3HS8A

Intersectin 1-peptide-ap2 alpha ear complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
b'FEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adaptor protein complex AP-2, alpha 2 subunit
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 58
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs8A02
1W80A 1R4XA 2DWXA 1QTPA 1D3UA 3MNMA 3EIKA 1QNBA 1PCZA 1QN4A 1VOKA 2G30A 1NGMA 5IYDP 2IV9A 2Z8UA 1GYVA 1GYWA 3HS9A 4PY5A 2IV8A 1KYUA 5CN1A 1QN3A 4WZSD 2E9GA 3OC3C 1NH2A 1AISA 1VOLB 2VJ0A 3H1ZA 1QN7A 1KY7A 2D0CA 1E42A 3OCIA 1QN6A 1TGHA 1QN8A 5IYCP 1QNEA 1GYUA 1KY6A 3HS8A 4BCXA 1IU1A 4B0AA 1CDWA 1RM1A 4ROCB 3ZY7A 3ASMA 1KYDA 1QNAA 1TBAB 1TBPA 1NA8A 2D0BA 1YTFA 2YMTA 1YTBA 5CN2A 2DWYA 3ZHFA 1KYFA 1QN9A 2D0AA 5IYBP 1P4UA 1QN5A 3VN5A 2MJ7A 4ROEB 1JFIC 1NVPA 2A7BA 1VTLE 1C9BB 1OM9A 1MP9A 1B9KA 4RODB 1QNCA 1QTSA 1VTOA 1PZDA
chains in the Genus database with same CATH superfamily
1DVFC 4Y19B 4B6ZA 4EI5A 3IU4H 3U1SL 4HUVA 5CINH 4UIMB 5C6TL 2WXHA 2C4XA 1P5DX 3SYCA 1VLXA 3RY4A 1V3LA 4CW1B 3RWCB 2GK2A 4HC1H 5D5MB 1DLFL 3D07A 5CZXD 2ZG1A 4P23A 3WNJA 2DLTA 4HHAA 1D6VH 5DJ0A 5FA4A 1ZPUA 3WKYA 4NC1E 5C0AD 4PD4K 3EJZC 2F53B 1ETB1 2R9HC 4Q9CA 4IHOB 2ZOWA 2VKXA 4GYBA 4IIQB 5C71A 1A6AB 1F58H 1PU0A 3OX8A 5L88H 2NR6A 3VD4A 3V8OA 1WZAA 4GG8B 1DEDA 4XO9A 3T4AB 3KGSA 4J4PD 4LCYB 5F3FA 1VEMA 3II2A 5ISZE 4F1SA 4HIHB 1AO7D 1YQKA 4XCNA 5GS0H 2EIZA 3KPRA 5I1LB 5E8PB 2QPUA 2GFBB 5D5ME 2WXLA 2IDSA 4WUUD 3U1PA 4DK3A 2EDRA 4TRPH 3LQZB 4GW4A 2NXYD 4YDKL 2A9ML 2DJ4A 1JJUA 1JOIA 1N8ZA 2F53E 4G1MB 1QNIA 3OBAA 2V9JA 3X1EA 3VDBA 4Q7DA 1K4DB 1MXDA 4WU7B 4CKVX 5T3ZD 2A9CA 4OV6F 8FABA 2GJPA 3Q5YA 4L1HA 4GBXA 3BI9X 1GZPA 4E41D 4KK9D 3VAEA 3KPSD 2BSCA 1TENA 4R0LA 1G9MH 3C5SA 2IPTH 1RHHA 4FERA 1OAXH 3OKMB 5HD8D 3QXAB 4Y1TA 4S10A 3BUQA 1WFIA 1KN2H 5CJ8A 1BX2B 2ZD0A 3VD9A 4ZAKA 1JWSB 1NGXB 1OAYL 4Z76A 2IGTA 1MIMH 2EIBA 4A6YB 4AYFA 1ECZA 1CLCA 3ZUCA 5EZJA 4YSQA 1ROWA 2CRMA 2KYIA 4OVVA 5JTWA 2Z1KA 1TETL 4LO9A 3UZVB 2R4SL 2X4OB 1LWWA 1BMGA 1YAZA 5CJ5A 5I2IB 5KVEL 3NVQA 2CHZA 3DX1A 1F8TL 1VF5C 4S0HA 2ZYRA 3HR6A 2J4WH 5HYQB 3HNSH 4RNRA 1QYGH 5EUKB 3GIZL 2ICWA 5KVDH 1TTBA 4X5RA 1TO4A 2EXYC 4ZSOB 3RJQB 5EBLA 4P4RA 2EECA 1JGVH 1ZD6A 3LV3B 3NRPA 4LIQL 4OFDA 5J9PB 3V9FA 1FYTB 3MBEC 4LMQE 5KVDE 5I74C 3ZL4L 2ZCHH 5JN5A 1NCOA 5MP6L 1U8PA 5HHPA 1KB5L 3OVUB 2ZF9A 2ZYIA 3BPNB 3O3AB 3WTSA 2XNAA 4AT6A 1E0OB 1MCCA 3RWDA 3QI9A 4I4WB 5ERWA 2HA1A 1XCWA 3IMRA 2V9UA 4JVUA 3S7GA 1UFGA 3KLKA 2PETA 1LEGA 1CZ8L 2A6IB 2X1PA 4JE0A 2ZXQA 5BZWA 1KENL 4RCAA 3KPTA 5AD0B 1E90A 4AYSA 1FYTE 2EXTA 4IOIA 4MCNA 3TBVB 3U0TB 3ALWA 2BNQB 1DBJL 1KB9J 4XPGH 4Z0BL 1W6WA 1NEZB 2IQAB 3X11A 3MRGB 1KULA 1I1YB 3MV7D 4UIKH 4NQEA 1U91B 3L3OC 2EKSB 3EJUA 3TH3T 3MUHL 2OKMA 2PMZA 3CFCL 3QUHA 4FXGB 2XKSA 4XC1H 4MX7B 5KJ7E 4XHQA 3M45A 1RZKC 2CD0A 1NC4A 5IREA 5IKCA 1URZA 4JRWA 4BBWA 4UOQA 1HNYA 3EOBA 2GBUA 1UH4A 4KRPD 3GI8H 4K15A 4U6XB 3ZKQD 5IJVA 2BNQE 3O3DA 3TEYA 2TSBA 4BWTA 1SVZA 5AKVA 4WJKB 2BRRL 3CD4A 4JRYB 1Q94A 3VXRA 1LWJA 1LO0L 1E4JA 3CVIL 3JVGC 3GSNA 1KGIA 4PJ7A 1LO5B 4XN9A 3NCBB 1LDPH 1YNLL 1KPRB 3FMGL 1F3JB 3UZQB 4UTAL 3WENA 4GIAA 2X4UA 3PRZA 3RFZB 3WIIH 4FNQA 3CWSA 5DHEA 1EAPB 3B1UA 1G43A 4GT0A 5JPMA 3BSGA 4KOCA 2BVYA 5AVVB 3BLBA 1WIUA 2FKMX 1WDAA 5AB9A 1KB9K 4TLSA 4JRYE 5CSZB 4Y5VA 1P2CB 1WC7B 2CGRL 2IAMA 3ZRSA 2UX7A 2BNRD 4AOFA 3ZT6A 2EINB 4HLEA 5IVZB 4FJYA 1EEYA 5T5NF 5IOKA 1YPZA 3W5NA 4MD4A 3VFVB 5LCVH 3V9EA 2AI0L 3F05A 1U42A 3N85H 3DDGA 3NK3A 1IC0A 1S8DB 4HJSA 1N2RA 4KV5F 2ZT9C 3PF2A 3LIZH 5BOZG 4HJHA 1RKRA 3BVNB 4J6IA 1MI5D 1KPUB 2BIMA 1A3RH 4EE2A 4X6BA 3IKCB 4EAJA 2G3XA 1H5BC 1UVQB 4PJBA 4F8OA 4FKHA 5AL8A 5DJ2B 3O45B 5EN2A 4LRIC 1XMEB 4S2SB 2YXWA 5IP4A 1CYXA 3NP3A 1OP5K 3G6JF 5LN4A 2L7UA 1IQDB 2V8QA 1DBBL 2CIKA 2ZONA 3OLDA 4WCYH 1CK0L 5C07B 1MUJB 5L4FA 3S88L 3PNRB 4TQPA 2IV9A 3MRPB 4PH8A 1T20B 4ESKA 1G94A 3SNSA 4OFQA 2FATH 4NZ8A 3BIBX 3CZGA 3LH9A 1GGTA 1CS6A 1JGDB 2P24B 3MRMA 4KO7A 1COBA 4NENB 4PTUA 3T0WA 3MACL 1X5XA 3IKKA 4XNXH 5IJKC 2OAAA 1V5SA 5DI8B 4OGAD 1FGVH 2C5DC 1F2XK 2PPEA 2FUTA 2CIIB 1F42A 1QN7A 2RD0A 3SDAB 2WLIB 3FOMB 5ESQB 3CHQA 4XBEH 3G08A 4MWFB 2XQYG 4JKPH 3GMNB 4G8GD 2TRHA 4IBQA 1A7QH 5EOQL 5C07E 4CVXA 2R2EA 1G6VK 3P11H 3PU7A 1MCEA 1KJ2A 3P40A 1XH3B 3RVTD 1NWOA 4ODSL 4KV5E 3UP1A 3MBWB 1WSST 4YPGB 2WGXA 1HWWA 5IFHL 5DVLA 4XPBL 2ERJB 3B2DC 4Y7MA 4PJHF 3FS9A 5SWSA 3IJYA 5CEYA 2LLLA 3O0RH 4QJ3B 4AVJA 1QLFA 3SKNB 3IRPX 2ZP0T 3TWCL 5E51A 4URKA 2G2PA 2Y9RT 3V4VB 4E5XB 5GJSH 4K3GA 4ZX4A 4AC2A 4DKEL 3U0WL 4ZQTA 1IIIA 2VLMD 1YMMB 3KWWA 4C55A 5A40E 1MHPL 1AS7A 3DBXA 2ZSVB 3N04A 3IETB 4XH2B 1M1SA 4FQXC 3IBOA 2B1AH 1TJIH 2P8LA 2DWYA 2XRAL 5DRXB 2AEOA 3ZHFA 5IHLB 1TJHL 3OC5A 4ZXBD 4WGWB 2R29H 1CFVH 3MNZA 1N70A 4K71C 4P5TD 3V4VH 4K7PX 4GEIA 4EIUA 2FJHA 1R3IH 5FM5M 1H9DA 4P5RA 3SPHA 2QGCA 3N1GC 4TQEH 4A7VA 2CBMA 4YLQT 3O4LD 3ZTNH 1WAPA 4ZTEA 1NC2A 4H5SA 4CC4A 3WY1A 2DBJA 4X7TA 4LEOB 2OP4L 4ZFOA 5JA9A 1RP8A 1YMME 3FN3A 4PG9B 4X7CC 5MEPB 5D1QC 3LNGA 4WLCA 4ZUSB 4AE1A 1CTMA 3KWTA 1ORQA 1E9PA 3FTZA 5BUPA 4GAGH 1ZGLM 2OCFD 2N7AA 3ARQA 2J88L 1JXFA 2VSCA 4JG1L 3CFMA 3ZYIA 3VWKB 5C1MB 3DVNA 4G8EA 3MV9B 3PQYD 4ELMB 3QG6A 3QIBA 1QNCA 1CE1L 1A6TB 1KCBA 2VM4A 3FOLA 3WTTA 3QEQB 1FO0A 2HH0L 2KI6A 4R4BB 3MYJB 4G3YL 1AXTL 2DTML 5AAWA 1UQSB 2VXTL 2R0ZL 4HK3J 1YEHH 1MJUL 1OGAA 2F19L 1GCFA 4DQOL 5I5MA 2BP0B 5DRZB 4N24A 1MDAA 1VFUA 1PDKB 2XTLA 4R5VA 2YXFA 1IAII 3AT8A 3QDGD 3VRIB 4MHHG 1QBBA 5AW9B 2AHIA 3PDKA 1EA9C 1BQKA 3NFSL 4RFEB 2YAOA 4XXWC 1F1AA 5DU7A 3QEQE 3BFQG 1J1OH 5IESL 2PR9A 2QT6A 5EO9B 4P5MB 2WTRB 5KUKA 4BFFA 2CBQA 1VFMA 3SKOA 3ASNB 4GG6A 3S35H 1HNFA 2R2BB 1TPXB 2C7UB 3B2UD 5C0RL 3GBDA 3O6FB 1N0XH 4JO4L 2ZIDA 1PZ5B 4KHTL 4TQIA 2GIMA 5CWSA 1UJ3C 4GAFB 3SCMD 3RWGB 4BHUI 1R3HA 4TL4A 1QFWL 5HI4C 2VJ8A 4K3DH 1JTTA 4UF7C 4ELKA 1U8KB 5ID1A 3W9EA 1BQUA 1OB1A 4N6RA 1U21A 4XP4H 2BZ7A 2I32A 2K3TA 2NX5A 3CH1A 3IEAA 3WFCL 3K6IA 3PFUA 1HHIB 2WC7A 3TONA 1VFBA 5DXWA 3VFPA 4MMYA 5K9OA 2GABA 2XFGB 1TZHB 3IFLL 2QREA 1GGBL 1QLRB 3NIFF 3MJ9A 3WL9A 4HS8H 3UEQA 4MB3A 1OAZL 2FJGB 4LSQL 5FB8A 1F11A 4P2AA 1LL1A 2MWCA 2VN5A 1A6WH 1H8NA 4BKTC 3ESOA 4YXKH 5EZIL 4PGEA 1NH6A 2NY3B 3JTTA 4PRAB 5GGVY 1JZ7A 1OHQA 3HMXH 5DT1L 4GUPB 2XN9A 5GGUB 4N2AA 4JGJA 1QBLH 3VE0B 2OCJA 2ICEC 1HTYA 4Z95L 1VTLE 3P9MB 1DUYA 1G1YA 4X6DA 4YFLF 3G5YB 4XNBA 4MA7L 3VCLA 3BISA 1KMGA 4AKOA 3BKCL 1WIOA 1HXYA 4RETB 3UTSA 1VKXA 3D39A 3U7WH 2ATKA 5K9JL 4XI5D 3CFNA 3EBGA 5D7JA 4Z5RB 1SXBA 2Q1EA 1BLNB 3H3BC 5INDA 1QR1B 3VDCA 4K7PY 1X3DA 3TJPA 1BBJB 1TU2B 3LNEA 1RZJH 3BEVB 3OKOB 4YSTA 4CSSA 1IFHL 4RISL 4DERA 3C60A 3EYFB 4F8NA 5BRZD 4XHJD 4L4TB 4QT5B 4TVPH 1Z9LA 1WHOA 5HDBF 1XF5B 2EIMB 3FCTB 3NIFE 3MUZ1 3IWUA 3CZSA 3C87A 5CP7A 5CP3A 1JK9B 2EXSA 4YK4C 4HIIB 3F10A 2B4CL 3HNVH 4ACTA 4WRLA 5T33L 4TVPE 4OFYD 1I9IL 3QDHA 3OQ3B 3IJEB 4JKWA 5KBNC 2GUOB 1R3KB 3HG4A 1NAML 2MTPA 4URTB 1A14H 3GJEB 4FYRA 2DWDA 3BKML 1AZVA 1ZLDA 1QUPA 4C4KO 5I1CH 5MENA 4NI6A 4GOSA 1DQJB 4GRMA 4WO0A 1CFMA 2A73A 2VDML 3UJIH 2F0CA 5E24E 3MI6A 3STLA 4PRPB 4B9FA 5GZND 3VGEA 4Z7WB 1IBHA 3WNNA 5DFVD 4H26B 4H8WH 3KR3H 1RUAH 5BZXA 2YZ8A 3QUYB 4P3WA 4PS3A 5ADOH 1FVEA 1MLCA 4P0DA 1KO9A 2B3IA 4I5BB 1PCSA 1F4YH 2UZIH 1Q9WA 3QZBA 2ICWJ 4OCSL 3VXMA 2NCEA 3AITA 1DFBH 3CFEB 4PJ5E 1BM3H 4PJEB 4E9XA 2MHAA 1DVQA 1QFUH 1C5DA 2XWBA 2H8PB 1BXUA 2YD8A 1OOAA 3S5ZA 1EUVA 4Q0XH 4OQTA 2YKLL 4Z7WE 4FP8L 2EKJA 2ZP8A 5HDBE 4Y5XC 4BH8A 4DFIA 1GMEA 2VXQL 2VABA 4FZEH 1UA7A 3GSQA 3T2LA 2V8MA 1I7ZB 3RILA 1WFUA 5JXED 5KSUB 3T1FB 3CDCA 3L95B 1CN4A 1UYWH 1W16A 4ONHA 3F12B 4PJEE 3B7UX 4X5PA 2I9TB 5FGBA 1QN5A 4HOWA 4Y4FA 3CVCA 4Y4KD 3R8BB 4CMHC 3CFKA 4NO2B 2HRGA 2PLTA 1EHNA 2ARJA 3ESVF 2D0HA 2WAHA 4R4NC 1BAGA 2DIBA 2XZQL 2F7IA 4HV8B 5F7HA 1DQKA 4GP4B 3H9ZA 4U4BA 1TJXA 1OM9A 1YJDL 4RGNC 1MP9A 3ETSA 5MERA 4ZO8A 4P5SA 3D87B 2EEFA 3R06A 3MGAA 5ALCH 3TO4A 2VR6A 5T1KB 3U2IA 3D2UA 3QRFM 2AJZB 2V8LA 4I1NB 4X4ME 1A9BB 3QRBA 3QXDB 3II3A 4PREA 4XNDA 4NLHA 4JJ5A 4WJ5B 5E94B 1KDJA 3MRFB 5GGTA 1GOFA 1OF2B 2KH2B 4D0BA 1NCGA 1P6AB 5AYUH 1S7TB 4IOSD 2LLNA 2DI9A 4M6OL 1AHWB 4XMUA 2RIKA 3WTXA 1WFNA 3CFBA 4IHBA 4DEWA 1I8AA 4DPBX 3FO9B 4QOKE 3ATBA 4JFFD 4OD2A 4FG6D 2P46B 3IDJA 3STZB 1WJWA 4KUZL 5FHBL 3RB7A 2V17L 2EYRA 1NSNH 4TTDC 4ZFFA 3T2PA 3B8YA 4JREB 4HHAB 4ZTOL 4DAGH 2AITA 1JE6A 5FA4B 1G7JB 1F1GA 2Q3XA 2R7EB 2YARA 1OM3L 3MRHA 2JK5A 4HK0A 5JQ6L 1BJ1J 5C08D 3HG5A 1MCFA 3IDYC 5HYSA 1UATA 3E8VA 5D1XE 5IYCP 2ITCB 3OX8B 3ZE2B 4P04A 3E80A 5L2KA 4TVUA 2YD9A 3HZYA 5TFSH 3THMH 5CCKL 4ABQA 1U8NA 4XCNB 4G43A 3MRIA 5AW6B 1CIDA 2QMJA 5SWQA 5FPIA 4L9LC 4PJDA 4XP5L 4P07A 3QO1B 4HCRL 4ZUVB 5T5NG 1OEZW 4WHYG 1HH9B 1FHGA 1XDTT 1LO3H 4MA8H 1D5ZA 2Q8BL 1BDYA 1UKSA 4IEFA 4MJHA 2RQ8A 1G0YR 4OI8A 1U3JA 2JKTM 4PWJA 4XVJH 3V6FB 1INEL 3ZE2E 3NCYS 3VFOB 4OIFA 2ATPB 2DB8A 4GBXB 2XV0A 3P2BA 1GGCL 1UTDA 5KBPA 1I85C 3Q2WA 3SDYL 3T9WA 3OGDA 2FAUA 1AANA 1UEMA 1XEDA 2MQ0A 1CURA 4N8VB 3KPRE 1B0IA 1INDL 1RHHB 2ARWA 4EN3C 5C7XH 1W91A 3OKLB 4W93A 3D09A 2XPGA 3D3VD 4NFBA 4IRJA 5GSRA 5I6XB 3P69A 4JANB 1KNOB 3O9WC 1THCA 1ZDQA 4LCWD 1BVNP 2Q10A 2DOCA 3PXLA 4BFJA 4APQB 3GWJA 3NABL 4CU6A 4Z76B 2XJLA 3LEXB 5FHAH 2A7BA 2BSED 3D85A 4X7SH 1W8NA 3TZVA 4PJGF 3OKDB 3OAZH 4XAWH 5H4ZA 4R7NA 1CFBA 3VGHA 3LH2H 3ZTJH 3WFHB 4WK0B 1HAWA 1OGTA 1T22B 4UM9D 3HLAB 3GMMB 2V5SA 1EQWA 3B1TA 4HUNB 5LVEA 1UD3A 1QSEA 5E6YA 5B38B 4A7UA 1KIRA 5DCCA 2Y72A 4A1RA 4GY4A 4M6NH 2NXZC 5CGYC 3DSFH 4HIXL 4YDJB 2ICWB 1L9NA 3EJZD 4V2BA 2YBRB 4XAKE 2R9HD 1HEHC 4PJ9C 3UBGA 1TF4A 2BSRB 4UOZA 4Y9EA 4UILH 2JCCA 3VA2C 3CG8A 1KBKA 3FRPA 1EJFA 3MLWH 1IUZA 4LEEA 4MAUH 2GJZB 4JMXA 4YE4L 4D9RD 4YE0A 2XZCL 1J8HA 4YSSA 2HVBA 1FV1A 1U2HA 2GAZB 2CLRB 3ARPA 1A7OL 3S36H 4O2CB 4ALAL 4AT6B 4DUVA 1BSIA 1MNUL 5I6PA 3N43B 4RESB 1PSKH 1Z7JA 4Y8DC 1NGWB 1TOXA 1R34A 3ZHKA 1CICC 4LKXA 4W9LC 4QLRA 1GKEA 5F6IB 5C9KA 4LCVA 4ODUB 4MJ5A 1JHLH 4QGYA 4X8XA 2CPCA 4JVWA 3K8KA 3EGSA 3LZFH 2IPKA 1EGJA 1YNTA 2XYCA 3IGAA 3L2MA 3KL3A 3FT3B 2X1QA 3HFMH 2FBJH 3UROR 5L8LB 3BWUC 2O5ZH 4PRHA 4JRLA 3PCYA 4K23L 4WFFD 2I7SA 4QXGL 2QZQA 1FAIH 2DN7A 2XCMC 3BYTA 3NN8B 4PJ7F 4H25B 5HJGA 3UG4A 3EYVA 4MD5B 3UFIA 3WJMB 3AW5A 3WLWC 3WD5H 4L0YA 1MFAH 3HPJA 4KTDL 1RZGA 3GZOA 1S7XA 5LG1A 2DL2A 2Q86B 4NGHH 2ZYSA 1QWUA 3DV6A 5AYTA 1L3WA 5IJVB 3PAYA 5GS1A 3S3BB 1HKLL 3NT0A 3FU9A 3O3DB 3FO0H 2W9LA 1QI5A 2BW5A 4PTTA 4FQJH 2BS8A 3MLRL 1C4GA 1HZHL 1Q94B 2E0PA 3AVEA 4NQEE 3VXRB 5I6OA 1WWCA 4KVNH 1D7FA 4LSRL 3UIYA 1YPZF 4PJ7B 5E5RB 1T0NA 5AVYB 1ZHNA 5AAMA 2QKIA 3F6JA 5PCYA 2QELA 3MA9H 5EHFA 5F0LB 3LKRA 5HGDA 1U93B 5I1GL 1WE5A 1HOCB 1NTDA 1Y0LB 3GXTA 5DZPA 2X4UB 4XMXA 1X4ZA 5C09D 4NDMA 4XMZA 1G1OA 1D5IL 2EXYD 5AOMA 5C70A 1BF5A 3RZCC 1E6OL 1F4XL 2ZXCA 4PJBF 3GSNH 3B4NA 1A9EA 1RULL 1FZMA 1UB5A 4JFPB 3MBED 3EH2A 3VXRE 4IJ3C 4G9FB 4YX2H 3C6LB 2WCPA 2ED8A 4PJ7E 1A7RH 1I7UA 4F9LC 4WWNA 1M7XA 1JYNA 5FO7B 4A2HA 4M61A 5F70A 2OI9B 4LARL 1N2RB 4P4KA 4GI6A 1FN4A 1Z9MA 4FHKA 1H15A 2V7NA 3N9GL 2C9RA 3KM1A 5BCAA 1KGYE 4EAKA 2K45A 4M00A 4XVSH 1LE9A 1FNAA 2BVTA 3T6WA 1JAEA 3T0XA 2X40A 1D9KC 4G9FE 4IDJH 3T3MB 3IMVA 5FW8A 1VOLB 2AJXH 4LCIH 5I15H 2VW4A 1CUOA 4EBQL 1BWMA 2NWVA 4MXWL 3SOBL 1C12A 1JHKL 1FF5A 4UB0H 3KPNA 1K2YX 2KUTA 3U83A 3CXDL 3NTCH 4EF3A 4FOMA 4PJBE 1YEFH 2NUTB 1EO5A 3ELQA 5CIPB 3T65B 5E56A 5F9DC 2GSMB 1P5UA 4L48A 5LGHL 1CVRA 1NBVH 4F5CE 3T3ME 2BM3A 4W9HC 2RCSL 3OHXC 4X99A 3HC4H 3H6JA 2F8OA 2JQZA 2AJUH 4IBVA 4PRNA 4Y1SA 3WDJA 1A9VA 1KJ2B 1N4XL 3OAYH 3R1GH 5IUCA 4FQQA 3MPCA 3QUZA 3AUWB 3T0EA 1MHCB 5FUCC 1N0LB 1R19A 2WXNA 3TVMC 5C0EB 4KI5F 3BP5A 3A47A 5SWSB 3RTQC 2PCPA 4DN4L 2BVEA 3CZFB 5JNYA 1T7VA 3BH9B 4TKWA 4BK8A 4CKQA 1KJ2H 3TN0C 3S3PA 5DDHB 1FC1A 2AQSA 3ERXA 3WBDA 2HKHL 4JO3H 5CJBA 1EZSA 5HHMD 5JIIA 3DPBB 4UAOC 1ET5A 3DURB 2L7QA 4OTXL 1MWOA 2IC2A 3CPLA 4OD1H 1HKFA 1VERA 2V3DA 5B3JF 2ZUQC 1OP9A 1BCIA 5EZOH 5SWSE 3TOPA 3MNZB 4OF3A 1Y07A 1H0DB 1EAOA 3FUKA 1IBGH 4NJ9H 5E1GA 2JJSC 1PZUB 1YYCA 5CJOH 4A68A 4B96A 3BZ5A 3FUHA 1KLUB 3WUWB 2A5UA 2GITA 4XMKH 1WCBB 3QG7H 5HHXL 4P2OC 3Q6FB 4M9PA 4ZFOB 3QHTC 1J5OL 1I1RA 2LAAA 3IGFA 4WFED 4KY1L 5HGBB 1IZJA 1RV6X 2AEPL 2VM9A 1ORQB 3DOHA 2FQDA 4R90L 2H32A 4N90E 1CFTB 3L4TA 3DTDA 3BVWA 2KZBA 4JM2C 3ESUF 4HGMA 5JMRA 4X4XA 4F8QA 4G8EB 1SBBA 3QG6B 1ZXQA 1F97A 5LO7A 4A37A 3WEAA 3K0YA 5EUOF 3EDKA 3GHEH 4IRSB 5C0GB 3QUGA 1PIGA 1NEUA 1ZK9A 3CVBA 3D4YA 3IB4A 4QJ5B 3CVHA 4Z7UF 4GG6F 1G9NL 2X1XR 3IPFA 4GKNA 2WV3A 2JIXA 2G5BB 1JWMB 1SUHA 4LKCA 4OLYL 3UBXA 4XXDA 2JB5L 3A3YB 3TH2T 1AR1C 5FECB 3G9VA 2XQYK 5HPMB 5B3JE 1FO0H 1CPUA 4TPSA 1FH5H 4OCYH 3V7AG 2VW7A 4MJJA 1XHHA 1ET8A 3HS0B 3SN6N 2XWTA 4AK2A 2WXJA 4MS8C 1JCKA 2PTUA 4Y2LA 2O5YL 4LLMB 4JY6B 3IN0A 3DOIA 1AS8A 4YR6B 5DGQA 5FEBA 3NGBB 4JG0L 1N6QH 2YFNA 2DF3A 2ZX8A 5EO1B 2NOLA 5E9DA 2BSSB 3H0TA 3MRBB 4HKXA 4U6VH 4XOAA 5D70L 1MFUA 2D0BA 3TF7C 4NYLB 1UWYA 4FQXD 5CWSB 2DQTL 3FF8A 3S3JA 4F7MB 3C04A 2EH7L 4YHOH 4QPEA 1R3HB 1KFGA 5ACZA 1BREA 4C59B 5IHWA 3BXNA 3G9AB 3IFNL 3DJSA 5AZEH 1CXFA 1A4BA 4NNYA 2ADGA 1DJYA 3M1BA 4Z7OF 4PY7A 4ANKA 2NX5B 3REWB 4APXA 2ADJB 3OXRA 2WLZA 2UY6A 4LLDB 1NMBH 1X7QB 2JH2A 1MWAL 2WXRA 4ODXB 4QRAA 5A2CA 1QWHA 2Z35A 4MMYB 5BRPA 2YIHA 5K9OB 5DJAB 4F8TA 4TULL 1MVUA 1AE6L 2H26A 4HISA 4X6DF 2LHAA 3GXNA 3KS0H 4PPTA 5D1QD 5E95B 3DVGB 2X4NA 3JWDH 3U30C 4OM0H 1HHGA 5EBMA 2CK0L 4TMPA 2GI7A 4UOW0 4AVKA 1G6RB 3MQIA 1F11B 3FULA 4N2IA 1UOLA 2IG2L 4XTRC 2WZPD 5FYJL 5EIVA 5I8EA 2EEAA 1GZQA 1TJGL 2R69L 3NIGB 3BGFB 4YDIH 2IFGA 4AJYV 4NKIH 4MQTB 1KBGH 1AJ7L 1P7QD 2NX5E 1MAJA 5E1IA 5SWZA 1V3KA 2VMDA 4IYKA 3LAFA 3MJ9H 4G5ZH 5F7YC 2XN9B 2A83A 5F7BA 4B9ZA 3K4AA 3DMMD 3TBSB 2DLFL 2DWEB 1DCEA 4U3HA 3V6OC 3WS6A 1DUYB 4L8SC 4S1SL 3IVKA 4WAFA 2BVOA 3P3UA 4OAWA 3ESNA 2AGJL 1KN4H 2ATKB 4RSYA 2VLRB 4HX1B 1I1AC 2WBWB 3QHFH 3WMQA 4DKFH 5CGMA 3KVQA 5INDB 1RZIB 3KBPA 4G7VL 4JPWL 1KYUA 3L7EB 3OB8A 1MEXL 4N0UA 4NC1C 3UO1H 2P47B 2XN9E 3HUJB 1OK0A 4O51A 2LU7A 1E2ZA 2IFFL 5DURB 1ED3B 3AXHA 1DJHA 4DZBA 2O6PA 3QQNA 1BG1A 2BMKA 4OB5L 3ZXAC 2OZ4L 1RJZA 2Q76A 4I48B 4J3VA 2C9AA 2Y06L 2Y5TA 3UTSE 3D39E 2F8IA 4HF5H 1QSFA 2VLRE 2A9AA 4HGWA 1X5MA 2ZKYA 4K73A 5HI4D 2ZXAA 3VFSB 5IMOB 2APXA 4YFLI 1IBBA 3SKMA 1PEZA 5L7XL 4UT6L 2X7LA 1E5BA 4DKDC 1JI2A 4U6HA 4N8CH 4B9YA 1D2PA 4R97B 1HE7A 1EFXB 1YAIA 1VB9A 1Y7VA 1AI1H 4OW6A 2XFXA 4YVUA 1CJYA 5HJ3A 4FA7B 5CP3H 4GRMB 3RVWC 1AGFB 1K2DB 1WS8A 1JD9A 1I1CA 3STLB 3ARTA 2CO7A 1XQ4A 3F62A 4PSRA 1XGTB 3T4AC 4M93C 5E8DL 4M48H 3WLBA 2CA4A 1JPEA 1Q9WB 1I4FA 1OSPH 1S7WA 1KGXA 2P5WB 4K94L 3BZFA 3QJVB 4I3GA 4BK5A 5LQBL 1WEJH 2Y6TE 1KIQA 1PD1A 1MJJB 1IM9A 4LQFH 5HDWA 3BDXA 4ZX3A 5MENE 2YEZB 4HCFA 1G9MC 4L1LA 1Q0YH 3QQXA 2DQHL 3QUXA 1XO8A 3FT1A 3QFJA 1JVKA 4PV9A 1XT5A 5AVQB 5D8JH 5F7DB 1VEPA 1Z32X 3EGXB 1MSPA 3NZ8A 4HWBL 2X2HA 3BQUB 5BRQA 2GYSA 2GUYA 3Q01A 2WQRA 1SBSH 3N5AA 1RJLB 5J12C 3VWJC 1FDLL 4A38A 2P7TA 2P5WE 3VXME 5KSAC 2W0KA 4HALA 3VSQA 2FYYB 4XE0A 3INOA 4OQTH 5EMYA 1V7NL 4J1UA 4N0CC 2OXGA 2WO2B 3K5SA 4NO0D 4UOW1 4RODB 4NQUA 4C56B 4J3OG 1NKOA 1LK3L 3CFKB 4X0KB 4AEFA 3LKQA 1N64L 2HTKC 4IGBA 5DC0A 5FYKL 5D7KD 3LOWA 1ZVNA 4QY8B 3APDA 4PCTA 5SX4H 3UAFA 4XMPH 4UDUA 2GK0B 1FFPA 1E9QB 2FJFA 4G6KH 1E3FA 2JKJA 3OC8A 2VC2B 4XPTH 3C08H 2FX9L 5MERB 4UDTB 1MG3C 2CBPA 3JSSA 3TO4B 3ARDA 2X4SB 3WMSA 3BP4A 1XIWC 4GUCA 3OG4B 1W6LA 1X5AA 2Z92A 4CJ0A 5E23A 1K85A 5DJZB 4KTEL 3B9DA 4DNLA 2NYKA 5J4MA 3RDTB 4P2QD 3LQAH 3NEXA 2BIHA 5JW4R 4PRBB 3VD7A 1CBVL 3VI3A 2XJKA 1YYLL 2Z6FA 3ULSA 1CGSH 1RVFH 2WCGA 4OD2B 1UGNA 1AGCA 1CR9H 3JTBA 4WI7A 4FQCH 3V55A 1AACA 1FBIL 5GGTH 1TGHA 1QN8A 5T3XE 1RZFL 1KEMH 1NINA 4ZMNA 1QR4A 1KY6A 4JQIA 2WN2A 4ZQKB 3K46A 4PJDF 5IMLA 4HSCX 4ZO6A 4AV4A 5D72H 3MRHB 2JK5B 4OM1L 3PPSA 3GPEA 2V9RA 5HYSB 1SOQA 3KPLB 2ZUVA 3LDBC 2Z8VC 2D9CA 4AM0A 4NXKA 1U4FA 2Y6SC 5T1LA 3SPGA 4P46C 3V0AC 4FLSA 4ECNA 2ZPKH 2BOCA 4OI7A 2HB0A 3ECBB 3VDAA 3KM2A 4OBRA 1U8NB 3MJ7A 3MRIB 2VO8A 2BVQA 2JKLA 3DIVA 2DMKA 2OMVB 4KNUA 4PJDB 4OU3A 1PYWB 1T7XA 2CWRA 4RA0C 3D0VA 4MMZB 3WKMH 3MLUH 2UXFA 1BZ7A 4L37A 4DVBB 1RUQH 2G9KA 3AT9A 2QVMA 4OZFG 2YA0A 2A4CA 3MKGA 2ESVA 4R4ND 1E6JL 1GC1L 4M3KB 4PWIA 5L2KE 1NLDH 1XCQA 3BN9C 3TASA 1GIGL 3CSYA 3ELAT 3ZRFC 5C0CD 3FTGB 4RGND 2NNAA 5F7EL 4KX7A 1KCSL 1LWHA 1OCWH 1JZHA 2QADB 3AMLA 4H88H 4XWOD 5JORA 1HZLA 2WTPA 1DQLH 2DDQH 3EH4B 1XH2A 5GPRA 5B8CA 1WH0A 4PJDE 2WVVA 2X89A 3HB3B 5GSRB 2IGFH 3UTZA 1M56B 3IGKA 3QO0A 3SDDB 3OF6D 2GY5A 3CIQA 5CHNB 1UASA 3QIUB 3FU8A 3G6DH 1NCCL 3GSVB 3VXUB 5CU9A 1OALA 3OR7B 4X8JA 1JNNH 3PHOB 2YOCA 4M5SA 1DLHA 4Y7OC 3TZVB 5B1JA 1RU9L 2WCSA 2DJSA 3MGOB 5J6HA 1OF0A 2JCCF 3IDGA 3QP3A 3POCA 4EKJA 4DULA 4KO6A 3GTNA 4YHNA 3WSQL 1OGTB 4K2UH 3QS2A 1KJVA 3ENOC 1K5NA 3L3JB 1JVOA 1VHPA 1JCVA 2YPKA 4F27A 2NW3A 3CC5B 3CXHJ 2HSIA 4U1NA 5I1JL 3BDYH 4D7RA 5LUMA 2FD6H 1TCRB 4TTDD 3MXVL 1U8MA 1TZ8A 3VXUE 1XF2B 3C6SA 1JDYA 4DEPC 3DPTA 2F9BT 1NQBA 1B2YA 5K9JH 3GI9L 4XNAA 1NIDA 1YNTF 4LXFA 2IWKA 2ZWSA 2P80D 1RZPA 2F74B 4K8RH 1ZVSB 4O2FA 1QN6A 1J8HB 4OKVA 5D6CB 4OCLC 1NBYA 1QSEE 1YA5A 3Q1SL 5T3ZL 5LAXB 2A9DA 1A02N 3MLZL 4R2GC 3WAJA 3GGWA 1A6PA 1TDQA 4X6CB 1G7HA 5ANHA 5G5DA 1WV7T 4ROCB 4LKXB 5ESVA 4XT1C 4G9DA 4XB8A 5LG6A 3IFOB 1SJEA 4JN2B 3K71A 3D6GA 4R26H 2JCCE 3JV4A 4JZNB 3EGSB 3FQ2A 2IPKB 5ID0B 3WJLC 4F15B 2WLYA 1F4WH 5L4MA 3ZO9A 2B2XL 1J8HE 3L5WA 3JZ7A 3IGLA 2Q6WA 3NIDF 2ZOLA 1ZLSH 4HPHA 1DJSA 4EN3D 3ZBMA 2Q8AL 2WKOA 1M7IB 4ZW6A 3VH8A 1D5XA 1LMIA 3H8NA 3O9WD 3HPJB 4XO3A 3DOSA 2BPBA 1RZGB 2YA3A 1BD2A 1INQA 1CD9B 1D5RA 4GXVH 4EDWL 2V7HA 2EDQA 3OLIA 4EVNB 1A6VH 1XXDC 2F8XC 5C8JA 5GS1B 1JPTH 1DDHB 3PHQA 1TEFA 4XZ4A 1EXUB 3QORD 4PRHE 4FA6A 5M94B 4UYPA 1CLYL 2ARJQ 1LVEA 3NJLA 4G8IB 1MJ8L 2EVHA 3FTVA 3VXNB 4YOKA 4YHPA 3RX8A 1I9JH 1GAFH 4NRYA 4DPCX 2NXZD 2FWOB 2VL5A 5CGYD 5DK2B 1SQMA 3B3IA 5GHWH 1V7MH 3SDXB 3EKCA 4LHUD 4PJCB 3S5LG 4NQSB 4KJYB 3DJTA 2PYEB 4PJ9D 3MRCA 4WW2F 2HMIC 2BFVL 1RUPH 5D7SH 2XN2A 1J5HA 1UB5B 1FHNA 3BX7C 2AEIT 3OPUA 2MCPL 1EEQA 4J2QA 5KVEE 2QVFB 2CO6A 3HS9A 2D7MA 2VMEA 3F6IA 1JZ2A 1MJ7H 4YWGL 1OY3B 4RZKA 3P30H 1GMIA 1OAJA 3L9EA 4N9GB 5DLML 3BEWB 2JV6A 2Y24A 5D1ZA 4HJ0C 3TBCA 5AB2A 3V52L 3NJKA 1UOKA 4PJCE 1CICD 2OSLA 2ZZUT 3QDJD 4ISVA 5BOPA 1H15B 5IWLC 2XV6B 3LKPA 3D50A 5HGAB 2OSXA 4FYSA 4AKPA 2JE8A 4HJJL 3NPSB 1SXZA 3C9NB 4WSKA 4N0FB 3VXSB 5J0BA 3P0VH 1T0PB 2OPCA 2J7LA 4JY4A 5JHBA 2K8QA 1XV8A 1KXVC 1MREL 4BJLA 2F5BH 2YSTA 2Y7QA 4YDLC 3DJRA 5EU6D 5TQ2L 5FWRA 4EI6A 5IBUG 4F7PA 2DQUH 1U92A 3DUHA 3ZKXB 1HXMB 4QXWA 2LU5A 5A7BA 3HE7B 1JZGA 2VR7A 5D4HA 1RZQA 3CZKA 5D2NA 1S7UA 3WEOA 4YEFA 4GAJL 4ZMWA 3ARGB 4J3UA 5JXAL 4JO2L 3I84A 3VXSE 4DEUA 3WMPA 1OPOA 3L3DB 3V6BR 2YMTA 3K2IA 3D0LB 1MQ8A 2X70A 4EKXA 5A2LH 3B9VA 4QAMB 1H3GA 4OLUH 4PRNB 1CFSA 1IV8A 5AUMB 1XCTB 3L54A 3QZWG 4G72B 4GW1A 4N2BA 2LQRA 3TPUA 2MOQA 2XZZA 3Q0HA 1SHXA 4DTGH 3MUGA 2ZG3A 4Z9KB 3T0EB 2XG5A 5EB9A 5IW3A 3DX0A 3BP5B 5D7IB 5DD3H 3RZCD 2PCPB 2ISDA 2KQMA 3EFFB 4WNSA 5JNYB 3W9DA 2H1XA 1Y6KR 2VXSL 3VM5A 2YRPA 4LLWA 1TYEB 5GISL 2P26A 4L3FA 2IQ9L 4YSDA 1KIPB 3QIWA 1ZGLA 1M7DB 2YFOA 5IVXB 1J88A 4UTBA 3US9A 4LQ1A 1S9YB 1ZLVH 2PXYA 3I02A 2QQNH 1RURL 4DGYH 1RK1A 2MOVA 3CPLB 5DZJA 1I8IA 2WQUA 5KYXB 1KBWA 2WK2A 4XO4A 3CH8A 3LSOA 5DD1H 3T0EE 3UAJC 2PPAA 2GTZA 4HXAL 5JW4Q 4HUUB 1S3KL 5AWNH 15C8L 4HPOH 5D7IE 5BXFB 2X9XA 2CGRH 4C8XA 5ABAA 3QJSB 1A66A 3WN6A 1KXQA 4H8HA 1E9OA 3UOAB 3AB0C 2QQQA 3WNMA 2O4EA 1D9KD 2IMMA 3WY2A 3M7OA 1LWYA 1FE8L 4W4OC 4NUQA 4JHUA 5K5YA 4CGTA 3U6XA 1CDUA 5DD5H 1BVKA 1WA2X 5DVPA 2YK1L 4EZKA 1RZJC 4HQQH 5J13B 2OK0H 3HHSA 4B9KC 4G1EA 3TGXA 1N3NB 4OGXH 3OGOE 3RVXC 5L4IA 2CPUA 5JO5B 5TK2A 1R0AL 1J48A 4ZPVA 1RZ8B 1TQWA 2H32H 1CF8H 1K4CB 3BYYA 4U1MB 5IM7A 1CG9A 1MCPL 4GKNB 3KLSA 2HG5B 1IU1A 1ZMYA 4ZOCA 3ZSSA 2Z91B 4G42B 1CDIA 4LKCB 3BRDA 3JWOH 1RL1A 3KLQA 4I18A 4AQ1A 2HT4C 2BS9A 4W4NA 1IGYA 2B5IB 5D7LB 4EUPA 4M5TA 2TSAA 4H2CA 2BIIA 4JRXD 3BHBB 4MCZA 4AG4L 4F24A 2VE6B 1MDTA 4NWTH 3MXWL 1DFXA 2QHRH 3Q8AA 1NICA 3PL6A 3CVHH 4RMWA 3MLYH 4H8WC 3TVMD 2X2JA 2PCFA 1NDMB 4MQXC 4N0YL 3RTQD 1LGVA 4XP9L 5C6WH 3RWFB 3VB8A 1TVBB 4GQ9L 1T1YA 5INCA 3TXAA 1FG2A 3NCCB 1WBXB 4LHJB 5TE4L 3MUY1 3TN0D 4HG4J 2ED7A 2IEPA 5DO2C 3AREB 2OMZA 2JSFA 1KLFA 2E9JA 4NZFA 3RIAK 2ZICA 4HT1H 5IHUH 4QO1A 5E9DB 2NY4B 1J11A 3H0TB 4LHQB 4HZLB 1A1OA 4Y0GA 4YBLC 5EPMB 4IM8A 2E9WA 3VU2A 2DQIH 3K72A 4V1DA 1CGWA 3OM3B 3EDEA 4P2RA 4KZDH 5ACZB 4GAYB 3S37H 5SX5K 3JV6A 2CLVB 2N56A 2KBGA 1P7HL 4KXCA 2JTYA 2V5TA 2UY6B 4GNKB 1TTGA 1MHPH 3F65A 2Y8QA 1J0IA 1DN0B 3P1VA 5BVJB 1BQHA 4P2OD 5E9DE 5TQ0L 4QNPF 4AMKH 4PLNC 2X4NB 1XF1A 5EOTA 1DBKL 4XBMA 5EBMB 5T5FA 1KTDA 3E2HB 2FKFA 3I74A 3CSTA 4JM2D 4PRID 3UTTD 2EE3A 3LPPA 4HHGA 3AY2A 5FM5O 2P5EA 3WY3A 5I8KL 2D0FA 3A67H 4XGZA 4JFSA 2LU4A 3BESR 2JPIA 2D7TH 1ZGLP 3BT2L 1ZHLB 4P05A 3B7RL 4I0PC 4XCFH 5SWZB 1GL4B 3LZQA 3CZUB 4HG4K 4L3CB 2A83B 1IBZA 1T21A 2XG4B 2X1OA 4W6WB 4AIEA 3WFDH 1QRNA 5A7EA 5DHXB 1T0OA 4R7XA 4JG1H 1EPFA 5DFTA 4ZFQA 5IUSA 1CO1A 1AR1D 3NZHL 5A2BA 1UXSB 1I82A 4UM8A 5LNEA 3H1ZA 4KDWA 3V4UH 2YWYA 5ESAB 5TPWL 3S97C 2OBGA 2JTDA 3HG1D 5DJ6A 3UADA 4G11A 5AG8A 3MUUA 1N5YH 1AXTH 4P59L 2AEQL 2PWGA 3FO1A 4WDIB 1FA4A 4MS8D 4JFDA 1IT9H 5SWZE 1CXHA 3ET9F 4N0UB 2JF1A 5E2WL 1KG0B 3RBGA 1A25A 1I9EA 3K81A 4FI6A 3O41B 1Q8MA 3U6RA 4M1GL 5D1XC 4A7SA 1DO6A 4HH9B 4POZC 1OCCB 2F58L 2FK9A 2Y5TB 3IJ9A 4K3HA 5ANMA 4EI5C 1H6FA 4G6MH 3V0JA 3TA3A 3QJZA 4A63A 3O6KH 5E8OB 4HGWB 1NCHA 2UV3A 3F58L 3ETTA 1ETZB 1DQQB 4MDIB 4P23C 5LNDA 4FJ6A 2G2RA 2OMUA 3O6LL 4U6HB 4CNIA 1IM3A 4PQXA 2CSPA 3OAUH 1YYMH 4N0UE 2UY7B 2XFXB 3S8WA 3QDMA 4L3EA 4FTDA 5HJ3B 5I6NA 3LHPH 4PI0A 3RX5A 2DQJH 4L4VB 2N7BA 1MRFH 3HZMA 4AYEC 5J06A 2R56H 3DXAD 1OE2A 2AQPA 4JO4H 2NR6C 2CO7B 1CCZA 2Z4QB 2ZUXA 4AJ0A 2VISB 1T04A 2CJ3A 2B8OT 5L0QB 2ENSA 5JHDA 2W9DL 1W72L 5EIIG 2DD8L 2F54B 1QSFE 3GSOA 4LPXA 4UQAA 3FRPG 3UAAA 1I4FB 2JJTA 2EUXA 5E4EB 5JYMA 2VZTA 3L1OL 3TWYA 4XTRD 4YPJA 3TH4T 2BNUB 1NMAL 3W81A 4AYBA 2VDRH 3SZKC 5ITFB 1PG7L 2OX5B 1ZT4A 3HN5A 3BLPX 4EALA 1P4LB 1SRDA 2NCMA 4L8DA 1U8LA 4PV9B 4C83B 2J5WA 4ABVA 2DBLL 3KNBA 3LS5L 4D8PA 1IKFH 5B3SB 3NZ8B 5IGXH 1NIAA 4GBXC 5JMOC 1BF8A 5HSHA 5I16A 1RHFA 3L16A 4Y1AA 2CXKA 2KLRA 3HEIB 3T2NH 3U46B 4XNYH 4BFIA 1PGRB 2PNDA 2F54E 4R0LC 5ILTL 4LNVA 3WTVA 3E6HA 4NQTA 5IZ7A 5JOFB 1JF1A 4DN3L 1PVSA 5AFAA 1I1AD 3MNMA 5DT1H 2CUIA 2DTSA 2OXGB 2OJZH 2YO3A 3F7LA 2QLYA 4RWHA 1ZJAA 1KV7A 5JW5A 4ZAKC 3LN4A 5DMIH 5SX4I 2WXKA 4XNUH 4IGBB 2YGPA 3SO3B 3U2SA 5KVFH 5IROA 5CS7A 4GP5B 4JCWA 3VI3F 4GKOA 3PS6A 4UDUB 3R4DA 5DMGC 5SV4A 4HXBL 4U2ZA 4Z77A 3O2VL 5KVFE 2W65B 2G9HB 3NP4A 4JPIB 1NFIB 4L5FH 3SDCB 1SF3A 2WQ8A 5IW6A 5ISZD 5DHDA 4MB1A 5IK3B 1A1MA 1H6UA 3BP4B 3BAKA 3MLSH 5DZAA 4DKAA 1U8QB 1VRSA 1PAZA 1U58A 4S0TD 4Y2DA 4BKSC 3UGXA 4BSVB 4L5FE 1NAMB 2NY7H 1L7TH 2D31B 2BRQA 5GS0D 2F53D 1A8JH 3LRHA 3RVWD 2BLFA 3D69B 4FXKB 4PAZA 5KYUB 4ONFL 3QWRD 3BVXA 5C0ND 2VDMB 3I0XA 3L17A 4F33B 4PEEA 3PWPB 3F5WA 3CNKA 3FU6A 3Q13A 3VYOA 4M43L 3EZ8A 4S1RL 4TSBH 1O7VA 3FB6A 3OQRA 2J5LC 3QUKB 1EJOL 3WFEL 1J1PL 1YMHB 3ISRA 3P73A 3QI9C 4RFNB 5IMLB 3DHUA 4ZPTA 1U2YA 1UT9A 4NKQB 3MRQA 5HJBA 5FO2A 4WZ9A 5F6IC 4FCAA 2BK8A 2VT0A 3KHQA 4IRZA 1QQDB 4RRPM 4MCYB 3X13A 1QVOA 3VI3E 2Y5EA 3D33A 1T2XA 3TBYA 1U3HB 3VTAA 5TE6H 1E43A 5T1LB 2DQGL 2Z3FA 4JQIH 2FQEA 5FA3A 3PWPE 3OZLA 1FNFA 2J44A 3ZDXF 4M8RA 1Y18A 4W9GC 2WSPA 3VWJD 1RPUA 3SPVA 2FVNA 1JDAA 5GSVB 4HJGA 3IYLW 2A6JA 5KSAD 2XHNA 1VGKA 2K9UA 1SMOA 3GSXB 3GRWL 3MNVA 3ALXA 4DHLA 5EF3A 3GBNH 3D0VB 1W0WA 4N0CD 3KCPB 3GMOA 2GI0A 5TF1L 4KTGA 1C9BB 2HTKD 5T1JA 3RJOA 2ESVB 2DEYX 2D9QB 3E8UL 1I1FA 3NEOA 5DQJA 4AL8H 4ODHL 5FV1L 2M8XA 1ODUA 4OFPA 3FK3A 1L9TA 2IDQA 2AKRA 3BSZA 1QBML 5HVWA 4IMKA 1DVZA 3M8OL 1DQTA 4TNWF 4WW1A 1X5ZA 3QDAA 2WN3A 3CX5K 1SYVB 5CAYB 2CNYA 3ZMEA 2FIRT 5EO0B 3UTZB 1XIWD 4X6FB 2G4GA 1MG2C 2GJ6A 5F89A 3DYOA 3O8XB 3V4PA 1CE6B 1GYWA 2SODB 1UZ6F 2VH5L 2X2UA 4HJUA 2ESVE 4JL1A 5JPMC 4JFEB 3LRKA 3D34A 4P3DB 2FUQA 5BS0A 1KXTB 1MIEH 3OWEA 4YLCA 4MBRA 1IBYA 2PP7A 1PBYA 4YHNB 1AOZA 5HHQB 2CH8A 4Y5VC 2IAMC 3NSFA 3RPIA 4F7KA 1XGPA 2Y22A 4XPFH 2IH9A 1S9VB 4X98A 1EZLA 2CALA 3MMEA 4G82A 1S9KC 3U36B 3HC2A 5I8CB 1HEZA 3ARFB 4DO5A 1U8MB 2C9UA 2UVFA 3AGWA 2V2TA 2OI9C 1IGFL 1MW0A 2EIKB 1JD7A 4OCNC 2EVFA 1FORL 3RVVC 1FL6A 2R1XB 3GT6A 1KUMA 5EU5B 1JUFA 3WEMA 1WBZA 4QRPB 4V11A 8PAZA 2Y6SD 4YZFE 4P46D 4S0SD 2R23B 5CBEB 5JIPA 1NM9A 3TNMA 2V17H 2VQ1B 4O2FB 5I30H 2L7EA 4XMLH 5IEKA 2YQ3A 5I1KH 4AV0A 2ITDA 3QARA 3K1KC 5E03A 3M46A 3GGWB 4M8QA 5E1AB 1KACB 2JELL 5KZCB 4QGTA 1JHTB 1BBDH 3MLXL 4RDQF 1U8HA 4G9DB 1UZ6E 5CJXA 1SJEB 4PUBH 2E74C 1Z1WA 4LAQL 1HXKA 5LBGA 4C47A 4NQDB 2NLJA 3JV4B 3N42F 4FNSA 4EZMA 1O6VA 3BN9D 5KBKA 1Q72L 1ZA3A 4D8OA 2BVPA 1YUKB 2YD2A 3SQRA 3DA0A 1NL0L 2CLZA 2DYRB 2PKDA 4PP2A 2P8MB 3PP4L 2ETWA 4BZ1L 5F7UA 4L4JA 3T4YB 1CXIA 1XR9A 4ZTPH 2H9GA 3OAYK 3QEUB 4ONGH 4PMEA 4HWZB 2C9PA 3VFGH 2QHLA 4HD5A 5BV7L 5C0DA 2ZCLH 2V7HB 1WWWX 2MH4A 5BJTA 4XBPA 3KPOA 3ZT7A 4TS6A 2LVEA 3WHXA 4LOUC 2P9RA 4LLAA 1INDH 3PHQB 25C8H 2MKLC 3MREB 3F7VA 1P6FA 4YUEH 5A2KH 1A6UL 4NN7C 2B1OA 1J87A 5FR3A 2W60A 3IU3A 4KK5C 5ALBH 5DZOA 1T6AA 4M5YH 3KLAB 1BM7A 1QTPA 3B2PA 1E28B 4OF7A 1A4CA 5DWUL 3KGUA 4RGOL 4YHPB 1ZWIA 1HWGB 2X6UA 4XXCA 5HYJA 1BD2E 3B3IB 4JFQB 4O00A 5IBTH 1KTRL 1SMAA 2G3ZA 4KI5C 1RLWA 4IMLB 4MSWB 3MRCB 2I5WA 1AYOA 5JR1H 5J3HD 4ZOAA 5I9QC 1URLA 1PKQA 1WS7A 3CV5A 5F6HI 1NLBL 2YMXL 3H3PH 4CC4C 1YN6B 2P3YA 1NBZA 1N7MH 4OD3H 4R2GD 4OCWH 1Q0EA 2PO6A 3K0WA 4JMNA 4XCYA 1T03H 1IC5H 1BAFL 1P1ZA 5DLLA 5E6IB 1FAKT 4FQIL 2CKNA 1XGYH 4QJ4B 4NP4L 4CVWA 1I9RH 4C58B 1O5PA 1NCUA 4XPHL 35C8L 4MQ7A 1MLBB 5I18H 3TS8A 3QIBC 3GB7B 3N41B 4HPYL 1F4HA 4XMWA 4TNGA 1NUGA 4NZUH 4PLKC 5AAWC 4L8CA 4JY4B 5A1AA 3BJ91 2DLHA 5DUBA 4IS6A 2DQEH 5ICYB 1A7NH 1YNKH 4NJAH 5ENWB 1MAML 1BV8A 3WXVH 2J6EL 1XGQB 4NCC2 1XF3B 4WWKB 4PJ8A 4Y16A 2Z7UA 1F6FB 3FSZA 3WXWH 3WS3A 1WITA 2L4OA 5L8JB 1I3GH 1DSFL 1T6BX 4QHUA 4YBQC 2C9QA 1KIUA 1ZLUK 4K23H 5C0IA 4XNMB 5IFJA 4MS6A 5DA0B 3F7YA 4XX1G 3REVB 4M4RA 1BF2A 3MHZA 2X70B 2E9BA 4G6JH 1E4HA 1UEYA 5GRUH 3INUH 3NFPB 2D3LA 1VPOL 4OZFB 3PJSB 4PW3A 1RQ5A 1JIBA 1ZSDB 3VFWB 1YMMD 4GW1B 1F5WA 1BVLA 2IWEA 2MNWA 1SM3L 3RY6A 4RMSA 1YQVL 3OSKA 3MUGB 3QPXH 5CJQH 1J9RA 2W0FA 3RDJA 4M7JH 3JZYA 3ABLB 1YEIL 4L2YA 4QRQB 1G7MA 4KMTH 2A38A 4QXUH 3JWDC 3MLRH 4BUQA 1H6EA 4NNPL 3HC3H 3OSTA 2HMID 1CQYA 3ZR5A 1T3FA 3LMJH 4LLWB 1R5VA 4X80H 4CSZA 3X12A 3QIWB 1ZGLB 3MDJA 1WF5A 3W3BA 3FUNA 2C9XA 1DBML 1E8XA 4KZEH 4FULA 2XTJE 5DFAA 4Q74A 4UYQA 5ECGA 4UQDA 4WFGE 5LBSL 1D5IH 3OMAB 2VIRB 2GSIB 3MLTA 4HJ0D 5AVWB 1SZNA 1KCRL 1WD8A 2H3NA 3F0ZA 1ZIBA 3C12A 4UTBH 3LKNA 5EC1A 3QEQD 2DY2A 1QLEL 3BIKA 1TZGL 1RZKL 2PWDA 3RPJA 3DVIA 3VSVA 4D9LL 4Q2ZA 1HN1A 1J5CA 3R4RA 4B0MM 3ETBJ 2WLLA 3FO2B 3QHZL 2FECL 4MNHB 4FFTA 3V7MA 2ZYHA 3V0WH 5E8NB 1CYWA 3LH8A 4WX8A 4Q9RH 3PP3H 4HCGA 4G1EB 5FO8A 4FL4C 2B0SH 3TV3L 5D7JC 4DCQA 1UA6H 2A6DB 3MCKB 1T80A 5D7EA 3BPOB 1IVLA 5TGBA 2VTFA 3VMPA 1DL7H 4ZPVB 1JFQL 2A1WL 3FH7A 4K5MA 2R2HA 2CKBA 3C60C 3I50H 1CG9B 1YZZA 2HZHA 3I9GL 3ZQ9A 5IB3B 3SOBH 1VENA 3K8LA 2GB2A 4O5LL 1CDHA 1DUZA 2G3MA 2LAGB 1AKJD 4I18B 4OI9A 1ZANL 4RLDA 3C2AL 2FSEB 4QLWA 4MCZB 3L4CA 1ZXKA 3IDXL 4OCRL 3O81A 3W38A 1LILA 4X6EB 3FU7A 3UBXI 2WKGA 2IALA 1YN7A 5IQMA 3QULA 5L6YH 4ZO9A 3D9AH 3LN5B 1XB3A 1T1YB 3QJHB 5INCB 1OSYA 2ZAGA 4M1CC 1AZCA 4EUPH 4KX9A 4FQ2L 5E6ZA 3RNKB 4FG4A 1N4XH 2HFTA 2IH1B 2Z1PA 4QO1B 5DUML 2OMTA 2WWNA 1XL6A 2AXGB 4LLQB 4V1DB 2BCMA 3P77B 2X0UA 1LO2H 1OLZA 4KDTA 4P2RB 4X7FC 4F37K 1Z3GH 3UAJD 2AJVH 3FN0L 2QSTA 3QCTH 1M9SA 4X83A 5KOVC 2LT9A 3DX9A 4J3SA 4LRNL 1XR8A 2NOFA 4YNYA 3JT0A 1MCWW 3N55A 3RA7L 5I5RA 1OT1A 2DWXA 2ZUYA 4JY5L 3ROOA 4X7DC 5DTFA 3AT0A 4F58H 4ZUUA 1OPGH 4W9ZA 4LP5A 5F8QC 1L3NA 2AV7B 3IDNB 4V1DE 3T3PF 2OMWA 4P2RE 3AY4A 2YR3A 2P5EB 4TVPD 3RVXD 1QN3A 1C16A 1BW8A 3OGCB 4NP9A 4YGVB 5BVPH 1L9SA 5HDQL 2AJ3A 2AQTA 3OKKB 1U8IB 4Y4FC 1RAMA 2WZ6A 2CU9A 1UWXH 1J5OH 2OL3L 1AQKH 4U1HB 2I5YL 2I69A 1MY7A 5T5FH 1AGBA 2QR0B 4R90H 3U7YH 1C5CH 2F08A 5T8IA 2OJEA 2DH2A 4ANXA 3GJFB 4KGJA 1A1NB 3PPEA 1TR7A 3WE6B 2XZAH 2Z8RA 2HT4D 2J43A 1S9XB 5FYLH 2XI9A 2EDHA 5E9NA 5E2UH 4YHZL 3W39B 3TO4C 3Q8CA 3GHPA 2P5EE 4F1ZA 4RAUA 5B1BB 4AZUA 3WFZA 3ABMB 4RMQA 1PG7X 5FKPA 3EF4A 2Y23A 2F7OA 3FO1B 3LPGA 4PJ5D 4MQXD 5FYLE 1WJ3A 1DE4B 3J07A 3DROB 1KV3A 1P4BL 5DO2D 2QQLL 1QRNE 4IK6A 3U6RB 4JHAH 5E2VH 5F21B 4DVRL 3EO1B 1BFTA 1BGXL 4BK4A 4Y5YB 2DI8A 1PVHA 5ANMB 5LLIC 1W0VB 3K2KA 4PGDB 4WHCA 1I8LC 4MA3A 2XQBH 3SKJH 2CCLA 1JN6B 4XO5A 1JPFB 4EQ3A 2G2RB 4QDGA 2OMUB 4I9XA 4JFDE 2RGSA 3KYMA 3SE9H 3QZWB 5C0BB 2PPFA 4PB0H 4MJIB 3FU0A 3H4HA 4JO8A 1IC1A 2IANB 2QV2A 1XGZA 1HHKA 3L5XH 4OJFH 4Q6IA 1QKZH 3WNPA 1TMCB 1BA9A 5CZVH 3DX7B 3HI6H 1WUZA 3MV11 1MWAB 4NHCL 3UYPB 4HUXB 1G5GA 1T04B 4HJEA 2F15A 3IF1B 2WLKA 5ANME 2AK4A 3D0AA 4J8RA 3BPCB 5K93A 3UPRB 1MCBA 1XGRA 3GSOB 3IE9A 3IXAB 5D93C 3O3UN 2BINA 3PNWA 2H41A 5TDOB 4M1DH 5IT2H 2WVSA 3QDME 2H2PC 4L3EE 5I8OH 1BPLB 4I0PD 1KF9B 4JX0A 2ADFH 5EBWB 1AZZC 4HWUA 2HVKA 2BS71 4FABL 4MJ2A 3FONA 3Q8FA 3ZDYF 2UZYA 4QOKD 1YG9A 2OJ1A 5FF6A 3D18B 3HPLA 2FEJA 1GYAA 4AY0A 5BQDA 3AMKA 1T5WA 1LNUA 2WANA 1EERB 4I2XA 4AGMA 2D3JA 2HKFH 2FJUB 4IRJC 4KJPC 2XWEA 3S4SG 3NESA 5JW5B 4XCCH 1Q9OA 1JTOA 4H7VA 2CMRH 5HGGS 2XWRA 1KWKA 5FFGA 1GW6A 2PP8A 4GKZA 4LAJH 1MFNA 3CFJA 2X6MA 3MBXL 2ZKHH 4U1KA 3CZNA 3VH8G 4RDQG 5D1XD 3B56A 3PHSA 3GEFA 3GKZA 4YFDB 4EIBA 4I89A 2CO1A 4ZD3L 2QSQA 4POZD 4NQCA 4KI1A 4AGPA 4EI5D 1H3PH 2G60H 5IW6B 1RIHL 2VKWA 1QPXA 1HDMB 1OAUL 2GIYA 3E38A 1RFDL 3EOTL 4RGMB 4UQ2A 3TEXA 5A6IA 2OXHA 2XXGA 3K3QA 4MNQB 1U58B 4K8RC 4MKTA 4P23D 1MN4A 4Y2OA 2CXGA 2QEJA 4Z0XA 2IDCA 1U41A 2Y7LA 4HIQA 2FSDA 3N1PC 4N2KA 3WHE0 1I8MB 2ZKWA 5IB1B 4W9KC 1QNZL 1LQBC 4ERSH 3NK4A 1NGQH 1JK8A 2Y06H 5CILH 5DUPL 2YPLA 1JP5A 2NR6D 2Z0BA 7FABL 2NY6B 4WI0B 3F5WB 5GGSA 4FD0A 4WO4B 3MUJA 2YD1A 2DM2A 3VGAB 4DW2H 4K3JH 1T5XB 5H8DA 2KZKA 3KPRD 2EDYA 1W72A 2FRGP 3K2UL 4N6QA 1XB6A 1OSZA 3K6FA 4OZIA 4TOYL 1BYNA 2X4PB 2WBJA 1K8DA 1F41A 1QVOB 4K9EH 2AV1A 3MNWA 3E6FA 5AVUB 4X4YA 3MLVL 4GBXD 4ZFGH 3DKHA 1ZRUA 5TTRA 4AW7A 4KROB 3ROLA 2VDKL 2AABH 2AXHA 2UYLB 3EJQA 5FKAA 1F90L 4PJXA 2PWFA 1CLZL 4G7RB 1U6AH 3EDDA 3GMRB 4HJGB 5AKSA 2GEQA 2DWSA 4LDEB 4IRZH 1I3VA 2VLKB 2K3HA 4JLRB 3MNVB 1Q0XH 4ATWA 2J2ZA 4YIQB 1JYWA 2RQEA 3LEVH 4FFYA 4ZAKD 2PR4H 1R4XA 3QCUL 3ZYJA 3BUDA 4LSVL 3GSWB 4XAKD 3VG0L 1Y1DA 5DQJB 1Z5LA 4FEMA 3BSHA 4GXUM 1JNHA 5I66A 5GS1C 5DMGD 4NN6C 1FVCA 4JE4B 3AWEA 3PABB 4HFUL 1ZTMA 2Y2TA 4ZK8A 2EIJB 3C09C 4LBEB 4DGVH 3NJXA 3QAZC 3JBG7 1M05A 1HQ4A 4YDVA 3L3HB 5AAMC 1X5YA 2QKIC 4JFZL 5K9KB 1A0QL 4K5LA 1REIA 3CSGA 4ZOEA 1SJHB 3H42H 3ILPA 5EU4A 1B90A 5E08H 3HE6A 1G0XA 3BSZH 3U25A 4CC1A 4Z7NB 5J1AA 3RZWA 1PLAA 4HBCL 4IBSA 1JGUH 5HDLA 1F13A 2Y36H 3BRGC 2WGNB 3QUMA 1L0PA 4DK6A 2XA8L 3C2SA 3RPIB 1N8OE 2HX7A 3KYAA 5E8EA 3F2LA 4WHDA 3V4PH 1MH5A 3S34H 3JTSA 4QYOA 1VADA 2C1PA 2QVKA 4F57L 5TDPA 2K6ZA 3QQ3A 3QI9D 4FQ1L 1HEZB 3GNMH 1NFDA 4Z78B 1T2QH 5TDNA 1F6LL 3WDIA 4P4KC 2H6PA 5GJTL 3KVDD 4FQLL 2IOMA 2BJMH 1FL6B 3IE4A 5BS0E 2R0WL 3IJ8A 4WW2C 3FU5A 2EEBA 3SBWA 4AMXA 4DUWA 4Y19A 4A7GA 3NPSC 4PLJC 4UIMA 3I2CH 2C34A 1DDTA 1TVDA 1FNEB 1KGCE 3DECA 5CN2A 3TLRA 3II1A 3RWCA 2WKLA 1B4JL 2FBOJ 1Z2KA 2ITDB 3FUJA 4FMFA 4NQED 3KYKH 2B3RA 4TL5A 4JKMA 5I76A 1TTRA 2YUZA 4AK1A 1YEEL 3VGGA 4KPHL 5TE7H 4RWYH 4IHOA 4IIQA 2QPDB 1DBAL 4I3SL 5EOCL 1S7VA 3VN5A 3HI1A 1NC4D 2CHXA 3RWEB 4GG8A 1NKRA 5EIIB 2H5AX 1ODAA 1UXLA 4LCYA 1WRFA 1O6SA 4U33A 3UTPE 1P5UC 4HIHA 4XP6H 3W0WB 1HYSC 2A2QT 3IT8D 5I1LA 4FNUA 5E8PA 3DO4A 2BVPB 1X6NA 2GFBA 4QHNB 4AEIL 3VXRD 4XBGB 3Q2LA 3QJTB 4KVCL 2FYVA 4L1SA 1UUSA 2VDPH 4AQOA 3GZQA 2W8CA 4RMBA 1TO5A 4OF6A 2R8SL 1QTSA 2DKCA 1XSIA 4G1MA 4JBSA 4NKDA 2AXFB 4LFHD 4TUKL 3BKJH 4KFZC 4WU7A 1K4DA 4U4IA 3QUZC 5IJCC 1URIA 4R8WH 5LAPA 2GIXA 5K1JA 3KPOB 2OR8A 3OJDA 2EC8A 2VNCA 2WUCL 2BHYA 2EUVA 4XB3A 3FQWB 3RG1C 1VJSA 2IAMD 3OKMA 2Y7OA 5C0AB 3QXAA 3QR1A 4UINH 1BX2A 1ZLVK 4OUUB 2VL4A 4LSTH 3V8CA 1JWSA 3AUVA 4JHWH 2JI3A 3H9SA 1ZWIB 1BFVH 4A6YA 5F9CA 2NQCA 2VRAA 3EYSH 4MA1C 2KDYA 4XVUC 5EEVA 4WK2B 3TNNB 3UZVA 5FK9B 1AO7B 3RVVD 2PW2B 4GP8B 1X9LA 4ZUWB 3MJ8A 4ZMZA 5KJRL 4GQRA 3ESPA 5DD0L 4WUUB 3J8F7 3CLFL 1DP0A 3A6OA 2J1YA 2Z65C 3VMOA 4I3RL 1MFBH 3NRQA 2A77H 1NCBH 5EUKA 4XCYB 3MTRA 2FO4B 4G7YH 4UV7H 3KJ6H 4C7PA 3QRLA 2X5PA 1DANU 2QGDA 4ZSOA 1QEWB 4BEIA 2E8ZA 5HYJE 1BQHG 4GO6B 4PGCB 2XXFA 3LV3A 5J9PA 4L8BB 2XT1B 3KPSB 1FYTA 2VR3A 1AO7E 2YPVL 4JO1L 1XEUA 2NSMA 3JWOC 3TU6A 1NIEA 3DYPA 4TSAL 1GGYA 2DEXX 2E56A 3CTTA 4EOWL 4A7QA 5D1ZI 1PKQE 3O3AA 3FL7A 3SQBA 3MCYA 2F61A 3UC0H 5F0MB 4I9WE 1FGNL 4I4WA 3BAYA 4IS6B 3NCYP 1UH2A 1HQRB 5FGCE 4EDXB 1EAQA 1Z5YD 4RSVA 2A6IA 1IEHA 3MVSA 5I1IH 3EJYC 2EDNA 2YEQA 4HKJB 4PJ8B 4WI5A 4KQ4L 4Y16B 5AD0A 4HIJA 4PBWD 3RAJL 1ZHKB 5DZLA 3VRLE 1UM5L 2A4EA 3TBVA 2VITB 3U0TA 5IHZB 1DVFA 2BNQA 1A4AA 4J3TA 1NEZA 2IQAA 1ORSB 5SWSD 3FJTA 5F3HB 1I1YA 1CB4A 2ADIA 5C0IB 1BEYH 1U91A 3F7YB 4LOUD 2EKSA 4YXLH 4ZMTA 3DUSB 2R59A 3UIZA 4FXGA 2E7CA 1T7ZA 4W70A 4RDBA 4KK5D 1QWNA 2VDLL 2YQ2A 2F1AA 4TQ8A 1BVLB 1NGPH 2XHIA 3HRZB 4LP4A 4OLVL 5DJXB 4EDWH 4M7ZB 1NFAA 4N90D 3TBWA 4NM4H 2D7PA 2HN7B 2MRYA 4U6XA 1QFHA 1OTTC 2E59A 4OFIA 5F9OH 5KSBA 1PCZA 1G7MB 1VOKA 3L2NA 3ARYA 5AW5B 5KVMC 4JRYA 4XRCB 1NAKL 2PPCA 1RJCA 3WAKA 3NA9L 4DP9X 3WKPA 4PW4A 1M3IA 5G4MA 2HRPH 2ZWKA 1LO5A 5KW9L 2COQA 2VN6A 3CGTA 4H44C 1KPRA 1NC2D 2IDTA 5LWYL 3K1DA 3NOIA 1ZTXL 2ENPA 3UZQA 5B39B 1U4EA 5D6DC 5LXGL 3G5ZB 3MV8A 4HLJA 3RFZA 1F3DJ 4TUUA 4ZW3A 1EAPA 5CNHA 1PLGH 3MLTB 2XOTA 4ZW7A 4LEXH 3ZTDC 4CA4A 1A6ZA 3F01A 3KE0A 5CEXB 3MV7B 3N40F 3OZ9H 3QIBD 5CSZA 1W0YT 1WC7A 4Y88A 1H3WM 2VDOH 5IVZA 4U2YA 4PLKD 1OGAD 2Y1YA 3MOAH 1NCDH 3U82B 4OLWH 3WS6C 2A4ZA 1S8DA 1AD9A 2OR9H 1UWGH 1EVUA 3BE1H 5LB1A 3H7LA 1EX0A 2AS5M 3C8DA 4KRPB 3O6MH 3BVNA 2AZUA 2G75B 3LB6C 3IKCA 2WYTA 4TF4A 3AWFA 4QHKJ 2Z8SA 3DK0A 5BUAA 1CU4L 4MXVF 2CUAA 4GSDH 5FUZH 4KJQC 2YGQA 3O45A 5DJ2A 4BFOA 1EIBA 1EHLL 2EDWA 2R15A 2V37A 4YAQB 1A4JB 1MREH 3SE8L 2NYYC 1M42A 4W9CC 4HAKA 2A6KA 4Z7QF 4ZYKB 1PZ3A 1T89A 2R2HB 5E5UB 5C07A 2CKBB 5KS9F 4PJAB 3MRPA 2CCVA 3GD1C 1HINL 2HUHA 3MOBL 3GBML 2Q7NA 2P24A 1J1XL 3LRGA 4KXAA 2OW6A 3DSNB 5IQ7H 3UMNA 2WINB 2NY2C 1PS3A 4GAJH 3COOA 4GS7B 4ETQA 5IQ9B 3ULUF 1FIEA 3V10A 3I85A 4P06A 3C6EA 5KYWB 4B53A 2CKBH 1WT5A 3OR6A 4QI3A 2BNRB 3SDAA 2RAMA 2WLIA 4JR9H 3KL5A 4DZ8B 3FOMA 5ESQA 1S5IL 3GKWL 3NACL 4MWFA 3SB3A 1K6QL 1NOFA 3UL4A 3GMNA 1A3LL 4QKXB 1Q90A 4RFOL 2NX5D 3BZ4B 4Z7QB 5I1EH 1VGEH 3CPUA 3D4ZA 4HAFA 5H2BB 1LEIB 4P48A 4UZGA 1XH3A 4JB9H 5CF3A 4U7KA 1MI5B 3ESMA 3BAEH 4FNPA 1TZAA 3IBEA 5BMFL 1Z3RA 5AKRA 1OOWA 1JPSL 1T7YA 5AZ2H 3HNTH 4M6ML 3AACA 4NRZA 4MXVE 1JXKA 1PTZA 1IAIL 3PXJA 5GRJL 2BNRE 4JN1L 5JW3L 4BK5C 1YVLA 3E1ZA 4FCHA 4BSWB 2HFFB 1O5DT 4Q6KA 3RHWF 2DKDA 3O2WH 3SKNA 5PAZA 4E5XA 4Z7QE 4KNTA 4BE5A 1XR8B 4XNQB 2H0EA 2JHNA 3QUXC 5EA0L 2XN9D 2E9GA 3ULUH 3O11B 3OPZL 2YEVB 4PWEA 1MI5E 3IETA 4M02A 1X9RA 1RUKH 4ZUUB 2HRLA 5DRXA 1JNLH 3TYGL 2FX8L 4HXAH 2HVJB 3NSCA 2I85A 2ZTBA 5T1DH 1MVFA 3TPKA 4E2OA 2OMWB 3UTSD 1KDIA 4CADB 3D39D 1RIUL 5IVOA 5D7JD 2NW2B 4NPYB 5IFAL 4G8GB 5DRWB 4G6AC 3ARZA 3I6KB 4GQQA 1HNGA 3VYNA 1SHMA 3PWJB 1EBAA 4IGBC 3EYUL 3SO3C 5MEPA 4ZUSA 4O02L 1AGBB 3C60D 2IOOA 1ZE3C 3WTWA 4N2OA 1HIMH 2X2IA 3PV7A 2ZAIA 3EOYG 3EH3B 1IGIL 4O9HL 2Y5QA 4ODVL 3UCQA 2Y7NA 2LOEA 5GRWA 3VWKA 4F7EB 2HFEB 3MV9A 4UV4H 2OYLA 2XVKA 4ELMA 1A47A 4OZGA 4RZCA 1A6TA 4X50A 1XD0A 1F02I 3ARDC 5HHVL 5CCJA 3B2VL 4R4BA 3CDZB 3MYJA 3LXUX 1KCUH 3GBEA 2P28B 2J8UB 2JNZA 1R17A 4U1LA 1QFPA 1PX8A 2BP0A 1ZEAL 2LU3A 2WY3B 4HWEL 5DRZA 5MEND 3P3TA 4M1CD 1NMCC 2ZUSA 3WO4B 1XSKA 1UWEL 3PFQA 1PDKA 4U3SB 4ZXBB 2WLJA 2N3JA 5I1AB 4P5TB 4LL4A 2P5PA 3VRIA 1GGIL 1L6ZA 4RFEA 4F2MA 3EHBC 1OT4A 1U8OB 4N0YH 2WXQA 4KHXL 4NUMA 4LRIA 3IDUA 2F1EA 3BZDA 3O4LB 2A9NL 3ARBC 3P54A 4GQ9H 4ILDA 3MRLB 3O2DA 1QOKA 5FGSA 3VXMD 5EO9A 5AW1B 2WTRA 3P4MA 5TE4H 3U9PL 2WXIA 4MCMA 4U1IA 1M1XA 1KCKA 2X05A 1QACA 3ZX1A 2R2BA 4X9FA 2C7UA 4FZ8H 4N1EA 2ZOOA 4LOVA 1HHKB 3I9PA 4GMSH 4R96A 4Q6IB 4WIQA 3N44F 4M7KH 3CXFA 5HHNB 2WUBL 3L45A 3QNYB 3O6FA 1PF3A 1PZ5A 4OQ1A 1NZRA 3RWGA 2YOAA 4CJ1A 4Z3JA 2XX0A 3EUDA 2NSXA 1XGRB 4N2CA 3F04A 4J27A 1G87A 1P84J 4AL8C 4LGSB 4NZTH 1GHFH 4WTZA 4YXHL 4LSUH 5CN3A 3NCJH 3GMLB 5D55A 3N50A 1GSMA 1HHIA 3CVTA 1FL3A 3MRKB 4Y4FD 5C6PB 1GXEA 1CLOH 2OQJA 4FG0A 3BWAB 1OAKH 3ABGA 1AZBA 4P8QA 4EMZA 2ILLA 1QLRA 4JM4L 3QDGB 2HVKB 3A23A 1GSKA 4EPSA 2MZ8A 4FNTA 1QP1A 4NWUH 4AQAB 1UZ8B 3LKOB 3ZMRA 3W2DL 1GZHA 2FEEI 3VFRA 3E3QE 3ZGIA 3BT2H 4G5AA 1NGYB 2B9BA 4I7ZC 5K1VA 3D2UD 3TO4D 5B8CC 4FAAB 5H35B 4PRAA 2WWKO 4WUKL 3FT4B 4YL4A 5GGUA 3A6BH 4WI9A 2Y25A 2ZJSH 2L0DA 4N2FA 1RIVL 4UT7L 4XNZB 3VE0A 2O3OA 3FUDA 5E2JA 3P9MA 3QDGE 5DVOA 3EJJX 2F7LA 4GKZB 1WZMA 1BQLH 3NZHH 5B1JC 3SCMB 1L7IL 4U1KB 4U1GC 3STBA 2CRIA 2V5YA 2XWXA 3H7BB 1QPPA 3HMWH 4OJAA 3TCLB 3VX0A 1AP2B 3S6CA 1MFEH 4Z5RA 1BLNA 3TT1L 4LVNB 3RU8L 1QR1A 4JVPA 3UO8B 4Y4KC 4B97A 4I2XE 1SJVA 3NRFA 3S48A 4WF7A 1BBJA 1TU2A 3OKOA 2PYFB 4MAYA 1GVIA 3LS4H 3WIHL 3BKYH 2EH8L 4OZIF 1NIFA 1SFDA 5AL0A 3EYFA 4XC3L 3OLGA 4L4TA 4QT5A 2ICCA 2NNRA 1XF5A 4KXBA 3I3BA 4TNWK 1NIBA 2VR4A 5AOLA 2F58H 1JK9A 3DGGA 5K39B 4HIIA 4WY7L 2XLLA 2AJYL 1WIPA 5L2KD 1CGXA 4H20H 4PS7A 4Q58C 4AGOA 1Q1JL 1YECH 5DD6B 3IJEA 4NQCE 2JCWA 2GUOA 1R3KA 3A6CL 4PJXF 4A2MA 2IBZY 1FVDA 3KBHE 1TFPA 1W72B 4LLUB 1T1XB 1EANA 1DQJA 2SEBB 4JS7A 4W1TA 3FSOA 2YLHA 1BZ8A 4PIRF 2F7QA 2R51A 2H2PD 4PRPA 3BZEB 4Z7WA 3CFDA 1EO8H 3TBBA 1ZLEA 4YQXL 4EJYA 4H26A 3EF7A 2KZWA 3QUYA 2F5AL 3ZO0A 3FRUA 2YPLE 5GGRY 4JJHA 3EYOB 3KPPB 4ENZA 1W72H 4X4YB 3LY6A 2NY0C 2X88A 3IU4L 3TA4D 3H2PA 5CINL 2J1KA 3CFEA 5FKAB 1VSCA 3UDWA 4PWHA 4TVSa 4MNGB 2H8PA 4GUQA 1D6VL 2J1WA 3HB3D 4R7LA 4IRJD 2OCCB 5BRZB 3EJSA 4YDMA 4OZIE 4I1RA 3TFKC 1I8KA 3LS5H 3KRMA 3ZTCC 4NBYB 1BZQK 4YL9A 3BPLB 5DR5H 3SBQA 1NH2A 1F58L 3C5JB 5L88L 4LP8A 3D85D 3TZVD 3ARSA 1JNHB 5ILTH 5F0JB 1DJIA 1FVCB 3FFDB 4YBHA 5KSUA 3L95A 1A5FH 1ND0A 3F12A 4FFYH 1M05B 2I9TA 2CUMA 3VNYA 1QSED 4PD4J 4NO2A 4TRPL 1MHEA 2BC4B 3LEYH 3ILPB 4K8RD 4JKLA 4Q4EA 5EU4B 1G9HA 1IGTB 3WN5B 4F8PA 3RSMA 2ZCKH 4HV8A 4FGMA 2CO3A 3HE6B 3UJJH 5J1AB 4WV1B 3EO9H 2JFCA 1X9UA 4IBWA 5K1NA 2FL5B 5IBLC 3DI3B 3V4LA 3MNDA 2YC1B 3QUMB 2JI1A 1QTYT 5T1KA 3RTLA 1G9ML 2AJZA 4JQXA 3ZL1A 3KLDA 1A9BA 2IPTL 5D5MF 3QXDA 1J8HD 1S9WB 3AQZA 3UYRH 5E94A 1OAXL 2C1PB 4YSCA 2R2CA 3MRFA 4UNUA 2AP2A 1OF2A 1KN2L 4ONOA 1S7TA 3QWOB 1NFDB 5JUEH 2IADB 5D1ZC 5I26A 4UOJA 3ZHDA 1Z9PA 1MIML 3QUMH 1LEKB 2O26U 3FO9A 2OW7A 3VQ2C 3RWIB 1Z9OA 2VSMB 3B83A 4LF3B 5KUMA 3Q8BA 4N2NA 5K9QG 4X42A 1IC7H 3STZA 4BE6A 3EOAB 4KWUA 4XMTA 3V0EA 5AQ0A 1JFIC 4R7DB 3GBLA 4PRHD 2J4WL 2X1WL 3QZPA 5I76B 1G7JA 3HNSL 3APFA 2R7EA 2KS0A 4HIEB 1N5AA 1NFDE 1QYGL 2D73A 3BW9B 5GGQH 4IW4C 5KVDL 3SQOH 3K6SA 4R4FH 2Y07H 2NNFA 4UAHA 1S7VB 2ITCA 2CHNA 3HI1B 3DX6A 5D2NC 1M3QA 2DQGH 4LHUG 4ZX6A 1JGVL 3FCUB 4Y19E 4KAQH 5AVSB 1O6SB 2ZCHL 4DP4X 1XBRA 2BIPA 2CDEA 4H2AA 2XKNA 1FZOB 1CXLA 3UACA 1KFIA 2GJRA 2OA9A 3VQLA 4W9JC 3U4EB 3T6XA 4AXWB 4Z7AA 3QO1A 4ZUVA 3RPBA 2FO1A 1HH9A 2XTJC 4BFBD 1D5MA 4NKDB 3UPCA 2DM4A 1YEKH 1OZTG 2UUDH 1VZHA 4JFFB 3V6FA 3O0LA 3VFOA 3L1FA 1OT2A 2UZXA 2ATPA 1AISA 5FLUA 5JPNB 1KY7A 1BG9A 3OJDB 4XPGL 2VLLB 3VXPB 5HVHB 3RURA 3U2JA 4KQ0A 4N8VA 1S2EA 3T08A 1WQAA 2E27H 2QTEA 4D0DB 3A22A 3OKLA 2Z8WC 4DOHB 4JANA 1KNOA 1M57B 5MEQB 5C08B 2NOEA 4QR7A 4XC1L 3ZGHA 2PXYC 2RH0A 3AXLB 3HAEG 4H1LA 2ZWLT 4ZFZB 4C4UA 4APQA 3H9SB 3RY5A 2VH5H 1HJCA 2OFQA 3LEXA 1LQSR 3WIFB 4LCCC 3OKDA 4P4KD 2AK1H 1BOYA 2JJVA 4H13C 5B21A 3EADA 3GI8L 2ALWA 3WFHA 5HY9B 5J89A 1T22A 3HLAA 3GMMA 3MJ8B 4HSAC 4K5PA 4YC2B 1DJGA 4PLJD 5AKTA 1OARH 3GINA 4ZMAT 2UWEB 4A6YH 5B38A 3EAYA 4BIKA 1OL0A 2CBTA 4MD0B 1LDPL 1Q4NX 1CLVA 1KTLB 2FLRT 1X4YA 4YDJA 4QRFA 5C0JB 3H9SE 2XBZA 1F6AB 1OGPA 1QZ1A 4GSRA 2YBRA 4H8PA 1SLXA 1WUNT 4IBYA 3PP3K 4X8GA 2BSRA 3FQTB 3WIIL 4X9BA 3X3FL 1GS8A 2J8HA 2X6BA 2IPUG 1HSAB 3SYQA 4HBQA 2GJZA 5DWPA 5J6GB 4JDZA 2QGBA 2R0KL 4PB9H 1EZVX 3M7FB 2GAZA 3CN2A 2WZAA 1CWVA 2CLRA 3D3VB 4OZHA 2BOBA 4O2CA 1MCJA 3SQBB 4BXSV 3S0PA 4Z8FH 4LCWB 2V0AA 1NPNA 1F00I 4AUJA 5LCVL 1NGWA 3VUAA 4JZJA 3N85L 4I18C 4AQ1C 4D7BA 4ZSOE 1ZPLA 4ODUA 1B9KA 4NO5B 4FNLH 3UJTL 1KZQA 4QTHA 4HIJB 3K91A 1I7RB 4CL7A 1A3RL 3QUZD 3PL6C 3T0ED 3UCRA 4Z7VA 5E70A 5BV7B 4Z3FA 1DVFB 3TIEB 2AJSH 5HYEA 3FT3A 2V9TA 1DQIA 3ECQA 4HETA 2DQDH 2ADIB 2E8YA 1P5VA 1EMTH 4KVPA 4LVHC 4N5EC 3NN8A 4H25A 1IC4H 4MD5A 3SJVA 4WCYL 4I85A 3WJMA 5K69A 5KAQG 3ZW3A 2EICA 3VI4B 4QXVA 3T8VA 2ZXBA 2FATL 4RX4A 2PW1A 5EEZA 2R0LL 2Q86A 4S11A 4XNXL 3NSJA 3TBWB 2P43B 1FGVL 5KSBB 2GG1A 4EO5A 4XVUD