH 3SPJA 4HP5A 4GUPA 2ADJB 3IVKA 4OQ1A 1TSHA 1TQTA 4ZW8A 3V4PH 1KJ2B 1A9BB 1DUZA 1UM6H 3GIZH 5FEBA 2R39A 3MRCB 3ZT5A 1B4LA 1AY1L 3P0YL 2APVA 2YC1A 3IMVA 3BZ5A 5SX5H 5HHOB 1B4JL 1H6TA 2PW2B 4KH9A 2Q87A 3EDJA 4NJAH 1MSPA 3Q06A 2YUWA 2K1MA 4PTUA 1FZOB 4ADJA 5DJ6B 5GRZA 3FFCB 5CLXA 5MEPB 3VSVA 2OYLA 3LN5B 2NTSP 3MX0A 1DQTA 2HJKB 4CMHC 1ES0A 4GQZA 3UPRB 2JV6A 3VXMB 4OB5L 1QN3A 3RBGA 3WUWA 3O3BB 4MXWL 4HJUA 3B2UC 2OI9B 3QDMA 5CZRA 4R4BA 1NAMA 1GGBL 2G3ZA 4WF7A 1CICD 3SDCC 4J3OG 4EAIA 4G8GD 4CL7A 5AVQB 2BWQA 4KK5D 2NYYC 3II2A 4H88H 1B4TA 4D3CH 4IBWA 1FJ1B 5J8OA 3UBGA 3JWOH 3KCWA 1ZVHA 3SPVA 3US9A 4X42A 4JZJB 2FX8L 4P5MA 4EXKA 2H32A 3CQFA 5DJCB 3WNJA 2HFGH 3A0OA 5B7FA 5DS1A 3O41A 4I88A 4O58H 2J44A 3MRLA 4BJLA 5AAPA 1A1OB 1O7VA 4FQCL 2WWOA 3JWDC 5GS2D 3DIVA 3DURB 1N0XL 1JFQL 2P5WE 5EA0H 4UT6L 3UAJD 4ETQA 3QEGH 2ZXGA 3HOGA 2PYEB 4MS8C 1A4KA 1KFGA 2EECA 2EVHA 4WFFE 2EINB 5ILTH 2DICA 5I0VA 1ACXA 4HLJA 5J12B 1WITA 1WZ1L 1SYVB 4BUQA 4OZFA 5D2NC 3GSRB 4JQXC 4K5PA 3W1ZA 4WWOA 2HKAA 4MFHA 4I3RH 5DO2D 2PTUA 3N1QC 5F71A 3CX5K 1JMZA 5DJAA 3VWKA 2SEBB 3V6ZB 5I1DA 1K2YX 4JPWL 3EO9H 2BSDA 2FTAA 4XBGA 2WCSA 5ID0B 3EDFA 2FGWL 1RIHL 3WV0A 4ZMWA 2NQDA 4NIYE 4NO0D 2FGZA 3FO0H 3FFDB 3DXAD 2IGLA 3PREA 1LDPL 1W6WA 2IQAA 2XVGA 3LH2H 1FNGA 2XWRA 4PHXA 4R7DB 3TX4A 3U9WA 1SBSL 2B2XH 3S3BB 4J27A 3FO9B 2ZF8A 1INQB 5FHAH 1U3HD 3RWFB 3SGDH 3U0PB 3X3FL 3IE4A 3OC3C 3HZVA 3NRFA 3CDZB 4GKNB 4JFHE 4Y4HA 1VGEH 4LSSL 5GGSY 3W9DA 4R8WL 3WL9B 3SZ6A 2C9SA 4QCIA 4YDIL 2DI9A 3QJSB 1DJHA 2NW2B 3EHBC 4LB8A 2FO1A 5FF6A 2UY6A 2BSCA 5HI5C 2ZAHA 4HS3B 3ZO0A 5ELIA 4WO0A 4PJDE 3CBJB 2QT6A 5DC9B 4N8UA 4OCRH 5EC1B 4TUKL 3WNLA 2K8QA 1ZSDB 5D5MA 5DR5H 5EB9A 1EEZB 5JNYA 3C5SB 1BM7A 1TJHL 1TMCB 4QRPA 4DGIH 4N0FA 3S2AA 3T8VA 3T2NL 3NP4A 2WB7A 2AEQL 2XU9A 3MNMA 3R1GL 2A6JA 2DQFB 1EDQA 1DBKH 4H13C 4BH7A 1F42A 5FOBB 1IJ9A 2EDTA 1CBVL 1IVLA 2IBBA 2P7TB 2QZ5A 1M2VA 4PJAE 5CSZA 5D96C 4EI5C 1W0YT 2Q7YB 1JNNL 5CIPH 2G75B 2GJZA 4X7EC 1WLHA 4PJFF 2ROYA 5C6TL 3DX2A 2LE9A 4P5TA 3FRPA 1QSEA 4HPHA 3MV01 1C5BL 4LSQL 3QIUD 3G6AA 3PLYA 4K71B 2EH7L 2OS7A 1IT9L 1N8ZA 3CU7A 5T1DH 1O5PA 1T0NB 4BFOA 2IDSA 3W56A 1LMIA 5K9QG 2WK2A 4HC1A 2VCOA 1LP9F 2XKNB 3BPLB 3WUWG 3WTVA 2XV2A 3O4OB 1AQ8A 4LL1A 5C2UB 5HBBA 4F33A 3W38A 5DC0A 3RI5K 1QSFA 4L3CB 5MP6L 4XBEH 1XCTB 1YEGL 4ACPA 4O02A 5F6IC 4NWUL 4PGDA 3D50A 1S7QB 3TNMB 1UCBH 1QFWL 4FMFA 4Z0XA 3O9WB 2D4FA 4UV7H 3AVEA 3MC0A 5EWIL 1PX4A 2B7DT 4X4KA 1YA5A 2ZSWA 4UNVA 5I1KH 1KJ3H 4KI5E 4MRBA 4H8WH 4E9SA 2VRAA 3KPPA 4PTTA 4AJWA 4ANWA 4KDTA 4Z76A 4ODUB 3Q7JA 5LXGL 3D39E 1JZIA 1NBVL 4AYMC 2XHNA 1W16A 5BVJB 1UGNA 2FSDA 4NKOB 3STZA 3VXRA 1FVDB 2KZKA 3K4ZA 4MD5A 3DGDA 3FAWA 1CR9L 4OI9A 4XPAL 4U6YA 5F0JB 1OCRB 1DVYA 4KQ0A 2AXFB 4K94L 4OZFG 4XC1L 2WKLA 5F9WC 4TLUA 3GGWA 3GBDA 4NBXB 4BA0A 1QRNA 2VLME 3U7AA 4GEIA 3T9WA 2X0VA 2OXHA 3ULAB 1CUOA 1ZVYA 3ARRA 4HJIA 2PWHA 5TQ2L 3MZGB 5KVDE 4MYPA 4WQOA 2IFFH 3LKPB 3WNKA 3V0GA 4DUWA 2X4SA 1A6TB 1ZLWK 5B4MD 5I9QC 2W07B 1A6UL 3MUGA 1DYZA 4N6RA 5B8CC 3VD2A 3FH5A 4M5TA 4YSRA 5C8JB 3NOIA 3QUMH 4PJ7B 4QY8B 4AQ1C 4OZIF 3BAEH 1FFNB 4XP6L 1P9MA 4G1MA 2PPEA 1NC2D 1J0IA 5IVOA 3T4NA 4OD1H 4FQ2L 1MF2L 4Z7AA 2DIJA 1KV3A 1NH2A 4X6FB 3BWUC 5BZXA 4OM1L 2F54E 3EYUH 3D9AH 3JVFC 4GXVL 3MZTA 2WXRA 3EUUA 4LSVH 3CVIL 5C0RL 5DUMH 1JRHI 1ZPUA 4K3DH 1UZGA 3TE5A 2Q0ZX 2CKBA 1FNSH 2XX0A 4PJBA 1NOAA 2J1XA 3F58L 1OARL 43C9A 4N26A 1EZLA 4MB5A 2DMGA 4OLUL 1BZ9A 3S88L 4NQCE 5EDXA 2ODHA 5GGRA 1OXYA 4F2EA 1U3ZA 1SY6L 3PUUA 1JGLH 4QRQB 3EGXB 4OIAA 3Q05A 1MCCA 3HUJB 3MCLL 4P3DB 3FBKA 5LAXB 3JWDL 1MW1A 1JNHB 5T1KA 2BVTA 1L7IL 3Q6FA 3I02A 5JUEH 1JGVH 1BSIA 2N0KA 4I77H 3GBNH 1L7TL 2BXZA 5HDLA 1X4YA 2YKKA 3FRPG 1CICB 2DL9A 3L3GA 4YNYA 3MRJB 2ZNWA 5FCSH 1ZLWH 2ETWA 3Q8AA 4G8GB 3K2UH 3QJUB 4OLZH 3NCEB 4PW3A 5F1KC 1FL5A 2BNQE 3QJFA 4S1DD 3WIIL 3KAAA 3PAUA 4NQEA 3V5KA 3ZE2E 4YFLF 1KYDA 4J4PC 1C16B 3QYCA 4AIEA 1XH3A 1JN6A 2VXUL 4YSDA 1EHAA 1FYTE 4MAZA 2JTDA 3HEIB 1JCKA 1FAKT 1G6VK 1WFMA 4YEEA 1WK0A 1CXIA 4B7IA 1WBXA 2VDPL 4ZJ9A 4EN3D 2W0FA 5ICYA 1DJIA 3T3ME 3GJFB 1D5XB 3T0AA 2P8LB 1EWHA 2Z8UA 4KRLB 3TCTA 4CADA 3DOSA 1AD0B 1T20A 2BVUA 1QNIA 4PRPD 3OF6A 1Z5LA 4JNXA 4EAJA 4DERA 2EQDA 1VRSA 2EUWA 4MMYB 2PR4H 4Q0XL 4X99B 1ETZB 5AZ2L 5I1HH 3UG5A 1FV1B 5IUCA 1BLNB 2YJQA 4UOW1 3QHTC 1KMGA 1KULA 4NO2A 2WMPA 35C8L 4LCVA 3L13A 2CLZB 3OB0K 2OMXB 4NO0B 5EHFA 3VFSA 2JCCE 3VACA 1NCIA 2GSGA 2NR6A 5EIIB 3MV9A 2XN2A 3HI6H 5CEXB 1S9YB 4UTBL 4QHUA 4JFSA 3WXVH 2FCBA 5JLZA 3DPBA 2FUTA 1U3HB 1XDTT 1WUZA 2VDNB 4IJ3C 3SJVD 3SOTA 2O5YH 4QRTB 5IVXF 1M7IA 4QXUH 3THMH 1KN2L 1JAEA 4XCYB 3V4PB 3T08A 3QDJA 4X5LA 2MCMA 5LDSA 3V0WL 4R90L 3EADA 4DZ8B 1HL9A 5HHQA 4M6ML 1LO5B 1EJ8A 3D2UD 5J3HD 3H4HA 2N56A 2NXZD 4OF8A 1NC4A 4Q4EA 4FXGB 5KSBF 1V27A 1ZCRA 3NSXA 1D7DA 4R97C 1R3IL 1YY8B 3O2WL 1SXNA 3QPQD 4FQJL 1N64H 1PDKA 4H5SA 4MXQD 1KBKA 3PWJB 1BG1A 5DVPA 2NUTA 1L0QA 2QPFA 4K7FA 4Y1AA 3HS0A 1X5XA 2RALA 3WIHA 5FGCE 3WFHA 2NNCA 4LCWE 2VAAA 1Q9KA 2NQ3A 3MNVA 3TBCA 1QR1B 3C5XA 1OGSA 3RX5A 1K35A 4GP8B 2R9HC 1Z32X 4Q8BA 1TZHB 2X2IA 4ZD3H 4GUQA 3QIUB 5F7AA 4AJYV 3MOBL 3OB0H 1F13A 4BSVA 4A1RA 3OMNB 4I3SL 2VZVA 5J4MA 1MJJA 3D30A 1BFVH 2NYZA 3FHEA 4MA1C 3TN0C 3WJJA 1D6EB 4UQ2B 4N2BA 2I7SA 4RBPK 4ANXA 4OCWH 1E90A 2HL9A 2V3DA 1OHZA 3H0TA 2OCCB 1DL7L 4WO4A 3NQKA 1ZK9A 1T5KA 2B0SH 2W1NA 5FWRA 2WUBL 2VJXA 2OMZB 5CWSA 4ZRGA 1HH6B 2CHXA 3DMMA 4A37A 1BZDA 2ED6A 4LPUA 4A7UA 1A7QL 3W57A 1ORSB 1OY3B 1MHEB 2W0LA 1XGYH 5FK9B 5IMKA 5HTSA 4UM9A 2N7AA 1FG9C 2IJ0C 4QDGA 2EAEA 2BIIA 2R0ZH 5J11B 1FE8L 2XSKA 4LVHC 4AIZA 3NGBC 1EAPA 1Z0MA 5AOKA 3ATFA 1XGTB 4JHUA 2VDQL 1TTRA 4B9YA 4MDIB 2AQQA 1BXXA 7FABL 4ZK8A 2NNRA 3J07A 4CSPA 2ZCKL 3L4TA 3MJ8B <