4B0AA

The high-resolution structure of ytbp-ytaf1 identifies conserved and competing interaction surfaces in transcriptional activation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
256
structure length
237
Chain Sequence
KTNLANEDEAYEAIFGGEFGSLEIGSYIGGDEARNSKDYTEHLPDAVDFEDEDELADDGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 1, LINKER, TAT
publication title High-Resolution Structure of TBP with Taf1 Reveals Anchoring Patterns in Transcriptional Regulation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 58
structure length 237
sequence length 256
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4b0aA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4b0aA02
1QNEA 1KYDA 1QNBA 4B0AA 1QN7A 1KYUA 1CDWA 3OC3C 3H1ZA 1VTOA 1QN8A 1E42A 1QN3A 1VOLB 3ASMA 5IYDP 1KYFA 3EIKA 4ROCB 1NGMA 1TBPA 1D3UA 1YTBA 3VN5A 1KY6A 1W80A 3OCIA 1QNAA 2MJ7A 1RM1A 1JFIC 1QN6A 1TGHA 1YTFA 1TBAB 2VJ0A 1PCZA 1QTSA 2D0CA 2Z8UA 4WZSD 4RODB 1QN4A 3HS8A 5IYCP 1QNCA 1VTLE 1QN5A 4PY5A 1QTPA 2D0AA 1AISA 1NVPA 1QN9A 1KY7A 1MP9A 1VOKA 5IYBP 2G30A 1C9BB 1NH2A 4ROEB 1R4XA 2D0BA 2IV8A 2IV9A 3HS9A 1PZDA 1B9KA
chains in the Genus database with same CATH superfamily
1QNEA 2OOYA 2FKMX 1QN7A 1YQMA 3OC3C 3H1ZA 5BMNA 1VTOA 1DIZA 1EUVA 4I8OA 4C7PA 3ASMA 3ENOC 3CWAA 5IYDP 3F0ZA 4TPSA 1N3CA 2EHBD 5F9CA 4QG5A 1XSZA 1N3AA 1C47A 1KY6A 4WX8A 2JPIA 1C4GA 1PCZA 1QTSA 2D0CA 1LWYA 1QN4A 2PWWA 2QRCA 1QN5A 4DULA 1UT4A 1T6AA 1YQKA 1AISA 1WQAA 1NVPA 3BKQX 3OSEA 3CWUA 1MPGA 1P5GX 1WJWA 2G30A 2NOZA 3RSMA 5KL0A 1JDYA 1R4XA 2IV8A 4HJHA 3SNSA 2DKCA 4EAGA 4RODB 1TGHA 2O3OA 5JMVD 2YH5A 1UL7A 1QN8A 5HSHA 1VOLB 2HL9A 2NOLA 2ZFDB 2YA3A 3UW2A 1NGMA 3C04A 1TBPA 1D3UA 3I0XA 1V5SA 2JHNA 3PMGA 3OCIA 1N39A 3CWTA 1QNAA 4EAKA 2MJ7A 3OSTA 1LXTA 2VJ0A 5AN4A 5IYCP 1QNCA 4EAJA 1M3QA 1FN7A 1LWVA 2I5WA 3CWSA 1YQRA 2V9JA 1Q9UA 3KTUA 1KY7A 1PVSA 1PCJX 1MP9A 3OLPA 4WXAA 1PCMX 1C9BB 2Y8LA 2R5XA 3CW7A 4MRQA 2IV9A 5IYBP 3D7QA 3I0WA 3RPJA 3DPUA 1B9KA 3CVSA 2NOFA 2H4LX 4IL8A 4B0AA 1QNBA 1CDWA 2QLVA 4Q11A 2NOHA 2FKFA 1EBMA 3F10A 2DKDA 4ROCB 2F7LA 4BJUA 4D7RA 2NOIA 1YTBA 3OGDA 3N89A 3PDKA 3VN5A 1W80A 1M3HA 3OH6A 2MZ8A 1JFIC 2FGTA 3EAYA 2V92A 2Z8UA 5EPCA 2NWVA 2OOXA 1K35A 3NA5A 4EALA 3HS8A 3ENCA 1VTLE 1K2YX 2D0AA 2DKAA 5BMPA 1QN9A 3KRMA 2Z0FA 4EJZA 3TDHA 2HKPA 3DPTA 1J3MA 3D4VA 2FUVA 1KYDA 1VKLA 1P5DX 2QRDA 1KYUA 2HZMA 3TE5A 1E42A 5JN5A 1QN3A 2HZSA 4D7QA 1KYFA 2Y8QA 3EIKA 3IH7A 2XHIA 2NVMA 2H5AX 1YQLA 1TUOA 1KO9A 1RM1A 1QN6A 1YTFA 1TBAB 4WZSD 2NOEA 2JHJA 3OH9A 4EAIA 2NOBA 1QTPA 4PY5A 1KFIA 2HL8A 1LWWA 2QR1A 2V8QA 3T4NA 1VOKA 1M5Q1 2NLVA 1HU0A 3OSMA 3CVTA 1KFQA 2LAEA 4CFFA 3I3WA 2D0BA 1UT7A 4ROEB 1NH2A 3ULXA 2JOIA 3HS9A 1PZDA 2QREA 4EJYA
chains in the Genus database with same CATH topology
1QNEA 1QN7A 1YQMA 3OC3C 3H1ZA 1VTOA 4I8OA 3ASMA 5IYDP 3F0ZA 4TPSA 1N3CA 1N3AA 1KY6A 1PCZA 1QTSA 2D0CA 1LWYA 1QN4A 1QN5A 4DULA 1UT4A 1YQKA 1AISA 1NVPA 2G30A 2NOZA 3SNSA 1R4XA 2IV8A 4RODB 1TGHA 2O3OA 2YH5A 1QN8A 1VOLB 2NOLA 1NGMA 1TBPA 1D3UA 3I0XA 3OCIA 1N39A 1QNAA 2MJ7A 3OSTA 2VJ0A 5AN4A 5IYCP 1QNCA 1M3QA 1FN7A 1LWVA 2I5WA 1YQRA 3KTUA 1KY7A 1MP9A 1C9BB 5IYBP 2IV9A 3I0WA 3RPJA 3DPUA 1B9KA 2NOFA 1QNBA 4B0AA 1CDWA 4Q11A 2NOHA 1EBMA 3F10A 4ROCB 2NOIA 1YTBA 3N89A 3VN5A 1W80A 1M3HA 2MZ8A 1JFIC 2FGTA 2Z8UA 3HS8A 1VTLE 2D0AA 1QN9A 3KRMA 4EJZA 3DPTA 1KYDA 1KYUA 2HZMA 1E42A 1QN3A 2HZSA 1KYFA 3EIKA 3IH7A 2XHIA 1YQLA 1KO9A 1RM1A 1QN6A 1YTFA 1TBAB 4WZSD 2NOEA 2NOBA 1QTPA 4PY5A 1LWWA 1VOKA 1HU0A 3OSMA 1NH2A 2LAEA 4ROEB 2D0BA 1UT7A 4EJYA 3ULXA 2JOIA 3HS9A 1PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNE A;  1KYD A;  1QNB A;  4B0A A;  1QN7 A;  1KYU A;  1CDW A;  3OC3 C;  3H1Z A;  1VTO A;  1QN8 A;  1E42 A;  1QN3 A;  1VOL B;  3ASM A;  5IYD P;  1KYF A;  3EIK A;  4ROC B;  1NGM A;  1TBP A;  1D3U A;  1YTB A;  3VN5 A;  1KY6 A;  1W80 A;  3OCI A;  1QNA A;  2MJ7 A;  1RM1 A;  1JFI C;  1QN6 A;  1TGH A;  1YTF A;  1TBA B;  2VJ0 A;  1PCZ A;  1QTS A;  2D0C A;  2Z8U A;  4WZS D;  4ROD B;  1QN4 A;  3HS8 A;  5IYC P;  1QNC A;  1VTL E;  1QN5 A;  4PY5 A;  1QTP A;  2D0A A;  1AIS A;  1NVP A;  1QN9 A;  1KY7 A;  1MP9 A;  1VOK A;  5IYB P;  2G30 A;  1C9B B;  1NH2 A;  4ROE B;  1R4X A;  2D0B A;  2IV8 A;  2IV9 A;  3HS9 A;  1PZD A;  1B9K A; 
#chains in the Genus database with same CATH topology
 1QNE A;  2OOY A;  2FKM X;  1QN7 A;  1YQM A;  3OC3 C;  3H1Z A;  5BMN A;  1VTO A;  1DIZ A;  1EUV A;  4I8O A;  4C7P A;  3ASM A;  3ENO C;  3CWA A;  5IYD P;  3F0Z A;  4TPS A;  1N3C A;  2EHB D;  5F9C A;  4QG5 A;  1XSZ A;  1N3A A;  1C47 A;  1KY6 A;  4WX8 A;  2JPI A;  1C4G A;  1PCZ A;  1QTS A;  2D0C A;  1LWY A;  1QN4 A;  2PWW A;  2QRC A;  1QN5 A;  4DUL A;  1UT4 A;  1T6A A;  1YQK A;  1AIS A;  1WQA A;  1NVP A;  3BKQ X;  3OSE A;  3CWU A;  1MPG A;  1P5G X;  1WJW A;  2G30 A;  2NOZ A;  3RSM A;  5KL0 A;  1JDY A;  1R4X A;  2IV8 A;  4HJH A;  3SNS A;  2DKC A;  4EAG A;  4ROD B;  1TGH A;  2O3O A;  5JMV D;  2YH5 A;  1UL7 A;  1QN8 A;  5HSH A;  1VOL B;  2HL9 A;  2NOL A;  2ZFD B;  2YA3 A;  3UW2 A;  1NGM A;  3C04 A;  1TBP A;  1D3U A;  3I0X A;  1V5S A;  2JHN A;  3PMG A;  3OCI A;  1N39 A;  3CWT A;  1QNA A;  4EAK A;  2MJ7 A;  3OST A;  1LXT A;  2VJ0 A;  5AN4 A;  5IYC P;  1QNC A;  4EAJ A;  1M3Q A;  1FN7 A;  1LWV A;  2I5W A;  3CWS A;  1YQR A;  2V9J A;  1Q9U A;  3KTU A;  1KY7 A;  1PVS A;  1PCJ X;  1MP9 A;  3OLP A;  4WXA A;  1PCM X;  1C9B B;  2Y8L A;  2R5X A;  3CW7 A;  4MRQ A;  2IV9 A;  5IYB P;  3D7Q A;  3I0W A;  3RPJ A;  3DPU A;  1B9K A;  3CVS A;  2NOF A;  2H4L X;  4IL8 A;  4B0A A;  1QNB A;  1CDW A;  2QLV A;  4Q11 A;  2NOH A;  2FKF A;  1EBM A;  3F10 A;  2DKD A;  4ROC B;  2F7L A;  4BJU A;  4D7R A;  2NOI A;  1YTB A;  3OGD A;  3N89 A;  3PDK A;  3VN5 A;  1W80 A;  1M3H A;  3OH6 A;  2MZ8 A;  1JFI C;  2FGT A;  3EAY A;  2V92 A;  2Z8U A;  5EPC A;  2NWV A;  2OOX A;  1K35 A;  3NA5 A;  4EAL A;  3HS8 A;  3ENC A;  1VTL E;  1K2Y X;  2D0A A;  2DKA A;  5BMP A;  1QN9 A;  3KRM A;  2Z0F A;  4EJZ A;  3TDH A;  2HKP A;  3DPT A;  1J3M A;  3D4V A;  2FUV A;  1KYD A;  1VKL A;  1P5D X;  2QRD A;  1KYU A;  2HZM A;  3TE5 A;  1E42 A;  5JN5 A;  1QN3 A;  2HZS A;  4D7Q A;  1KYF A;  2Y8Q A;  3EIK A;  3IH7 A;  2XHI A;  2NVM A;  2H5A X;  1YQL A;  1TUO A;  1KO9 A;  1RM1 A;  1QN6 A;  1YTF A;  1TBA B;  4WZS D;  2NOE A;  2JHJ A;  3OH9 A;  4EAI A;  2NOB A;  1QTP A;  4PY5 A;  1KFI A;  2HL8 A;  1LWW A;  2QR1 A;  2V8Q A;  3T4N A;  1VOK A;  1M5Q 1;  2NLV A;  1HU0 A;  3OSM A;  3CVT A;  1KFQ A;  2LAE A;  4CFF A;  3I3W A;  2D0B A;  1UT7 A;  4ROE B;  1NH2 A;  3ULX A;  2JOI A;  3HS9 A;  1PZD A;  2QRE A;  4EJY A; 
#chains in the Genus database with same CATH homology
 1QNE A;  1QN7 A;  1YQM A;  3OC3 C;  3H1Z A;  1VTO A;  4I8O A;  3ASM A;  5IYD P;  3F0Z A;  4TPS A;  1N3C A;  1N3A A;  1KY6 A;  1PCZ A;  1QTS A;  2D0C A;  1LWY A;  1QN4 A;  1QN5 A;  4DUL A;  1UT4 A;  1YQK A;  1AIS A;  1NVP A;  2G30 A;  2NOZ A;  3SNS A;  1R4X A;  2IV8 A;  4ROD B;  1TGH A;  2O3O A;  2YH5 A;  1QN8 A;  1VOL B;  2NOL A;  1NGM A;  1TBP A;  1D3U A;  3I0X A;  3OCI A;  1N39 A;  1QNA A;  2MJ7 A;  3OST A;  2VJ0 A;  5AN4 A;  5IYC P;  1QNC A;  1M3Q A;  1FN7 A;  1LWV A;  2I5W A;  1YQR A;  3KTU A;  1KY7 A;  1MP9 A;  1C9B B;  5IYB P;  2IV9 A;  3I0W A;  3RPJ A;  3DPU A;  1B9K A;  2NOF A;  1QNB A;  4B0A A;  1CDW A;  4Q11 A;  2NOH A;  1EBM A;  3F10 A;  4ROC B;  2NOI A;  1YTB A;  3N89 A;  3VN5 A;  1W80 A;  1M3H A;  2MZ8 A;  1JFI C;  2FGT A;  2Z8U A;  3HS8 A;  1VTL E;  2D0A A;  1QN9 A;  3KRM A;  4EJZ A;  3DPT A;  1KYD A;  1KYU A;  2HZM A;  1E42 A;  1QN3 A;  2HZS A;  1KYF A;  3EIK A;  3IH7 A;  2XHI A;  1YQL A;  1KO9 A;  1RM1 A;  1QN6 A;  1YTF A;  1TBA B;  4WZS D;  2NOE A;  2NOB A;  1QTP A;  4PY5 A;  1LWW A;  1VOK A;  1HU0 A;  3OSM A;  1NH2 A;  2LAE A;  4ROE B;  2D0B A;  1UT7 A;  4EJY A;  3ULX A;  2JOI A;  3HS9 A;  1PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...