3HS8A

Intersectin 1-peptide-ap2 alpha ear complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
238
structure length
238
Chain Sequence
FEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis
molecule keywords Adaptor protein complex AP-2, alpha 2 subunit
publication title Regulation of synaptic vesicle recycling by complex formation between intersectin 1 and the clathrin adaptor complex AP2.
pubmed doi rcsb
source organism Mus musculus
total genus 58
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3hs8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3hs8A02
4RODB 1KY6A 1QN9A 5IYBP 4ROCB 1KYFA 1QN7A 1P4UA 1KYUA 4B0AA 1TBPA 1VTOA 2G30A 1QN3A 2D0CA 4BCXA 1E42A 1NA8A 1KYDA 3ASMA 1IU1A 1GYWA 3H1ZA 1QNCA 1AISA 1QN4A 1RM1A 5CN1A 1TGHA 4WZSD 1QN5A 2D0BA 1VOLB 1JFIC 1VTLE 3HS8A 1QN6A 1B9KA 1TBAB 1KY7A 1YTFA 2Z8UA 3ZHFA 1QTSA 2A7BA 1PCZA 3MNMA 1VOKA 2MJ7A 3OCIA 1OM9A 2YMTA 4PY5A 5CN2A 1QNEA 3OC3C 1NH2A 1R4XA 2IV9A 1D3UA 1CDWA 1YTBA 4ROEB 2IV8A 1W80A 2VJ0A 2D0AA 1NGMA 3ZY7A 1NVPA 2E9GA 1PZDA 1QNBA 1MP9A 1C9BB 1QN8A 3EIKA 5IYDP 5IYCP 1GYVA 3HS9A 2DWXA 2DWYA 1QNAA 1GYUA 3VN5A 1QTPA
chains in the Genus database with same CATH superfamily
1EHLL 4JPIB 3RY4A 5ADOH 2DQCH 4CSZA 1ROWA 3EUUA 4I4WA 5GSRB 5HYJE 4UQ9A 3D2TA 4G71B 4HAFA 2AQSA 4X6CE 4X9GA 1LVEA 3QJHA 3QRBA 3FFCA 3Q48A 4ONGH 5MP6H 3WUWG 4L48A 4JY5H 4UDUA 2VT0A 3QWNA 2ZOLA 3DX2A 1KG0A 2BW5A 1M71B 2R69A 1ZJAA 5M7QA 2XZAL 1Z5YD 2YKLL 3ESUF 3LSOA 4CNIA 1KIQA 4M1GH 5GJSH 3A6CH 4N2GA 3BCDA 1W91A 1MJJA 4WY7L 4MXVF 2VWEC 3KWXA 1Z5HA 4NWUL 3D05A 3GTVA 4OLWH 3MLWL 3RNQA 3P9LB 3GSNB 2J5LC 2BY2A 4K73A 1TTFA 4OZFA 2ITCA 3L3OA 1P4IH 1TU2A 2EZ0D 4Z76B 3E3QC 3II2A 2A74B 1E30A 2R2CA 3AVEA 1FL5B 3KWWB 2OTUB 3IDNA 4LFHD 1BJ1J 3DJTA 3SPVB 5MERB 1XIWB 3WD5L 1WP6A 3PWVB 4ZNCD 2NSXA 3PWLA 4NO2B 2BNRA 4ZW5A 3GHPA 2B4CH 3CU1A 1TMCB 2FBJH 4L3CB 2BVTA 2W5PA 3OKYA 1NBYA 2BOCB 3JWOC 3MRCB 1XGUA 1ZT4A 3MRGA 4Y5VC 4YSDA 1VZHA 2EIMB 4XH2A 4YAQA 4LCCA 3KE0A 4ALAH 5I17B 1ICTA 2Z6FA 4JL1A 4PVMA 3VCLA 1SBBA 5C0AD 3LS4H 5IV2B 3HJ0A 4ZFOB 5K5YA 2EACA 2ZKWA 2CALA 5IEHB 3BWAA 4UIMA 2MZ8A 1BZ8A 1R4XA 3M17A 4N5EC 4BK4A 3A67H 4G7YL 5BZDA 4GT0A 3WEAA 2Y5TB 4P2AA 2ALWA 1EUUA 2IDCA 4MASA 1DBML 3CDCA 2DD8H 5BVJA 3G5WA 2IADB 4P2CG 1RZJL 4CGUB 5AUMB 5T3ZL 1YNLH 1JL8A 1S9YB 3E8VA 4MHHI 3GSOB 1P5UA 2ZUVA 3WFCL 3KM1A 4YFLF 4H1LA 3IFLL 1DQLH 2WMPB 5ETUB 2DI8A 4C56D 1ZHBB 4LLQB 2QDWA 3ZKMD 4J7RA 4U6YA 3AQXA 4FE9A 3WGUB 3NSDA 1U4FA 2K8MA 4Z7VB 1R5IA 4D2NA 2FEDD 3K6DA 3TU6A 3RL2A 3RTQD 3V5KA 1CZ8H 3SNSA 4YGVB 3GZKA 3SKJH 3SJVB 2FUQA 2YMXL 3SDAB 2H2SD 4YSRA 1UB6B 3Q2LA 4JE4B 3W9DA 2V37A 4A55A 2OMZB 2EADA 4O9HH 5HJDA 1IB5A 2QMKA 4OLUL 4B5ZA 4YSCA 4MAYB 4EKJA 4DGWC 1HAWA 3OB8A 4QYOB 4MA8H 4P05A 2EO9A 5HY9B 4PRHB 4PJ9C 4P99A 2GI7A 1QEXA 4Y19D 4YHIA 2FIKB 2AQQA 5GHWL 3ZX1A 5JPNA 1HKFA 1KELL 4JFXB 1TKWA 1E28A 3P3TA 4L4JA 3TA3B 1I8IA 2LGNA 3QDMA 2F74A 1RLWA 3QORC 4RAUB 4XP5L 1XTMA 3CK0L 1KN2L 2I9LA 4EDWL 5D9SB 1U8PB 2N7BA 2NNRA 4MNGE 4E9VA 3DVGB 1OGTA 1QNCA 1A9BB 3QDME 5A6LA 4XVUD 4JFOA 2O30A 2X6BA 4QY8B 5EUOA 1CTOA 2XV0A 1FO0A 3ZL1A 2P5WD 3LKRA 2IWFA 4QRPB 5D7IB 4OGZA 5DJYA 5JW3H 3PV7A 1DVZA 2WWMD 5DVNA 2OMYA 2G5RA 5F89B 5KSUA 3RL1B 2ZUWA 5TD4A 4Q6KA 1LEIB 5C0DB 1T6WA 1VFMA 1B9KA 1FGVL 3PQYA 3QJRB 4NRXB 3GJFA 5KJ7E 4FQ1H 4M1CC 3BUTA 1C47A 2YHGA 2ZF8A 1Z2KA 3PQYE 3THML 4UIKH 1NC2B 1G7JA 2WW8A 3OCIA 3WAKA 5IMLB 4RAVA 1A6VL 3PWNA 1WDAA 4PJXB 3WIIH 5C0BD 1ETZB 2EYSA 4Q8BA 4KV5E 1IGCL 4JZJC 1YTBA 4BQ6A 2VL4A 1TUPA 4UZSA 2XXFA 1IC5L 2Z7YA 3PREA 1KC5L 4YMPA 3VFVB 1B0GB 3I6LE 2XJKA 3ARGA 4U4IA 2WOYA 3RGHA 4MMXC 3JT0A 2JJTC 2DYPB 2F7RA 3K6FA 3X1FA 1KGCE 2E4TA 2FX7L 3O6LL 1QNBA 5D71H 1F6AB 4BZ1A 1IEBB 4XP4L 3TASA 2E7LA 2UZIL 4F9LA 3POHA 2FEEL 2I07B 1MVUA 3DNKA 3LKPB 4OGQC 5TDNB 2W60B 1OPGL 4ABUA 1KTLB 4MXWH 5BZWB 2EDRA 3N41B 3T4AB 3UBXB 1J8HB 2HTKC 1TF4A 3UPRA 2A5UA 1SOSA 3QIWC 4FULA 1DBJH 3U1QA 3MTXA 5KWYC 4J2QA 2VKWA 2XPZA 3MO1B 3TVMD 3HBGA 2J1WA 1BVNT 1IIIA 5HHNB 4KX9A 3RGVC 3I2CL 3HAEH 4PJIA 4I13B 1CFVL 2GTQA 5KBLA 3DO3A 2ZT9C 4JKWA 4YSTA 2PCFB 4Y9CA 2E74C 2R59A 5FYKE 1MLBB 5CIPB 2WBJD 4HA1A 5EN2B 3RHWK 1NWPA 2CR0A 1E4XL 1H5BC 1Z9NA 3SDYL 2V7HA 4R5XA 4FCHA 4XCNB 1C12A 4FL4C 1J12A 2BSTB 1DFXA 2I60L 5BRZA 3G04A 3HG1D 4ZUWB 3HC4L 1ORSA 2BWQA 2F7LA 2R0ZL 3X3FL 1T22A 1E8XA 2XN9B 4XN1A 2AXGB 1G7IB 5E8NA 4FQXA 2IJ0C 4JREB 4BXVA 3HG3A 2CDGA 3O3UN 3UZQB 4JLRA 4G3YH 1V7NL 2P7TA 4LZKA 5DTFA 3U7AA 5CN1A 1U3HB 4U1GC 1MHEB 2V4LA 3ECVA 2C3GA 1D9KB 3VFRA 3TN0D 3WJLA 4NZTL 5L4JA 3H7LA 4NBZB 2CDFA 3SGEH 5A16A 4AKOA 1RUAL 5EUKB 4OM1L 1G9MC 1YVLA 4WFHE 1NPUA 3TA4D 3VXSB 1A4JA 1NEUA 1B4JH 1BBDL 2JI3A 3X1EA 4M7LH 4D8PB 4PY8I 2CO6A 2P26A 3V0IA 5BOPA 5J9PA 1DJYA 4I18B 1JNLL 1YEEH 2K70A 4MQ7B 1KGXA 3EJCA 4FXKC 2IFGA 5D70L 5L6YL 3Q8CA 4QAMB 4DQOH 1NCCH 4U2ZA 3PGCA 1L6XA 2EIZB 3BSHA 2BCMA 1OAQL 4X4KA 4HQQL 4V1DA 3OC3C 2F0CA 1MVFA 2O93L 2VMJA 4LVNB 6FABH 4LKCB 3T0EB 2R7EB 5C7XL 4FLSA 2Q86A 4ROEB 4BKLB 5KW9H 5TH2B 1QVOA 1I9JL 2CRMA 5E8PA 3ULSA 3QG6A 3GHEH 5D2NC 3WELA 5I0YA 1U41A 4JM2F 4GEIA 4Z8FL 4JFDD 3QR2A 3FSOA 4LU5H 4PJCA 3CFUA 5E2JA 3U4BH 2FWOA 5IVNA 1I3RB 4PW4A 3VNYA 2NY0B 3PDKA 1Y6NR 4OZ4A 1KFQA 5FO7B 3CSBA 4UT9L 3T65B 1AD0A 4JRLA 4Y2OB 4MSWB 4KQ4H 5A3ID 5TDPB 4PRIB 1AKJB 3HMWH 4JY4B 2DWYA 1S46A 4FZ8L 1QNAA 2J8OA 5DZAA 3SSGA 3GRWA 2OMBA 4HEPA 5JW4M 2AK1L 3N0PB 3LS5L 4AIEA 4GSRA 5DRNA 1KTBA 1VFBA 1E65A 4ZUTB 4MVBC 1U6AH 1MOEA 2ZQKA 4P2OB 1H3UA 1UKSA 3L3HA 3CDFA 3HS0A 4Y16A 5DRZA 5DHXB 2AAAA 4NQSA 5F1KC 1E9QA 5LCVA 1L0QA 1IFRA 4Z9KB 4PGBB 5LLIC 3FUEA 4AGPA 3HA0A 4AYFB 1HWHB 1QI4A 5KVMC 1U8NA 4GG6E 4UQCA 4B9PA 4DK5A 4FA7B 4OKVB 5HDOA 4WNJA 3QULA 4MNQB 3I50L 4M48L 4PG9B 3RBSA 1SY6H 2P5EB 5GZOC 4JHWL 3J7HA 1INQA 2CIIA 1LL1A 4WW2A 3AITA 1FLRH 2QKSA 3PNWA 4M9PA 5FDWB 1MKFA 2PW2B 1CD8A 3PGDA 4IIZA 5T1LD 4WIQA 4M8VA 4E0RB 4IEFA 5E5RB 2A9NH 2WZPA 5I75B 4W81A 4TRPH 5CZKA 5BRQA 2DQ6A 2Q2EB 5AW4B 3W56A 3Q6GH 3F5WA 1RMFL 1L9RA 4WI0B 4TNFA 2BXYA 4OY9A 5DK2A 2D7PA 4P4KA 2WWNA 1QR1A 4HWUA 1SJHA 3HNVH 2XQYK 4P46C 2Q76B 2YO3A 5EOQL 4N0UA 4Y4KA 1KJ3L 3ARFD 5TQ0H 4BGLA 1JPSL 3V0EA 4NKMA 3BUPA 2WXIA 12E8L 3D3VE 3M86A 4LLMA 3PPEA 9PCYA 2PW1B 3C6LD 5ECJE 1TENA 1WIPA 2HT2D 4PR5A 3LQZB 4Z3FA 1Q9OB 1MCWM 3GQFA 3CLEL 4N8UA 4RAHA 5KUMA 3WY4A 5HHVH 5FUOH 3L6FB 2GK2A 4EVNA 1RURH 3MCG1 4F8QA 1FIGL 1KB5A 25C8H 2YPLB 4KRPB 5A2IH 4BUGA 4A6YB 4M5YH 1BXVA 1NGZA 5J1AB 3EJSA 1ZE3C 4K0OA 4LVEA 1I1FA 4Z18A 4E36A 4IRZH 4PJ7E 1MWAH 5EWIH 4F8PA 3EXJA 1M56B 1XD0A 3IVKB 4ESKA 5DMGD 3MYZA 5MEND 1PEZA 1F1DA 1VGKA 4M4RB 4UILH 4OZFG 5IYDP 1Z1WA 4L4TD 4DVRL 3BZ5A 5C9JB 1BQLH 4G83A 2A6KB 3HS9A 3ULVD 2KZBA 4IKIA 5DYOB 2VN3A 4FTDA 2DW5A 3F01A 4B60A 2YBGA 4X6DA 1ZSDB 2DQHL 2XZCL 3BDYH 2HVBA 3VFMA 2B08A 4WJG3 1DJZA 1HU8A 1FNHA 4QRQA 1G9NH 4X6DE 5DC0A 1UWXH 5F7FA 5I19L 1GGCL 1LE5B 4DZ8A 1DQMH 4OTXH 5T3XH 5K9OB 5EU6A 3JWDC 3W0WD 3ZZLA 3GWJA 4AM0A 3KRMA 4CW1B 4PSPA 1F6LL 5E5MB 2C4FT 4ZFQA 3PWUA 5D6CA 5EU6E 3BN9C 4ORGA 3NFNB 3MAWA 4AL8C 3BP6B 4ZW7A 4KTDL 4KOBA 4EEEA 3P30H 4HJJH 2ADGA 4MX7B 4UTAL 4LIQE 2CUAA 4M7ZC 3D34A 3IJ7A 3WGVB 5EIIG 4L1TA 1A6TB 1CVRA 1FNEB 1RI8A 2ESVA 1KBPA 4QR7A 1VEOA 3QWRA 4PGDB 1AG0A 4M56A 1F02I 4S10A 3JYCA 2WXJA 4G8GE 4F57L 2RIKA 1SVZA 3MRHA 3WL9A 1FFPA 2ESVE 3QJFB 3S97C 1JGLH 1JWSA 2XTSA 5IROD 5FR3A 4RSYA 3SGKC 2NXYC 1KIPB 3O45B 1WZ1L 3O6ML 2H26B 3LZPA 4L18A 1WEJH 5B39B 4H1LG 5HVFB 2KUTA 1XXFC 4XT1C 1H3VA 1M7UA 1EXUA 3MV7A 4Y5YB 3IETA 4WWID 3BQUB 4S1SL 4BV1A 1JWUA 4ZBJA 5DJ0A 3C5SB 5C08D 3DOSB 4X98B 4LKXB 2V2WA 2JKRM 4KY1H 4HLZG 3MV7E 3ZLQC 2HJFA 4QRRB 3HE7B 5IOPA 1NGQL 2BHYA 1X5JA 2PN5A 3IGAA 5HYSB 1IVLA 1RUKH 1V10A 1OAKH 3FSZA 3O2WL 3T0AA 3L3KB 5GZNA 3ZIMA 3BVXA 3GBMH 3VXUD 2PPDA 4EN3C 3ENOC 2V8MA 3PIQA 1JVKA 5JIIA 5GS2D 4GIOA 1YYCA 4PM1A 1DDHB 4IU2B 1NZRA 3PWPD 3KYKL 3SE9L 3GEWB 1G7PB 1JNHB 1VB9A 4J3SA 4JDTL 4FQHA 4OFYA 4JPWH 2CO2A 2WD0A 2BIPA 3D30A 3O6KL 5CBEB 5CEYA 1MCIA 2XWXA 4AQAB 3D85D 5I1GH 1CGSH 3ELAT 2WCSA 5DD1L 5AD0A 1TQWA 1T03L 1E8ZA 1OB1B 2OV0A 3WJJA 1N39A 4EI6B 4U1KB 1C8QA 3B9KB 3BO8A 2YGVA 1U42A 4FFYH 3U0TA 3D4ZA 4K3DL 3GO1H 3L08A 4HWEL 3CFQA 1ZGLB 4KK6C 1RUMH 4YVUA 3F58H 3DO7A 4ZFGL 2X4PB 1BM3L 4B9GA 5DQDL 5I71C 3QCTL 5EC2A 1KXHA 3LN5A 4LLYA 4U05A 3KL3A 4BSVB 1B6UA 4U3CA 2OP4H 3PP4H 3VE0A 3FU3A 1BD2D 1HE8A 2FBRA 1AIFA 3TWCH 3UIYA 1I7RA 4YDZA 4AQ1A 1AZNA 2ZCHH 3K5RA 4J23A 2GUYA 2OFQA 3V5DA 1AS6A 1VGEH 4Q9RL 4QRUA 3WDIA 5JW5A 2K7PA 2WCPA 5GGQL 1IILE 4E41E 5F70A 1VRSA 4XNQB 4OCMC 4UDTA 4GRMB 2EDTA 1Q94B 5CZXC 2E6PA 2YQ3A 4APQD 4P5TA 1SDDA 4PV9B 4LSTH 2VSKB 3VFNA 3P77B 1DBAL 5ICUA 3OLEA 4PGJA 2OBGA 4C7PA 2V17L 5IMKA 4IK6A 3ZKNC 1I7UA 5DJ6B 1HDMB 2QR0A 3O11A 3QCUH 4LRIC 4UM9D 5EMYA 3S36H 4ZMYA 4OIBA 2ZX7A 1VTLE 3KPSD 2HVJB 5DD6B 3IJEB 1HH6B 3FN3A 4PJ5A 3IKCB 2HL8A 4NDMA 5I1KH 4QHLB 3ZHFA 2UUDK 1UACH 3UADA 1FG9C 2Y7OA 4PJ5E 5E00A 3RZCB 4LOEA 2BIMA 3B4NA 4JFTA 1CBVL 1NLDL 1U30A 3BKYH 3KXFA 3S34L 1RIUL 2YK1L 5AWNL 3VXMA 4HXBH 3B2UD 3JZYA 4HZLB 4TPRL 3WNLA 1NUNB 3P4OB 3MRLA 5CMAA 4G42A 5E6IC 4BH7B 1AOZA 2RCSL 3ZKQD 4KNQA 3L5WA 1EJOH 2DQCL 3AQDA 4Q9QH 5F3BB 3H6JA 2X89D 3FU9A 1M3IA 4M5TA 2YS4A 4IS6A 4B7IA 1X9UA 3P9MB 1HL9A 1E8WA 3EYVA 4ONGL 5MP6L 2WLIB 4KKLD 3MRMB 4PJFE 3K0WA 3OC5A 1ZAGA 2BP8A 3ARDB 3F8UB 1M1SA 1KPVB 2G9HB 1MIEL 3BFWA 4WTZA 3A6CL 4XOAA 4BFKA 5E24E 1FN4A 3UJTH 3OSKA 4JO5A 3RE0A 3D4YA 4EBQH 5IR1B 4CUCA 2ETWA 3TIEB 3PCYA 2WLNA 3N04A 35C8H 1FSKB 3RVVD 2FT7A 3QFJD 3CZEA 3RWHA 4NUJA 3DBSA 5E23A 1P4IL 5ITFB 3FKUS 2VJXA 1SMDA 3O41A 4QHMA 4LARH 3L2NA 1EXGA 2CK0H 1FNSH 3VXRA 2EDOA 1WWAX 4R84A 2BHZA 1IE4A 1OALA 2APXA 3KNBB 5T33H 1GRWA 3NCBB 4NOBA 4YHZH 1W72A 2BNUA 5CWSB 5F1SA 1R0AH 4L8CA 1IBGL 1KXVA 3TGXA 1NAMH 2F8IA 5E9DB 3X1NA 3R0MA 4XBEH 4MDRA 4DUWA 1HTYA 3LAFA 2FAUA 4CSSA 2OMTB 5IKCB 1GOGA 5GS1B 3KPNA 3H55A 4GRWH 1QBLH 2ZUTA 5FA4A 3MV01 1MCPL 5ANMB 4EQ2A 4U4BA 1LJMA 2GT9A 3LS4L 2OX5A 3MCLH 4KGJA 4JO3L 3GXIA 3B8YA 1ZSHA 3RVWD 3UXFA 3L7EA 4JFEE 5DEZA 5KYXA 3A67L 3LKOA 4N2DA 2F53D 4Q4IA 5ESVB 1JFIC 1DQTA 1KNOA 1YN7B 2NX5E 3Q2WA 1KJMB 1T0OA 4FQPA 5EA0H 4DWHA 1OAUL 4AC4A 4ELDA 4GUQA 1SYVB 3REWB 4O02H 2D9CA 3C8DA 4PP2B 2WBKA 4KITB 1FYTB 4QF1A 4KAQH 5A1AA 1EFXA 1HJCA 5JPMA 3UERA 2Q7YB 3TESA 4FQQB 5ITBH 4PJ8D 1JGIA 3QZLA 4HAGA 3SKMA 1Z0NA 4I0PC 1M5Q1 3EIFA 3HAEG 4POYA 1RHHA 5K59E 1JN6B 2Z8SA 3BT2H 4PB0L 2KPNA 4XBGB 1RIVH 4KTYA 2D31A 4O5LL 4XCYA 1MHPH 2QLVB 4LLWB 3AWEA 1WAAA 3FL7A 3BPLC 3QVAA 4OSUH 4X0KB 1QFWM 1MI5B 4FOMA 3ARVA 1CZ8L 2W9EH 3UAAA 3MR9A 4NLAA 4Y9BA 3SKJL 1CF8H 3GLAA 5HYJD 5KVFL 4R0LB 4MRQA 1TETL 1Q9UA 1G0DA 2H32H 3V6ZB 1THAA 1VSCA 4O9HL 3CN1A 1A3RH 3V52H 2KZKA 1BAGA 3HPJB 3B7UX 2VLRA 2MEJB 1XGRA 4XNYH 2XWCA 3CHSA 5CEXB 4HPHA 1S7WA 2VDLH 1THCA 5FIEA 4Q14A 5HPOA 2IQ9H 3AADB 2VLRE 1P5VB 3UMNA 3TVMB 4EIZC 4F7CA 3Q6FB 2AXFA 1ED3B 4N9GA 4JCWA 2VDQH 5DK0A 2V5RA 2Z0FA 1JRHL 3SPCA 3WCYA 2XIBA 1XSOA 1CE1L 1GZQB 4XO8A 2APSA 3T3ME 2BNQA 2MFNA 3MLTB 5J3HD 2I9TB 4N0FA 3K8LA 1KYFA 1XSKA 3E3QE 1DUYB 2WBJB 4HJ1A 3EO0B 1ND0A 1A8ZA 4YSSA 1A7NH 1KYUA 3APDA 4YZFE 4AJ0A 5JW3L 4AI7A 3TEZA 4QKTA 2CA3A 2EE9A 1SXAA 2ZAIA 4Y5VA 1D7DA 3GXFA 4GUPA 4NXKA 3SBPA 3QDGA 4NSKB 4H0HB 3ABZA 2AJ3B 1A3ZA 2DKAA 4XWOD 2HRHA 5HDBF 5CJBA 2DMHA 4KZ0A 4PWHA 3HI1A 2QRCA 4PB9H 2EVIA 3FF7A 1LP9A 1X5AA 3CIAA 3GXUB 3CSYA 1DUZA 1G7HB 3ZKXC 3TN0B 2J8UA 4H8WH 3F00A 3FW6A 3KLQA 1HNYA 1XGPA 1LP9E 3A4EA 3G5VA 3ARTA 3E1F1 4HFWB 4HSAC 2SEBA 3WIIL 5HI4C 4M5ZL 4NQEB 5BQ7B 4MKTA 2XBTA 3GSRB 3IT8D 3VD4A 3BH9A 2RFXB 3RJOA 4UAOB 2X4NB 1DQVA 4B41A 5JO5B 2EUWA 4AGOA 4QRBA 2XWEA 1UWEH 2O6DA 3H85A 5LBSL 4BUHA 1KY7A 3QUMA 5DD3H 2UXFA 3WUZA 3MBED 3JVFC 1UXWB 1BIIB 2VN6A 3RI5K 3MGTB 3IDJA 3FT4B 2Z4QB 1EO7A 1OVZA 4FLOA 1OQOA 4P57B 3LZQA 1A7QH 3MACH 4JFYA 2I7SA 3RWFA 3PS6A 4H40A 3FO1B 3L4CA 2GFBB 3PGFL 2DQIL 5FYJU 2NQDA 3EHBC 3EH2A 3IXTB 1X5GA 1AGDA 3OHMB 4IOFD 1YO4A 2QADC 2VQ1A 3ZR5A 5K39A 4LAJH 5EU7C 4X4YB 1QHOA 3I6SA 3FUIA 4XE0A 4ZFFB 1DQKA 4N1CA 5I8OH 3EBIA 4U49A 5G4OA 4DP7X 4JG9A 4PJ9A 1KYAA 3DIFB 3BUIA 1CXIA 2H9GB 2O5ZL 3V4VA 4ANVA 4DGUA 1U8HB 4TPSA 2WKGA 4FQ2H 4HMEA 4L8SB 5HGAA 2BSED 1UA6L 4M61B 2QGCA 3VVWA 1ZT1B 2VLJA 5KSAB 1MFAL 3NJNA 5IB5A 4IMLA 4X6CA 1XCTA 4UT7H 1TJXA 2DWDB 1YEFH 3BQVA 3M8OH 3Q13A 4JVUA 2FKFA 1J5OH 1F42A 1WD8A 1F3JA 2FD6H 2LLGA 2H0FA 3CFKA 5DQJA 1Q0XH 2HX9A 4U7MA 3RX7A 2D8KA 3OXRB 3Q5OA 2BX5A 4G9FB 2VXQH 1G9MH 5CHNB 4K23L 4Q97A 3QDMD 3ZTNL 3B2XA 2DZEA 3NIGE 4WF7A 3BFOA 3NIFE 4K8RD 2BK8A 4OCSH 3FRUA 3VD3A 3HRPA 3JV4B 1PSKH 2OMNA 4GAGH 3N42B 2PWDA 2PTVA 3FCBA 2ICWJ 4FJ6A 4RX4A 5I6NA 5IHWA 3RVUD 3AU1B 3IU3B 4KJPC 4RFOH 3SE3C 1URZA 4LF3B 2HA1A 4AW7A 5E1IA 4U0RB 1NCHA 8PAZA 3KLLA 3FTVA 2VUKA 3ULUC 2H2PC 4GLRI 1MDTA 4CC1A 2F5AH 3PQYD 4RGNE 5T1LB 5MEPB 1WG3A 4JB9H 4JZJA 4X5XB 4TQPA 1YEGH 4XVSL 3WUWB 1QI3A 4PD4K 5CBAA 2VE6A 2D9QB 1I9RH 3KPRE 1RZ7H 3Q1SH 1WIUA 4L1DA 3MBXL 1PKQA 3CFMA 5JQ6L 5LWYH 1D2OA 1JPEA 3CFIC 1TEFA 2APTA 4OLZH 4KZDH 3DXAA 4MMXA 2JJTA 2FB4H 2NOHA 6FABL 3H2WA 1PKQE 2BFGA 2C3XA 4HC1H 4WNSA 5F7DA 5KS9B 4H0IA 4J2XA 1MQKH 1BWMA 1DVFC 2Y1YA 4JKPH 4GSDH 4RFNC 5EF3A 3ARFB 3WN5C 3GHEL 1QN6A 1IRAY 3DVNB 1U8MB 1Y0LA 3LNEA 4PV1C 1TDQA 3I6LD 5AZEH 4XN2A 5HHME 1CD0A 1TR7A 4XZUB 5F7KC 3UBGA 5T5FH 2ZCKH 1KGCD 4LU5L 2V2XB 2K6ZA 2NUTB 3OKLB 3U1SH 1SEBB 3EH4B 3NEXA 3SDXF 5CS7A 2DKMA 3QIWA 1J8RA 1DIZA 3H3PH 3EG9A 2XHNA 2ZP9A 3W9EB 4Q56A 2QRDA 4RISL 5DYFA 3O9WD 1DVUA 3O2VH 3AB0B 1F3RB 5HHXL 2KMWA 2ZYSA 3HMWL 3V9CA 4CN1A 2JIXB 4BM7A 1I1AA 3CSFA 5CEZH 1U58B 2DAVA 4EAGA 1QRND 3WTXA 3PJSA 4N20A 3A3YB 3F0ZA 2ADFH 3WMPA 3VFTA 4NJ9L 4OZHE 4DK3A 5I1HL 2OMVA 5ESAA 1HZLA 1U6AL 1YECL 1H5BA 1KTJA 1NM9A 3RWCA 3QEQD 2XWJA 1U2YA 2QV2A 2ZAGA 1LTXA 2PO6A 1E50A 3TBBA 1PLGH 3FQTA 5GXBB 3OSEA 4BSWB 1FAKT 5FYKD 4GKSB 5B3NA 2NLJB 2EE3A 3DYOA 5CGYD 4HX1A 2N7SA 3KW7A 1QAWA 3L1OH 1OIOA 5AB2A 4FHBD 4KJYA 2F1EA 1YQRA 1PIGA 3IDYB 4ACPA 1X5ZA 3MRIB 4YR6A 3WO3B 1BFOA 1UZ6F 2R0LH 2VIRA 3I6KB 4N24A 3MLPA 3W0WB 3BKCL 3MTRA 5LGJB 3QEGL 3MV11 2C1PA 3SCMC 3BPNC 3NDYE 3RWIA 1SY6L 4TLUA 1FORH 3N50A 2E5EA 1I4FA 1TZGL 4K55A 4NFBA 4ELMA 4KKQA 5KSBB 1AVAA 5JDSA 3MI6A 4M1DH 3C5ZC 1IGYA 3L17A 2KH2B 3DROA 1AANA 4NZDA 4Z1PA 2JB5H 3QQ9C 1N6UA 4PW3A 1WFIA 4CL7A 1U8QA 5EO0A 4WFHD 4B7LA 3Q6GL 1BHGA 2G9KA 2P80A 1BYPA 1BCIA 1YG9A 4XVJH 1YEHH 3A24A 3ME0A 3WKPA 1MRDH 3C60B 4U31A 2FX8H 2JCCA 1F90H 1LK2B 2E6JA 3QEHA 4S1QH 4WV1B 1HVXA 5TQ0L 1BSIA 1UXMA 3BKML 1JZEA 2XQYA 2XKUA 5F9WC 2JCCE 1S8DA 1FZKB 4PREB 5JUEL 4CILA 3L5XH 3FN0H 3N9GH 4U6HA 4OQTL 4UOW1 2K6YA 3Q0HA 1MJ7L 4IDJH 3DX7A 3MRJA 1N59A 5HHVL 3LN4B 1MW0A 4AIZA 5D2NE 1RURL 3HZVA 1CTMA 1EBAA 3QUKB 1ET8A 1QLFB 4JG1H 4P5KB 4KVCH 4ZMTA 3MA7A 5JNYA 4AUJA 3GJEB 5DRXB 3BKQX 4K2UH 3OH9A 3H9SA 1MWAL 1NEPA 2ZKYA 3NFPA 4XNZB 2I26N 4LSPH 4XVTH 2EDMA 3VXTB 3VXUB 4BCZA 1CXLA 5IFHH 4UILL 3ZZQA 3BZEA 3BHBA 2OQJB 3T6VA 3H9SE 2RGSA 4CMHC 3NJFA 4LNVA 5GPRA 4DGYH 5ID1A 3PWPB 5DUBB 3OBAA 4DULA 1MCOH 2AI0H 4D0CB 1D5XB 2EILB 3NK3A 5EDXA 2R69H 3JWDH 3KLAA 3M6DA 1CS6A 1SUJA 4XXDB 3CVSA 3IS0X 2YJQA 1GOHA 1PY0A 5BMFL 2ZWYA 5H94A 2XIIA 1P6AB 1GA2A 4Q58C 5CAYB 1G9NL 3RKPA 2VZUA 5T3XL 3DETC 3GYRA 4WFGE 3ZTEA 2HFTA 2R9HD 2YR3A 4NQVB 5CEZE 2DKSA 3EDJA 3CVBA 2GSGB 1UWYA 2PPAA 3MRNB 4K5OA 5IMMA 2H5UA 1T5WA 1A9VA 3LOWA 4QO1B 3BVNA 1T5KA 3FCGA 4OJFL 1ZCRA 1UZ8B 2DM7A 5GZOA 1Z0MA 2A83B 4PWEA 3DSFH 4QTHA 3VGFA 4I48B 5TDOB 4Y5XB 4PRDB 2GIXA 3HW7A 3PNRB 4C83B 3QUXD 3UAJC 1UXLA 1Z9MA 1S7VA 3AG2B 4KNTA 3BEVB 3OXSA 4WI4A 3SYQA 3QHFH 2I24N 5DHYB 2DYSB 5DLML 2FSDA 3AS2A 1SRDA 2VABA 3U6XS 3V4PA 4JN1L 3EKCA 4PJGA 3UTZA 1H6EA 3VWKD 3K5SA 7PCYA 1EGJA 3D39A 5IBUG 2X9XA 3FFOA 3PF2A 4CKVX 1K72A 2Y06L 5DJAA 1GGBL 4OT1H 5E99H 4A7SA 4RRPA 5MHSE 4HK0A 3VX0A 2WUBH 2FGTA 1CICC 1R24A 1BAFH 2W65B 5B1JA 3LDBC 4TM9A 5CCKL 1OLLA 1UG9A 4APQB 2WZPD 4KI5D 2NY1B 1MFBH 2A1WH 2IALB 3IJYA 1UUSA 5KOVC 1JHLH 5D1QC 2FJHA 2HYMA 5DGRA 1E0OB 3ESMA 4Y7MA 3SD2A 1OAKL 4P4KD 1ORQA 3UAFA 5HSFA 5EU3A 2C3HA 3D3VD 1YEKH 1AQ8A 3DOHA 4YHYB 3E38A 4QHUA 1YQKA 3KPSB 1A7OH 4N2CA 3VXNB 4U1HB 2VUOA 1AGBB 5K1JA 1EO8H 2Y6SD 4OV5B 1DZ0A 3ZHKA 2Q3ZA 3MUGA 2R5XA 3MLYH 3ZE2F 1AO7B 5T5NF 4U6XB 2HFGH 4Z7WF 5FDYA 4ZXBD 2CU9A 1A47A 5DT1H 3MFGB 5AZ2L 4JPWL 2C3VA 2R27A 5JTWA 3KYMA 4KUZH 2NXZB 5DJ2A 2ZCLL 2A9DA 4I3GA 4AZUA 3EOBA 3CH8A 1GGIL 1DLFH 4FGMA 2YD5A 4JM2C 5AOKA 2OM5A 4JPVH 2D0HA 1N8OE 1DQQB 4PMFA 1RZIA 1SDAB 4DP4X 1J0ZA 1GMIA 2F54B 3OJDB 2AJYH 5BV7B 3MYJB 1TVDA 3FCUB 5JYLA 4XPHH 1M7IB 1KLGA 5LHDA 3VD0A 1CFTB 5IQ9A 1W9XA 4JDEA 1NIFA 2QPSA 1EWHA 2VDKB 2YGNA 2RTTA 4E9XA 5I16B 3S0PA 5FM4A 3NJXA 3WXWL 3O81A 4YSAA 2V3FA 4YIQB 3QBTB 3BWUF 3S3BB 1H6FA 3BXNA 2X88A 5I1EL 5I1LB 3IDGA 4XPTL 3VACA 2UWEB 4XPGH 4X7DC 1DJXA 5F7BA 4YSEA 2Y72A 3DHUA 2CJSA 1NMCC 3TWCL 3NCJL 4AH2B 3QXDA 4PAZA 2X0WA 2WNWA 1ODUA 3ATEA 4UNTA 5HVHB 5IQ7H 4JFFB 5JW4N 4Z7QB 2O61B 1PMYA 4N2KA 3QFJB 5HTSA 3SGKA 2OYKA 3W82A 2LU7A 4ZTPH 2CJTA 3GMNB 1R3HB 3V0VA 1N3AA 4DN3H 4G8GD 2AMGA 1N70A 1IGJA 4HHWA 3U36B 3EAKA 4XMWA 1U8IB 3G5XA 2ESVD 5B8CB 4OFKA 1WTLA 3RFRA 5KEZA 2JHJA 2I5WA 5FCSH 1YPZE 4J27A 1WHOA 3S98A 2MJWA 1T89C 2JWYA 2QVTA 3IMSA 4GYBA 3KPTA 4QIRA 4UBDD 1UGNA 3UPCA 2X7LA 3BWSA 1J7VR 3TS8A 5D7LD 1JPGA 4PJHB 4TS6A 3UYRH 5D1ZD 5FGBA 2CPCA 4YXHH 4BCXA 1FIEA 2DBLH 3FFDB 3GHBL 3MV7D 2HT3C 4PLKD 3O6FC 4XC1H 1T20A 1NSNL 3IXAB 3RWEA 1K35A 3PAYA 4EN3A 5D1XB 1A65A 2WYHA 3P0VL 4KMTH 3C5JA 4N0CC 2H6PA 3DARA 4YL4A 5HHPA 3M7OA 2Y36L 4PGEA 3SYOA 1FNGB 2AK4E 3UP1A 1A6AB 3QO1A 1HEZB 1L9PA 4PJEA 1KTRL 4HXBL 3C08L 1LK3H 3S3DB 4F93B 3VFOA 2HWZL 1YEJH 1Z3GH 2JB6B 2ITEA 4U1SA 3ML9A 4Z7UA 1EJOL 4MNHB 1FNFA 4ZQKB 3D0VA 4NQUA 4F15B 5IREA 5E8EB 4Q9QL 5FYJE 2WXRA 2XG5A 3CX2A 4PJ8B 2IWEA 5KSVB 4ZDHB 1P5DX 4Z7UE 5DI8A 4F33A 2FBOJ 5JA9A 1BREA 2W91A 4GIAA 4J3BA 3V0FA 1RAMA 4GKZA 4FERA 4QWWD 1YZZA 2I5YH 2HPOA 5FW6A 2GC7C 3JBG7 4X4XA 1F11B 1UEYA 3CZGA 5C07B 1FVDA 1T21B 2FE0A 1S78C 5HI3D 1ACCA 3VI4A 4FFVC 1EFQA 3UJTL 2BY3A 1U8JA 3OLDA 1JK8B 4M5SA 4X6CB 3AROA 1XCXA 1L7IH 3FQNA 1P6FA 4ODUA 2WLLA 1Q1JH 4I4WB 35C8L 1PDKA 1NCDH 3DBXA 3QJHB 4AEHH 1L6ZA 2AP2A 3FFCB 5GGVY 2ZOLB 2CK0L 2J71A 2Y8LA 1FNSL 4O4YL 1A0QL 2IAMC 2A6DA 3BH8A 5FV1L 4DGIH 1JYXA 4GSUA 4CNIB 4EI5C 3LSOB 1KIQB 1JFQH 3OZ9H 5IB3A 3TH3T 1MJJB 4FMFA 2CHDA 1MREL 2E8ZA 1NAML 3QJZA 4Z7VF 4E41D 3RNQB 4X5WA 4YSPA 3VX1A 3CLFL 3T09A 3WLBA 1UJ3C 4BQBA 1F4YH 2AQ1A 1HFUA 4LRIA 3L3OB 4OZFB 1ETA1 1TU2B 3H54A 2BVQA 1KBGL 1AMYA 3QH3A 3MCLL 2HUEA 4P5TD 4LSRL 3WIFA 2K7QA 1HE7A 4XNXL 1PLAA 4I5BB 4OH2A 3IDNB 4G82A 1KCUL 4W9HC 4FG6D 4KUCD 1BZDA 5EDSA 1BFVL 3G9VA 5EA0L 3DTDA 3PWLB 3Q01A 2BNRB 3D25A 4BEIA 4A1RA 5I30L 4WWOA 2BJMH 5DCCA 1JNJA 4KAQL 1AMXA 1XGUB 1ZT4B 3EYUH 4FTVA 5F6IC 2J21A 4XH2B 4LCCB 3HNSL 4PJ5D 2EQDA 2RA1A 1F00I 4GRLD 4UMSA 1GGYA 2VSMB 1U8OA 1X5KA 4ZSOA 1IEHA 3ENCA 4PEEA 1QTYT 3RDTC 2AITA 4OZGF 2JQZA 2KDGA 1RIVL 4G6FD 3BWAB 4UIMB 1MHPL 3BUYA 1N9PA 3HMXL 4PS3A 3VFWA 1HESA 3FDWA 3FUMA 3OX8B 5CINH 3EZJB 2G3XA 5BZDB 4F91B 5AYUL 1FDLL 3ZTCC 3WXVL 1CF8L 2Z31C 4BA0A 2KBGA 1PFCA 5BVJB 1PZBA 1C5CH 2UZPA 5IW1A 3EH1A 5D7JD 5J89A 5C0RH 3BLKA 3A47A 1VZIA 2GKIA 3V52L 2NY5C 1P5UB 4JRYE 4H1LB 4XNYL 5F9OH 1SOXA 1WO2A 2WGNB 4XHJC 4ELKA 2VDLL 2J3SA 4WENB 5CN2A 4XMLL 2CJUL 4U6YB 5GRVL 1F97A 2VDQL 5TF1H 3BIBX 4JPSA 4K94H 4OGYL 1QSFA 3RL2B 2MQ3A 4N2FA 2QR1A 3CPUA 3V5KB 1N10A 5IBLD 1JPST 1DTUA 2JTYA 1FAIH 2J25A 1XSZA 5KVDH 5E6ZA 3RWJA 4J3OF 1S7SA 1A66A 3CX5K 3S2AA 1OK8A 1WBXA 2C8NA 5HJGA 7FABH 2XQYG 1OLZA 1RULL 3S37H 1CD9B 3IYLW 4XB7A 4EIUA 2O5YL 5E1HB 2FIRT 4LCWA 1ID5I 4DEPC 1G4RA 3DGDA 1QSEA 4YHIB 5JPNB 1JZ5A 2ZWLT 2ZWKA 3FCTA 4OF8A 4X50A 4AQ8A 3FTWA 3GXDA 3NTCL 4MCZA 4MNGB 3N41F 2IBZX 4LCWE 3QI9D 1TKWB 1J10A 3OKNA 3B9DA 1I8IB 4PWFA 1F4XH 2F74B 3QDMB 4C4KO 5LN4A 2OMWA 2I9LB 4PB9L 1IUZA 2IGTA 2QQQA 1OGTB 3CIQA 1RCYA 1E5YA 4J3UA 4JFOB 1T7WA 3RUGA 2VC2H 4TNEA 3CE1A 5EUOB 1RUQH 1O9WA 5KBDA 3LKRB 4KRLB 5DJYB 4B0AA 3NGBC 5IJKC 1JI1A 3NJGA 4RBPK 3RUGE 2AJSL 4EKXA 1W2KT 5KSUB 4JFED 5T8IA 3S88L 2X1QA 2NY6D 2ICES 4HCGA 3BP4A 2NX5D 3LRHA 3QE5A 4HJ0D 1UWEL 3PQYB 1UQSA 3GJFB 5JQHC 4YLCA 1HH9A 3WTVA 5CZVH 2NR6C 1KLFA 1U8CA 3HHRB 4B9ZA 3B83A 1WWCA 2R1WB 4OCYH 1OM3H 3GXMA 1A7QL 3MACL 3TBSA 4RAVB 2ATKA 2F7OA 3PWNB 1A21A 3EGDA 3LNGA 4L8DA 4XXCC 1CXKA 1CIUA 2X2YA 2EYSB 5LGHL 1KEML 3O4OC 4NJAL 4MA3A 5CLTA 3O2DH 2MRYA 1U8LB 1YNTA 4PJDA 3A5VA 1J3MA 3INUH 2YFNA 4H26B 1VESA 4PWKA 3QXTA 1OO2A 2NY3D 3FHAA 4YXLL 3ARGB 3EO9H 4ZMQA 2XV6B 3BLBA 2YD1A 4UT6A 1XO8A 2IVFC 3O9WB 4YOKA 1RJZA 1IFHH 5GRWA 2WXQA 4HLJA 2HMIC 1HU0A 4DPRA 1MVUB 3CFEA 3LN9A 2Q8AH 3K74B 5IESH 3O3DA 1AJ7L 1MFVA 4IYKA 4RRPG 2VLRD 3IDIA 5L4MA 3EOTH 3NK4A 5B38G 3UPRB 3U0WH 4LPUA 3P3RA 5DZPA 1RP9A 1C7SA 1W80A 4QUOA 4EO5A 2ZXDA 3P0YH 2DQUH 5I8KL 2VXQL 4FMVA 2E9GA 3O0LA 5DWPA 1FZMB 1W6LA 3K2IA 3MV9E 4CDHA 4S1DD 4PJIB 2ZKMX 1DDTA 3LHPH 5E8OA 1QWHA 3SE4C 3L2LA 2AXWA 4PWGA 1QBBA 3DX3A 4M93C 4C54A 3V0HA 3Q1EA 1H3TA 1JDAA 4XMPL 1C08A 5D4HA 3TT3H 1HYSD 3BMVA 2V33A 1SN5A 4CDGC 2RMNA 3LXUX 1C12B 1KWGA 4NQTA 1DEEA 5CUSH 5BRZB 3G04B 2IDFA 4RMQA 1ORSB 5F7UA 3APNA 1RD6A 1TZHA 1D5RA 1T22B 4HISA 1IC7H 5IEKB 4PH8A 5E8NB 3KPMA 1AZVA 4PCTA 4L0ZA 5ICZA 2CDGB 2F5AL 1VEPA 4JB9L 3WNIA 3RPIA 4RH4A 1SBSL 4JLRB 1EDQA 1I9RL 1RZ7L 2P7TB 3Q1SL 3LQAL 5DTFB 3X2QB 2JK5A 3VFRB 3GS7A 4N5ED 2R23A 5HD8C 2FB4L 1JVOA 2CDFB 5A16B 3GZPA 1AXSA 4HC1L 5BV7L 1KPRA 1MQKL 5ABZA 2Y69B 3FPYA 1A4JB 3ZKMC 4GSDL 4DW2H 4P3CL 4FKHA 2CO6B 3DX9A 3KL0A 3NMEA 5LGYA 1EZLA 1CGVA 5J9PB 2VR9A 1N64H 1EAOA 2ZCKL 3D08A 2FEDC 3S2CA 4MA7H 3RTQC 1BG1A 3TO4A 3CBRA 5K9QG 2KLRA 4TNGA 1D7FA 4KJQC 3FU5A 2D3VA 4ZTOL 4TTDD 3N2JA 2H2SC 2IG2H 3U4EA 1UXSA 5FLUA 2HJLA 5EU5A 2ADJA 1U92A 3PGCB 1AR1B 2QSTA 4KTEH 4AT6A 3WS6C 3SHSA 4L4VA 3BIKA 2XHIA 1R75A 2F08A 3QR0A 1ZVHA 3ARBA 2B3IA 5F44A 1FC1A 1LEKB 4DTGH 5CEZL 4CC4C 5KYWA 3I0XA 4X6FB 3KPQA 5BW7C 2FO1A 4JY6B 4XPFH 2Q86B 2ADFL 4L4VE 3JUZA 1QVOB 4YH6A 1LO0H 5E8PB 3ULSB 3QG6B 4LCIH 4R5VA 4J12A 5L0QB 2BVOA 2JVUA 1RZ8A 4ZK8A 1KO9A 1CDJA 4IKKA 3QUGA 4PJCB 3WO4C 3W37A 4XPBH 2VM3A 1M05A 1IJNA 2FWOB 2R39A 4ECNA 4XNDA 1B2WH 2B5IC 2LLLA 1BG9A 4OZ4B 5DUPH 4KRNA 1ETJA 3BE1H 4UINL 15C8L 2EXSA 4NN5C 5EEVA 1AD0B 2O1AA 2YSTA 3WY2A 3L1OL 3G9AB 4JHZA 1KXQA 1XH0A 4OLEA 3QORD 5FYLH 2Q10A 3GPSA 1AS7A 1CK0H 4XE5B 5IW6B 1QX1A 2VDPH 4KNUA 3SDDA 4Q9CA 3UTSE 5DJDA 5DRNB 4AMKH 4PJAF 1VFBB 3KD4A 4MXVE 4ZUVA 1DJWA 3VGAB 3ZUNC 3ZY7A 2N1TE 3L4WA 1MFCH 2J73A 2PWGA 4Y16B 5DRZB 3O4LE 5GGUA 4NQSB 3SE3A 2OTPA 4QLWA 4M1DL 1E9QB 3VSQA 1TOXA 1HHIA 4HGWA 4UTBH 3QUXB 1GZPA 3JTTA 1U8NB 2N7AA 3KLHD 2X09A 4OLYL 3O3EA 4M1CD 4TVPL 4XVJL 3V0JA 4NM4H 1V5JA 4AYEC 4CFFA 1PNCA 1FYHB 2ADYA 2Z8VC 5E7FA 2ZXCA 3QULB 4B0MB 2FX8L 3VWKB 1F90L 3B9EA 4FLHA 1IO4C 4RODB 3K2UL 5GSRA 3CJJA 3LNIA 2PLTA 4LLDA 4LAQH 1CLOH 3IDMB 4RGND 1INQB 5C0GA 2DS4A 3LZFH 4WW2B 3D8MA 4AENA 3REVA 3KPRD 3PNWB 4ZOEA 4YDKH 2XFGB 2AANA 2WIIA 3WN5A 3PGDB 4KDWA 1DSFL 1JF1A 4WU7A 1PD1A 4IEFB 2X9WA 1PBYA 1J5DA 1S7UA 2ARWA 1OZTG 3OSTA 4F80A 3LVTA 4XCCL 4DFHA 1VFOA 3EFFA 4EPSA 1DBKL 1HWWA 3F5WB 5D72L 3TEUA 1T2QH 1ZGLP 4P4KB 1QR1B 1SJHB 5HHMD 5AVRB 2O4EA 1JV2A 3PXLA 5EIQA 4N0UB 5DHEA 4Y4KB 3MGOA 5H37A 4BGDA 1WS7A 5IFHL 2V92A 1UT9A 1PL3A 4NKMB 4LLMB 1QN4A 1FRGL 4DGYL 2AI0L 2OW6A 2R29A 5IJVA 2R69L 2HTKD 4PR5B 5EG6C 3R7RA 2Q8BH 2VERN 3P2BA 1QN5A 2OTUA 4LVOB 3TYGH 4IBWA 1I3UA 2WTOA 4Q0XH 5IQMA 3VQLA 2D3LA 3PWVA 4LP4A 2WXGA 3MNZB 4NO2A 1KB5B 5D2LF 1GR7A 4Q6IB 1J0HA 3NSYA 4EIGB 4JPKL 4D8OA 1VDGA 1N4XH 4ODWA 3RGVD 3R19A 1NGZB 2Z4TA 3BZDA 4GAJH 4L3CA 4YPGA 4B0MM 5ILTL 1I1FB 4DKDC 2JOIA 2IBGA 4U6TA 2B14A 4FHKA 1UM6H 2AEIT 1VGKB 3MJ9H 3F6LA 3NCXA 2DL2A 4KO9A 3UO1H 2I7OA 4AG4L 1BV8A 5IV2A 1AP2A 2FATH 4HS8H 1IL1A 3SCMA 3RTLA 3MKGA 2XKSA 5FO9A 4X8GA 2OJ1A 5DUML 4X6DB 3DSFL 3SZKC 3QJXA 4KI5F 4KROC 1IAOA 3M46A 2HN7B 2BOBA 5F7MC 3VFMB 2R83A 5EF2A 5CN3A 1X7TA 3QYCA 5IQOA 3JV0A 5I6MA 5KAQG 2B77A 3AZUA 1E4JA 2FEJA 4K9EL 4WU5B 4I87A 4XO3A 2V3DA 4DZ8B 4HZ1A 4QKXB 4AC2A 5EU6B 4NP9A 4P2RA 5K9QI 1S9YA 4AM0B 2FKMX 2XX0A 4OCXH 3K71A 1CXFA 5FUCE 2P42B 6PCYA 3PWUB 4LK4A 1A4CA 5D6CB 4ORGB 1Q8MA 1N5YH 4OT1L 4BQ9A 4ONFL 1TTCA 4X83A 4OD1H 2JI2A 1MEXL 3BAIA 4AYID 1GC1L 3APCA 3WNOA 4G8GB 4GXFA 5AVSB 4L0YA 4PS8A 2OJZH 2ESVB 3OB0H 1MFBL 2A1WL 2J20A 2W07A 1OP5H 3UFIA 4U1IA 5F7EH 4KKAC 1EJFA 2AV1A 3MRHB 3WL9B 2L0DA 1FFPB 4HEMA 2CGZA 3VXQA 1FE8H 2OI9C 1JWSB 3QCVL 1YEKL 3KLKA 5C86A 1P4UA 4I8OA 1UD8A 5D1ZB 2ZXWB 4HJSA 5SWZA 4APXA 2JF1A 4I2XA 1A7OL 4PRHA 3I02A 3MV7B 4D94A 1EXUB 5DD5L 3IETB 1EO8L 1JHKH 4HUNB 1JWUB 5JHDD 1PY4A 3N44F 3MLYL 5DJ0B 3HB3B 5A3IC 4JFXA 1RZJC 2V2WB 2D7MA 2KC0A 1SLWA 2V6HA 1HHKA 5DT1L 4LCUA 2HJFB 2NWVA 2IO5A 2YZ8A 4AQOA 5IOPB 1EBMA 3JWNH 2LE9A 1JTOA 1PJ9A 2DMGA 3WS3A 4HOMA 2F9BT 1ZK9A 1ZV5A 3IGAB 2PCYA 1ZHKB 3IDUA 2F8OA 3FSVA 5HGBA 2IOIA 4JFQA 1G0YR 3H9SD 4P9HH 4EZKA 5IM7A 2OL3H 1O7SA 4IOIB 4OJYA 3PIQB 1PCMX 1E9OA 2LHAA 2Q6WA 3QB7C 3UO8B 3FTXA 4YPJA 1Q1PA 3R0NA 1BZ7A 2Y4SA 4MVBD 4NRXA 4PFEA 3M07A 1Q72H 4FQHB 5C71A 1JBJA 4WFGD 4I3SH 1NUDA 2IPUK 4BE5A 5CEZD 4QNPF 3LKSA 2NY2B 1FO0L 1LLAA 1R46A 1JZGA 4FNLL 4XPGL 3UAJA 5IMLA 1ACZA 5AD0B 1XEDA 2BHUA 4QXUH 4Y2NA 3ECBA 3CPLB 3EOAA 3L4VA 4HZAA 1Y6KR 4WI3A 5IQ7L 3BGFC 3BO8B 1HINH 3U0TB 3F7YA 2X9YA 4ONOA 4HPOH 3IAGC 1GMEA 4OCWH 4AKQA 3EDFA 4GI6A 4ZTPL 4PGCA 5GZOD 3BYYA 3DO7B 2P48B 3KH4A 4DN3L 5TPWH 4P48A 5EC2B 2CQVA 3CWAA 4EUPA 3KYAA 3LN5B 4LLYB 4YHKH 2XY2A 1F6AA 1XSIA 2ZNWA 3FRPA 3VE0B 3FAXA 1E6OH 2B1AL 5TDNA 1NFDF 2W60A 1AIFB 3T1FA 5MHSD 1KTLA 4HV8A 1M6UA 2NUPA 4GMTH 1I7RB 3C6LC 5D1QA 4R7XA 3UBXA 2CGRH 3UYRL 3V5DB 2C9XA 3K2MC 2CUMA 4QRUB 4ZFZB 4JFZH 5JW5B 3VN5A 4P46D 5JORA 4XC1L 3GDCA 5D1QE 5B1BB 1VKLA 4L5FL 2B16A 3CN4A 4KMTL 1ET7A 4P5TB 1SDDB 1ADQA 2X4RA 3U25A 3ETSA 1E9PA 3VFNB 3WY3A 3MRQA 5DMGC 4RETB 2CR3A 1HXKA 1WYJA 5IMKB 4BXSV 4KOCA 1UCBH 1I7UB 3K8KA 4X5RA 2OR9H 3O11B 5E56A 3PDOB 1NDTA 4R2GC 4MCYA 4W1TA 3J27A 3S3SA 3WTWA 4JFVA 1NA8A 4YNYA 3WKML 4PJ5B 3KDMA 4R8WH 4JM2A 4NDMB 3WNKA 4D7BA 1JCVA 3EH5B 2N1KA 3F62A 5DURB 5EZOH 3BVDB 2V9UA 4N1EA 5E00B 5D7EA 2BS8A 4YDJA 3C09C 5FKPA 4ABVA 5C0JA 4EAEA 3KXFB 4ZYKA 1TQVA 2IH1B 4I1RA 3NIDB 5CKGA 1TGHA 3QFGA 2QMJA 1GY2A 1IAKA 1H3WM 3U4KA 1OTTC 1UWFA 4ZOAA 3MRLB 1M2OA 1T2JA 4G42B 4N8VG 1OK0A 5EUKA 2YEVB 3L5WB 1L7IL 3UL4A 4D8PA 2X2UA 4FD0A 2APBA 5AW3B 5CZRA 4Z3JA 1JYVA 4F8TA 3LIZH 4C58B 2C9SA 4NS0A 4Q7DA 3TBCA 4IS6B 4OFQA 3BN9D 1U9KA 4Q6YA 3EYVB 3MV8D 3D12B 2VAJA 3VFPA 5B21A 3GFUA 5IVZA 1X5MA 1KJVB 2A99A 1KBBA 1DFBL 2ZJSL 4JZOA 5IVOA 2EIZA 2FECL 3NA9H 4PQXA 4QEGA 2K3TA 3CGTA 5HYQA 3H2PA 1J0KA 4JAMA 3T1WA 1FN4B 4HKJB 4LKCA 1G43A 5INDB 2B1HL 2DDQH 2WZ0A 4G80B 4BKLA 4NZFA 2J1XA 3DMMC 4CU6A 1T89A 3GBNH 4QHPA 4K3JH 4YDLB 3RWHB 4NUJB 2FNBA 5CLWA 2N4IA 3KYOA 5FM5M 4QHMB 2XUWA 1QYGH 3O41B 2QSQA 4K71C 3O6FA 5D8JH 1ZANH 3EDKA 2V5TA 5JXEA 4R4NC 3VXRB 5HVWA 1HHGA 4XMUA 3FTYA 4A67A 5J56B 4OVUA 1W72B 4L8CB 3TZVD 1RPQA 1GHFL 3NZ8A 2LLNA 3EFOA 3HC3H 2VR4A 4HAKA 2X42A 1NMBL 4E42A 5TJWK 3U46A 1YA5A 3EYUL 3SQOH 1H3PH 1RM1A 3KPNB 2PWWA 2ERJC 2X4UA 5HHQA 5EEYA 2AK4D 4LSVH 5FA4B 4GKOA 3NPSB 3HNTH 5CLXA 1TVBA 2GT9B 1CLVA 2AEQH 2OX5B 4OJCA 1XSJA 1S7QA 1DZBA 3EJRA 2DH3A 2VXUH 3VD7A 1TNMA 2NZ1A 2VH5H 1WV7T 3L7EB 4AYFA 2CKBH 3LKOB 4CU7A 3GRWL 4N2MA 3CXDH 1KNOB 5CINL 2UXVA 4EAJA 1AZRA 2ZUUA 1GSMA 5FYJD 5E6YA 3OR6A 3DO4A 4NHUA 4X7TA 1C5CL 4QF1B 3NCMA 4FXLA 5C0RL 1YJDH 1P84J 3DURA 4U1LB 4G6JH 1I9IL 4O2FA 2CBOA 1IGIH 1CGXA 5IBUB 1BFSA 3SKMB 1IAII 3TV8A 1AISA 5LCVL 2V9RA 3ZN6A 4AYSA 4FFZH 2VR6A 2W59A 4LESA 5CILL 3W81A 1GL4B 4Y2DC 3CSPA 2D31B 4XCYB 3IPFA 5BVPL 1X5IA 4ZAKD 5TF1L 5IIEB 1PFOA 1PZ5B 3ZE1F 3MLVH 3NDZE 3KBEA 3MR9B 2IAMA 1QD0A 4GH7B 5SWSD 3RIAK 4EI5A 3VNZA 1CD1A 5KVDL 5KANG 4I3RH 5E9AA 4I0KA 4JVWA 3HBPA 1P7HL 4FYRA 3S37L 2RQEA 2VLRB 1NWOA 3V6FA 2IFFH 1XGRB 3FTGA 3CG8A 2FZ3B 1S7WB 2J5LB 2BP5M 4B9FA 2VDNB 1UD5A 4ZW3A 3T3MB 1UJ3A 1TQCC 2CM5A 4ICXA 2OTWB 2AXFB 4N9GB 5DK0B 3OAUH 1PS3A 1T83C 4KVPA 1F56A 2YPLA 3MUJA 1F4XL 2QZQA 2XPYA 5CZXD 2BNQB 4LXFA 5J5EA 4M6MH 4N0FB 2VDRB 1CQYA 4TV3A 5HHOE 3IVKA 3HC0A 1A1NA 1L0XA 1C1EH 1QN8A 4XBMA 1NIEA 1T3FA 3BAEL 4TNVF 3ZKND 5JZ7D 2QGDA 2LVEA 3BISA 3W5NA 1MY5A 1TSHA 4BHUA 1OQXA 5CKAA 1KEGH 5DYOA 4Y5VB 5L2KE 1ZSDA 2P8MA 3U1PA 3B2UC 1GYUA 3QDGB 4WUUE 2DJUA 4MJJA 5J8OA 4PJBE 3MJ8A 1IV8A 3VWJD 3HI1B 4IL8A 3RDTA 5CP3H 3TH4T 3FN9A 3ZMEA 1LP9B 2FGZA 4NP4L 1Q38A 3VFUA 3MBWB 2YAOA 3CSYB 1DUZB 3P3SA 4TVSa 4OCYL 4H25B 5GRJH 5CCHE 2EAEA 5E2UL 3CN3A 1XGPB 1N0LA 4FQCL 3G5VB 2Z31A 5E6ID 3BP6A 1KIRA 5E6SB 2CHXA 4N0RA 2NQCA 1QN3A 1IQWH 3O2DL 4LE8A 1RPUA 2C9AA 5E6UB 1EJ6A 1Z9SB 1DQDL 3MFFA 4NQCA 1UH4A 1Z6JT 3QUMB 3N43B 4BWWA 3EO9L 3QS3A 5ES4B 2NNAA 4O02B 1TNNA 2YAFA 4NQCE 3B7SA 5HGDA 2ED8A 1K9TA 3RVVC 4NZ8A 5E0FA 4HCFA 4JFYB 3RWFB 2HXAA 4HIHA 4JRYD 3QJUB 1AQHA 1CBJA 1OSYA 1Q0YH 1Y18A 1WTGT 2Q8AL 1KCRH 2LOEA 5IESL 4XAKE 5IOKA 4G5AA 3EOTL 1AGDB 3HN5A 5ALCL 2VQ1B 5SX5H 3SZ6A 5EZJA 4E68A 1MW1A 5K39B 1D3CA 2FT8A 3Q8AA 1GS8A 3U2SA 3DA0A 1S9XB 2YD2A 4UM8A 5KS9F 4QRRA 1RU9H 4ZT1A 2EEXA 4MD5A 4N87A 4P2YA 5C0CE 5C0EA 3T6QC 4PJ9B 1E27B 2EC9U 2EIDA 5HYSA 3FQWA 3LHPL 3P54A 5I26A 2JMRA 2SODB 3UYPA 3HG4A 1VF5C 4HUKB 4M6OH 2F6AA 3L3KA 3D2UA 3QPKA 2DJ4A 5HGAB 2WGXA 5FB8A 4GRWF 3CTTA 2VOTA 2QQLL 3QORB 3TT3L 2IPTL 2X3AA 5IB5B 4IMLB 3CHOA 5BS0E 4M7KH 5B1AB 4DERA 2Z9TA 3BKJH 4LCWD 4XX5A 1F3JB 3LD8C 2WVVA 3CFKB 2VJ0A 1IC7L 2LU4A 1D7BA 3VGDA 5IJKA 1AYOA 3NIFB 1IGFL 1W8NA 2VLME 5J13C 4Y1AA 5SX4I 3RPKA 4W6XB 1MG3C 1EEZA 2VRQA 4NPKA 2JJVA 2AXJA 5E0QA 3FRUB 2MOVA 1U4EA 2DQEL 1MAMH 8CGTA 2ARJA 3BVVA 1T1ZA 5FHAH 2P9RA 1M7DA 4YC2C 2J8HA 3AM8C 2ISDA 1T1XA 2E56A 4DAGH 4GW4B 2J72A 2YPVH 1N12A 1BMZA 2J6EA 4PY7A 4CAGA 2PTTB 4NQDE 2WV3A 4XXCA 4MA7L 4F8LA 3BRDA 3EYSH 5KANI 1VJSA 4I0PD 1XAUA 4XO4A 4JZJB 5CBAB 4OFDA 4ZI8A 2VE6B 4KZEH 1OOWA 1SEQH 1TTUA 1PCJX 1PKQB 4XXWC 3VDBA 4KTEL 5EPCA 2DI7A 1IQDB 5FCUH 4BZ2H 3DXAB 4MMXB 2QDVA 3DV6A 5E1GA 2H41A 2AJXH 4XZ4A 3DWTA 2NYZA 4DTGL 1TJIL 2F19L 2ZIDA 4FG4A 5F7DB 3TWYA 4PYGA 1AI1H 5DHVH 4YS4A 2XETA 2NOIA 1Y0LB 1KYDA 4LCIL 4N3UA 5GGVH 2ENPA 4IOSA 3IRZA 3NUKA 4GRMA 1SHXA 1IT9H 4X7FC 3G7TA 3CZJA 3DVFA 1MW3A 1B2WL 5E9NA 5J3HC 3QIWB 5I5IA 5I5MA 3TX4A 2PWEA 3EG9B 1EIBA 4QTFA 3T8MA 4K3EH 2YD3A 3TURA 1YMME 2AQTA 2IIJA 3QUZD 4PS4H 2O5XL 3ILQD 4KDVA 1JGEB 4X5PA 3P3UA 3DPUA 4IDLA 5FYLL 2UXTA 4UOZA 2CUHA 3MC0A 1ACYH 2VDPL 1FFOA 1CDHA 3PJSB 4A7GF 4AMKL 3FQXA 3VFTB 3S9DB 5JLZB 5ESAB 1UKQA 1H5BB 1F2XK 3MV9D 5C0AA 5IT2L 3A22A 1ZV2A 1MP9A 4FL4B 1BOYA 2HRPL 2XWJB 3EAYA 5KL0A 5H2BA 3VW3H 3SDCD 3LNHA 2H3KA 1O7DC 2XN2A 3DGCR 3H3BC 4KKZA 3ZPDA 5EZIH 2HL9A 4J3OC 3P4OA 4KJYB 1WZAA 3JQOB 5DFAA 4YR6B 2XA8H 1BFOB 3GI8H 2B2XH 2EDJA 2VIRB 3CUPA 1ZLUK 4OBRA 1JV5B 4U1GB 3M1OA 2FJSA 4IRSD 2PXYC 2C1PB 1JOIA 1FI8C 5DVPA 1PNDA 4G5ZH 3RWIB 3T2PA 1CLCA 4LAQL 3II3A 2YZ1A 3CVHA 4HCRH 1I4FB 3MBEC 3MRKA 4N1HB 4C56A 2Z65C 4ELMB 3T71A 3WE6A 3AT0A 4PD4J 3HPLB 5JDSB 3CW7A 3DDGA 2Z7WA 1IGYB 3VD2A 3DROB 2CPUA 4ZG1A 4MKMA 4C56E 1ERNA 4WO4D 2WYIA 3RTQA 4OD2A 1U8QB 5EO0B 3IJHA 4A04A 4IOFC 3PYCA 5EEZA 5IR1A 3ME0B 1WZLA 1PLCA 1QBMH 3UCQA 5HGHA 1EHLH 4NUGH 2JCCB 4QMEA 3HI6L 3ZRFC 4BQ8A 2J1KA 1MCEA 3MQIA 3QEHB 1EHKB 3VA6A 3WS6A 5I82A 1A3QA 3AGWA 3CAFA 4YZWA 5ITFA 4A7UA 1WFTA 2QVKA 2WKOA 2AQRA 4PRPE 5AVZB 1REIA 4Y19A 1S8DB 5LQBL 3HN8A 1QLEB 4HBCH 1DVXA 2V8LA 5E95B 4QI3A 1YAIA 2ENSA 4KJWD 5F96H 2QADD 3E2HC 2Q8BL 4JE0A 1CF1A 3DV4A 3DX7B 3GM8A 2XZAH 3MRJB 1OCZB 3UC0L 4Q0XL 4J5VA 2JKJA 4LDCA 1JERA 3HZVB 1IBDA 3FO9A 4WY7H 5FK9A 2GSMB 4L4VD 3MA7B 2C26A 5JNYB 1ACXA 3BAJA 2W1NA 4GAJL 3GINA 3SBWC 3VXPA 2IWKA 2JSFA 4EOWH 5A40E 3H9SB 5E2WL 1SQ2N 1NIAA 1UM6L 1JGVL 2P5WA 1X5FA 1EA9C 3MJWA 5JHLH 3H1ZA 1DSWA 5GGSA 3MJ9L 3IJSA 2DEYX 5TE7H 3WN6A 4YEFA 4J3XA 3BHBB 3BZEB 2CO7A 4FS0A 2VL5A 5ID1B 4HS8L 3VDCA 3K46A 5F6HJ 3KLAB 2WB7A 3NA4A 2GJJA 2XVKA 4G8IA 1Y1DA 1YN7A 1KJMA 5HDWA 5F8RC 3UTSD 2W9DL 1ZV9A 4H2AA 3RVUC 4B53A 4JHBA 3WKYA 4ERSH 4TVUA 2VMCA 1VIWA 2HKHL 4HDIB 4R4FL 3GMLB 3ZHDA 3O4LD 5C0BA 1J18A 1XH1A 4G6ML 5IMMB 1NFIA 2WVSA 3T0EC 1T5WB 4D9QE 1A4BA 2DWEA 3BVNB 4G7SB 4YL9A 3QZWA 4XBGA 4KJPD 4F7EA 2DN7A 1ROCA 2DRUA 5I15H 4QTHB 2XY1A 5ICXA 4LL1A 2K9FB 3F84A 2BSSA 2X1PA 5AB0A 1S7VB 4ZMAT 2VYRE 2XTJE 3OXSB 3FC8A 3GKZA 4IJTA 1DBMH 1NEZA 2VABB 4DHLA 2LV4A 1EK3A 1AYRA 3I6GA 4PJGB 5HDBE 3V4PB 4H8QA 1S6NA 5T3ZH 1IKNC 1PF3A 3D39B 2MOGA 4P4RA 3IFLH 1K6QH 5DJAB 4P46B 5IVXF 1DVFD 4HK0B 2JKNA 1QASA 1R24B 3TVMA 4OI7A 4L3EE 1WZKA 1PD0A 3FK3A 3DGGA 1VADA 4BJUA 2ALAA 3PJLA 4F9PA 3RJQB 3I3WA 5AVYB 4I85A 2FJHB 4WHYH 4FNRA 3IMUA 3ZGHA 4K9JA 1ORQB 4P9HL 2WBJA 5EU3B 4F24A 2JQAA 1TYRA 1F8TL 1E5ZA 3U9WA 4DESA 3BYTA 5CNHA 2BIIA 3AFLA 4QHUB 2YBRA 3SOBL 3UJJH 2BP0A 2VDNL 3AS1A 3HG1A 1ZT7A 2PYFA 1FBIH 2NZIA 1Q9KB 5CGYC 4DEWA 3MUGB 5DEFA 1KELH 5AW8B 2PPFA 5DA0B 3N1PC 3ALXA 1H3GA 4N2OA 4XP5H 3T6ZA 3EZ8A 2C3VB 4QRSA 5AW6B 4I3SL 1KN2H 2VDRL 4EDWH 1BF2A 5DJ2B 3LMJL 1U21A 3TN0A 4WKXA 2HT4C 5CP7A 4Z77A 3EOBB 3HHSA 3S35X 1MHCA 3IU4L 4Y4FD 3R4RA 3EGSA 5J12C 4N85A 2R8SH 3UTPE 4HOWA 2EIKB 3GSRA 5KVGL 4JHUA 5H4ZA 1M1XA 3K8MA 4QJ4B 3I3EA 2YGQA 3P4MA 1BLIA 3SCMD 3VU1A 5JO5A 4B9KC 4Z7NF 5IHZA 5K9KB 2OA9A 1FGVH 2R0WL 3BFQG 4Q52A 4JDEB 2UY6A 1XBDA 2A3TA 2Y07H 5TPWL 4G7RB 1H9DA 1BIIA 4WK0B 4KXDA 5I24A 4S0SD 5FYLD 5CJ5A 4LO9A 4YHKL 4M7ZB 4PCYA 1UJTA 3BXNB 3C5ZD 1MELA 3KJ4C 3THMH 5C6WH 3IDGB 3S5YA 5FOBA 1A6VH 1E6OL 2ZSVB 3ESPA 3QXDB 1DCLA 2CGRL 3IXTA 3VGEA 3V4UL 5FGCE 8FABA 1IGCH 2EJ1A 4JFDA 2CJ3A 2NXYB 3QUML 2F5BL 4F3FA 3FONA 3ARUA 4JRFA 5FM8A 1IC5H 1KC5H 2WVUA 3V0VB 2I32A 1IGJB 1JCKA 3L4TA 4JFDE 2FX7H 3G5XB 4Z23A 3V8CA 1XAKA 2WQVA 5EBMA 2QPDB 4Y4HD 2UZIH 4R4BB 5G2NA 1BVKA 4L1SA 1OPGH 3OPZH 1WK0A 1JPGB 1A02N 1UT2A 5T3ZE 4MA1C 2MMXA 4DP2X 3B7YA 2HCZX 5CD3B 2FLRT 4N0YH 1IZKA 2I85A 2KYIA 1T20B 2AC0A 3RAJL 3RWEB 4EN3B 2OLDA 2CM6A 4D0DA 3IGKA 1LD9A 3C5JB 3RKDC 2H6PB 5HHPB 3TF7C 4LB8A 3V4VL 3I2CH 1UA3A 3SDXA 3V9FA 4OZIE 4GNKB 1Z5LA 2R9HC 3QO1B 4AMWA 4HIEA 3NCYS 2R56L 3R1GH 2Y3AA 4OGXL 3SDXE 1ZOXA 4E9LA 5I6OA 3K4ZA 3VFOB 3D4VA 1TTBA 3VH8A 3KVDD 4R90H 4U1SB 5LNEA 5E1AB 4Z7UB 3DETD 5AB9A 3C75A 2R0ZH 5D7SL 4KU1A 3LIZL 1NGXB 2XG5B 1SVBA 3QPXH 4A2HA 2IPKA 4F27A 5CM1A 3WIHA 2ZP8A 5DI8B 4F33B 2F58H 4QHNA 5I66A 1M2VA 3G6JA 4X5XA 5GJTH 1SOQA 2WPGA 4GKZB 4RMRA 4GKLA 4YXKL 2EDDA 2HSIA 2LABA 1D7CA 4MJIE 5DJZA 4KX8A 5ISZE 4YO0A 4FQLH 4RFEA 4X4XB 3NJHA 4V33A 4NZTH 4FNPA 5I71B 1FVDB 3ML8A 2VO5A 2C1OA 1RUAH 5EC1B 3SY0A 1MJ8L 4P23D 3VI4B 3U9PH 2XWBA 3EO1A 4R26L 1WRFA 2XZQH 1DANT 4OM1H 4ZPVA 3MREA 2DDQL 2EEDA 1T6BX 2G3MA 1BBDH 3FQNB 3PJNA 5DJCA 1HZHL 2APVA 1U8MA 3T4NA 2X2HA 4ODUB 2WLLB 2OCCB 3GBNL 4Z6AT 1YMHA 1CO1A 4K3JL 1PDKB 4Z3EA 5IUSA 1UZ6E 2OYLA 4CVWA 3C6LA 4AYMC 4KI5C 1CDYA 3DBXB 1JNLH 2WLMA 3MZTA 5JOPE 2Z3FA 1QYGL 4JQIH 5D70H 4JJ5A 4NNXA 5E8DL 3B7RL 4K5NA 1CICD 5FECA 4MB5A 3BH8B 5F9CA 1OAQH 5GISL 4JM4H 3PWJA 3Q8EA 5IB3B 1U58A 3QZBA 2O6EA 4HWBA 4CA4A 1CFSA 4IBYA 1URLA 4YSOA 5MENA 2VDOH 2Y6SC 5D1QD 2IV8A 3CFNA 4X5WB 4B3EA 3EBGA 5C3TA 3SQOL 4ZXBC 5IG7A 4WSGA 4L4TA 5MENE 2HB0A 2P24A 3K72A 1ZXQA 2BVQB 1X7SA 1V3KA 5FWRA 2D7TH 4LFHG 2AEQL 2Z92A 4GKSA 3FTUA 3HBZA 1B3IA 3N3EA 4UT9H 2VXUL 1I9EA 2VH5L 4BHUI 2CKBL 3QQ4A 1ZPLA 3I74A 5K33A 3SGDH 4FZ8H 4AEFA 2ZPKL 3H9HB 3D25B 4GSQA 5J06A 5ECGA 2JKXA 3VG0L 3LS5H 4MDJB 2MKLC 1DVTA 1BJMA 5LGJA 5KBMA 3H4HA 4HALA 4W9FC 4FTVB 4H88L 3FMGL 1S7TA 1EMTH 3MX0A 1IGIL 4L3FA 5E6IB 1R3LA 3JV6A 4JM2D 3UG5A 2DB8A 2AJVH 5KSBA 4JQXA 3ISWA 1U8OB 4ZSOB 5G4NA 1R5VB 1OAXH 3RG1C 5EUOF 1SVCP 3D69A 1B0RA 1CCZA 5FGRA 5KYYA 1R1CA 3BUYB 3GMQA 1VTOA 4RA3A 3VFWB 3DUUA 5EZPA 4BK5C 1BM7A 1P6WA 2DQDH 2AJUH 2D7QA 2L7UA 1JZ2A 5LXGL 4FRWA 3I50H 5IROA 1AKPA 1FL3A 2C9RA 1TYJA 5IW1B 4DEUA 1K85A 4JRYB 4WV1A 3VG9C 2UV3A 4JHWH 3N55A 2J56A 4KRMB 2ZONA 2IFFL 5C08A 4TQHA 4ELKB 1F58L 2IAND 2UY7B 3KEHA 3CFJA 4BZ1L 4EF3A 4CMMA 3MNVB 2DL9A 3OAUL 4Q2ZA 3QUKA 3E6FA 2VW4A 4DSYA 4F37K 4KPHH 5MI0C 3D52A 1RMFH 4LHJB 4WJKB 1QSFB 1XB8A 3SN6N 3IPEA 3TJHD 2M8XA 4LL9A 1KULA 3DX1A 5EOQH 1NCBL 3RWJB 1KJ3H 4FQJL 1C1EL 3QUYC 2V5MA 3T0XA 4HF5L 2XZZA 1JPSH 1UEMA 1QLEL 1WBXB 2YIHA 4W6YB 1Q90A 3CZKA 4KXZI 3DPTA 4NI3A 4D0CA 4G2AA 5GS0H 1O5PA 3FO2A 4LCWB 1KEGL 3GTTA 4JO4L 2A6JA 1PG7H 2BCKA 4MCZB 2EVJA 3OKNB 3DUSA 4HUWB 4N0CD 2OMWB 4EXKA 3D85A 1RHFA 4KKRA 4E9WA 4CU8A 3GSNH 1WS8A 2AJZB 5DWUH 5H37H 4HJUA 2KL6A 1BQ5A 3SKUD 3NACL 1QUNA 5GRJL 3RUGB 5CJOL 1A3LL 3ZQXA 5KYNA 4K5PA 3DRTA 4PJIF 2R2EA 4GI8A 4LQFL 5D7KE 5D93C 4ZMPA 3WU1A 2AF2A 4GBXD 4YK4C 4DVRH 1UD6A 2HAZA 4Z78A 2FDBP 1IQWL 1RFDL 4YHLH 1UURA 2DQHH 1AHWC 5I1IL 3BP4B 3G5YA 4Z7WA 4C83A 2CAKA 1GW0A 5CSZA 4BDVA 5HI3C 1UQSB 1JNNL 4I0PB 2HX7A 5E94B 2DEWX 4EZLA 1KIUA 2Y7SA 5I19H 2H5AX 1HH9B 1ZS2A 3ZE2E 3RSMA 1KLFB 4UF7C 2J12B 1BD2A 1U8CB 2QQKL 1CUOA 2VLKE 5F0PB 4NRYA 3CZLA 1CFMA 2RAMA 3BPLB 3TBSB 1IGTA 5A7EA 5JIMA 3EGDB 1Q0YL 4QOKE 4FFVD 4L8DB 4FEMA 1X4ZA 1G9NC 4KTDH 4PHZA 3LZNA 3QZWG 4AIXA 1NAKH 1OZUA 4G9DB 4MA3B 4UTAH 4JKKA 2WB1A 1YNTB 4PJDB 3CQQA 1MRFL 5IJCC 3BT0A 1RU9L 2C3WA 3CZSA 4LLAA 3DX4A 1RK0A 1ZLDA 3ESVF 4WCYL 4F57H 1NEZG 2NYYD 5BUPA 3ZT5A 3JT2A 1EGJL 2IAMD 1DQIA 3CX5J 3QAZC 1T83A 1RJZB 4OJAA 1CPUA 4UM9A 2V5SA 1IZJA 1WZ1H 3O6MH 3C6SA 3CFEB 1Y7VA 4N68A 3O3DB 4WEMB 1OY3B 1WHPA 3BPOC 1HI6A 2ITDA 2K4WA 4FDWA 4M7KL 3IDXH 4OV5A 3BKJL 1MWOA 1CL7I 1UATA 3I9AA 3WOVA 4F5CE 4H8VA 2MHAA 2GJRA 2E9IA 4YHNA 3QA3B 1E8YA 3L45A 1NGQH 4WHCA 1K8IA 5LNDA 5HHOD 4DP5X 5E8OB 3ESOA 2WOBA 1IAIM 4FNTA 1AFVL 3O2WH 4PJCF 4JNXA 2X05A 2D0FA 4OCRL 1MAML 1C08B 4GRLC 1G6RA 2GW5A 1C5BH 5FHAL 5L2KD 2ZOKA 1JDDA 1W0VA 3ZKXB 5JIPA 4WUUD 2G5BB 3KYKH 1DEEB 3SE9H 2Q20A 2YPVL 5IK3A 2CBMA 1WUZA 1DCEA 1DJGA 1GIGL 1TZHB 4OU3A 4ZODA 2CCVA 2QQNH 4JDTH 1GAFL 4S11A 5ANHA 3KPMB 3EYSL 4EIBA 5ICZB 1BXUA 2LU3A 3O6KH 1GSKA 5TQ2L 5FC9A 3POCA 5D7JC 4KZEL 2FUVA 3FT3A 4PI2A 5DD1H 2IPUG 1YUHA 2JK5B 3GUFA 1MJUH 1T03H 4BH8A 4V2BA 2R23B 2QVFB 3KG5A 3MGAA 2A4CA 1IM9D 2ZG1A 4N2LA 3UPAA 1AXSB 1I1CA 4JM0A 1KPRB 2VDML 4K3DH 4KKNA 4NLHA 1TTGA 2L7QA 4ZW6A 5MEQA 3RVTC 2IMMA 3DX9B 1UWXK 4AL8L 4ZFGH 5FF6A 3EHBB 1IGML 1BM3H 4R7DA 5DQDH 1MCRA 4KGLA 4N90E 4NQCD 5PCYA 2QADB 5IBLC 3OD3A 2VXVH 4XB8A 4XHJD 3ZU8A 1UXSB 1O7VA 4K3EL 1N7ML 4PV8A 3NCWA 3GIVA 5EU5B 2ADJB 1U92B 5I9QC 3ENEA 1WWWX 4AT6B 1G87A 1NCWL 3BIKB 4L4VB 1OW0C 4M6NH 4PJHA 1ESOA 2FQGA 2HG0A 5CGBA 5KYWB 4WK4B 4YEEA 3KPQB 3SPIA 3V0GA 1FC2D 1I3GH 1QFWI 4BFEA 5GGQH 1ZLEA 3V4LA 5C0CD 3QI9C 4ZQTA 5JN5A 1RZ8B 2P52A 1IU1A 2ILLA 4PLNC 3F7VA 1I85C 3ZTJG 4KC3B 3VB8A 1FNGA 1A6AA 1CGWA 2H6UA 1HEZA 3QXWA 4FF9A 1COBA 1BVNP 1OT1A 2F53A 2YFOA 2V17H 1AE6L 1IBYA 3NPZB 4Q9BA 3GK8L 5EZIL 3D2UD 5BS0D 4JMXA 3QO0A 4IKJA 2EKSA 2XA8L 1UM5L 1ZDSA 3GI8L 2B2XL 1N3CA 1IM3D 4K3GA 4ZQKA 1GH7A 3B37A 5DJDB 3WSQH 5E8EA 3KM2A 2Y1AA 3KH3A 4PJ8A 3QZPA 4RDQF 2VLMD 4ZDHA 4I9XA 3M1BA 4OJEH 4Z7VE 5FPIA 2OZ4H 3AM8A 5GGUB 1KZYA 5C6PB 1TCRB 3K7UA 1VENA 3BD3A 4P5MB 4WHYG 4RQQA 1CBVH 4JGJA 4OUUA 1NLDH 3S34H 2OYPA 4HGWB 5CIPH 1RIUH 2YK1H 4LGSB 4XO9A 5AWNH 5IHBA 2EYTA 4TPRH 4AQZA 2ROXA 5ICYA 1GZPB 3JTTB 4BWTA 5HYJA 2XBDA 3ARED 2F1AA 2NR6D 1QBML 3QJOA 1LO5A 4LPWA 4NUGL 4XXWA 4NQDD 4B96A 4CGTA 1T0NA 3ILEA 4F92B 2ZE0A 3PHAA 4WI9A 4WKZA 2ZXAA 5DS8A 4AEIL 3ARWA 4LLDB 5J11C 4NWTL 1MCWW 2NY3C 5CU5A 5IQNA 5C0GB 4RCAA 1T6VN 1YEIL 4HBCL 4AENB 3REVB 4GUOA 1DYZA 4C4KT 2WAQA 4RFNB 5F96L 2WIIB 3P4NA 3PHSA 4LCVA 3WN5B 3IBOA 4H0GA 4WU7B 1JF1B 2Z35A 4OZGA 3S8WA 2G75A 1MIEH 4CRPA 1S7UB 2D03L 2GTWB 4FP8L 5CR8A 1MCLA 3EFFB 4OZGE 2C7FA 1UUNA 3WNMA 1IE5A 4EOWL 1FPTH 4IJ3C 1LDPL 5IYBP 4HCIA 4OM0L 5JHLL 1JV2B 1OE3A 3BZ4A 3SKNA 2HMID 3MGOB 5TE7L 4L23A 1A7BA 4IOSD 2X70A 3GXPA 2B9AA 3B2PA 4S1DC 3X11A 3L4YA 5IJVB 1YMMD 4JGMA 4DPAX 1QRKA 4HYTB 4I5BA 3VFSA 5C7ZA 1N0XL 1BECA 3HIZA 2DLHA 1HYSC 2EDXA 4E9SA 3VUAA 4ENZA 1IBGH 3BC9A 5CD5C 4ODWB 4YPGB 5AKRA 3J2PA 3UYOD 3LX9A 1NL0L 4W4OC 4ERSL 1X44A 5BNXD 1KJ2A 4WJ5A 4HWNA 2H8PA 3KGUA 4GP5B 1L9QA 1O7DE 1MCPH 1OHZA 3SBRA 1AP2B 1IL1B 2TAAA 5GGTA 3SCMB 5IHUL 3BPNB 4JO3H 1K4CA 4CVXA 2X4TA 2KQMA 3OMAB 4JFWA 3IMVA 1NC4D 4KHXH 1A6UH 3GSWA 5FO9B 5I15L 3IGLA 3MBEA 4O2EA 1IAOB 4NX0A 1QPKA 5EIIA 1BVLA 1H15B 2BOBB 4FADA 2NVMA 3OX8A 4RMTA 1CT8A 1IVTA 1LWHA 5HP5A 4A63A 4LHQB 1OAUH 1B4RA 1R3IL 3JYBA 3WAJA 3C5ZB 4MYWB 4HFUL 5IB1A 1RPKA 5DMIH 3FBKA 3DTXA 4P2RB 2DOCA 1U95A 1JGUL 5HD8D 5FFLA 3K71B 4JO1L 4PTUA 4QXGL 1TZIA 3L3GA 4LPYA 1E4WL 4PS7A 2J2ZA 1K6QL 4TTDC 1DVQA 2XU9A 1BQRA 4FYQA 3MVSA 2QTVA 4JANB 4PB0H 1MN4A 4O5LH 3AQZA 1A7RH 1FZJB 2ZOOA 4QRAA 4YDIL 5F9WB 3PHOA 1L9MA 2G0LA 1J1OH 2W07B 4FXGC 4PG2C 4U1IB 4AW4A 4KJQD 4QAWA 5KVFH 3ZDXF 2XVGA 2GG1A 1TETH 2AV1B 2BSEA 2NTFA 4G1MA 4PRPD 2A73A 2LU5A 4DP8X 3VXQB 2VXSH 3BLPX 2J44A 3QYMA 3QHTC 2W0KA 2P47B 3UJJL 1TQTA 4APXB 5SWZB 1TFHA 4X99B 4I2XB 4UNIA 3I02B 3OQRA 1FBIL 4MLSA 1NJ9A 4QHKI 2FYVA 3ATAA 4Z0BH 2NW3A 1ZA3A 3HTLX 3CFTA 3K81A 1HKLL 3MODH 4MNGA 5GRZA 4NT6A 5I18H 1CC3A 1JRHH 4CMHB