4B0AA

The high-resolution structure of ytbp-ytaf1 identifies conserved and competing interaction surfaces in transcriptional activation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
256
structure length
237
Chain Sequence
KTNLANEDEAYEAIFGGEFGSLEIGSYIGGDEARNSKDYTEHLPDAVDFEDEDELADDGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID SUBUNIT 1, LINKER, TAT
publication title High-Resolution Structure of TBP with Taf1 Reveals Anchoring Patterns in Transcriptional Regulation
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 58
structure length 237
sequence length 256
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2012-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4b0aA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4b0aA02
1QN5A 1QNAA 2D0BA 2IV8A 1C9BB 1JFIC 1B9KA 3H1ZA 1QNEA 1QN9A 4PY5A 1YTBA 1VOKA 1VOLB 1QN3A 1E42A 2IV9A 3OCIA 1AISA 1QTSA 4WZSD 3EIKA 4RODB 1R4XA 1D3UA 1RM1A 1KY6A 2D0CA 3HS9A 1NGMA 1TBAB 2MJ7A 2Z8UA 1PZDA 3HS8A 1KYFA 3VN5A 4B0AA 1QN7A 2G30A 1QN4A 1KYDA 4ROEB 1NVPA 1MP9A 1QTPA 5IYCP 1CDWA 4ROCB 1VTLE 5IYDP 1W80A 3ASMA 1QN6A 1QN8A 1TBPA 1KYUA 1KY7A 2VJ0A 1TGHA 1QNBA 1PCZA 1YTFA 1NH2A 5IYBP 1QNCA 1VTOA 2D0AA 3OC3C
chains in the Genus database with same CATH superfamily
3DPUA 3RPJA 2QR1A 2JOIA 3KRMA 2YH5A 3OH9A 1J3MA 3IH7A 2QRCA 3F10A 4I8OA 2HZMA 2V9JA 3OLPA 2NLVA 5JN5A 4TPSA 1AISA 1QN3A 1QTSA 1QN7A 4RODB 2HZSA 2JPIA 1N3AA 1UL7A 3HS8A 4EAGA 3PMGA 3I3WA 2NOLA 3D4VA 2F7LA 1XSZA 3RSMA 1K35A 3D7QA 4ROCB 1CDWA 2NOEA 2O3OA 3ASMA 1QN8A 2I5WA 2FGTA 2DKAA 2VJ0A 1PCZA 2NOFA 3DPTA 3CVSA 1TGHA 2JHJA 1QN5A 3CWAA 2HL8A 1QNAA 3T4NA 2IV8A 3N89A 4QG5A 3ULXA 1PCJX 3H1ZA 3UW2A 1QN9A 4WXAA 4HJHA 1VOKA 1YQMA 5JMVD 2HL9A 4IL8A 1DIZA 2OOXA 2QLVA 5BMNA 1TUOA 1JDYA 1PZDA 4B0AA 4D7QA 2G30A 3I0WA 1KYDA 4EJYA 2EHBD 4EJZA 2R5XA 4MRQA 2FUVA 2H5AX 1VTLE 5EPCA 1P5GX 2DKCA 4EAKA 5AN4A 2V92A 1KY7A 2OOYA 2H4LX 1FN7A 1NH2A 1N3CA 5IYBP 3CWSA 1MPGA 5BMPA 1VTOA 4BJUA 1EBMA 4EALA 3NA5A 3BKQX 4CFFA 1LWYA 1HU0A 1M3QA 2D0BA 2PWWA 4Q11A 1C9BB 1JFIC 2NOIA 1T6AA 2V8QA 1QNEA 4PY5A 1YQRA 1YTBA 1VOLB 1KO9A 1E42A 1PCMX 1P5DX 4WZSD 3CVTA 1D3UA 3OH6A 1EUVA 1Q9UA 2QRDA 2YA3A 3HS9A 3PDKA 5KL0A 1NGMA 1TBAB 2MJ7A 2JHNA 1KFIA 1C47A 1KYFA 2Z8UA 3VN5A 3I0XA 2XHIA 1KFQA 4ROEB 3OGDA 1YQLA 1MP9A 3OSEA 3TDHA 3KTUA 2FKMX 5IYCP 1M5Q1 3CWUA 1WQAA 2QREA 1W80A 5IYDP 2Y8QA 3F0ZA 2NWVA 3OSMA 3CWTA 1TBPA 1WJWA 1KYUA 4EAJA 1LWWA 2ZFDB 1YTFA 5HSHA 4C7PA 3CW7A 1UT4A 3OC3C 2DKDA 3ENCA 5F9CA 3ENOC 3TE5A 2HKPA 2NOHA 1VKLA 3EAYA 1B9KA 1PVSA 1C4GA 2IV9A 1N39A 3OCIA 1V5SA 3EIKA 1R4XA 1RM1A 1KY6A 2D0CA 1LXTA 1K2YX 2Y8LA 3SNSA 4EAIA 3C04A 3OSTA 4DULA 1QN4A 2NOBA 2FKFA 2NVMA 1UT7A 1NVPA 2NOZA 1QTPA 1YQKA 2MZ8A 1M3HA 1QN6A 2LAEA 4WX8A 4D7RA 1QNBA 1QNCA 2Z0FA 2D0AA 1LWVA
chains in the Genus database with same CATH topology
3DPUA 3RPJA 2JOIA 3KRMA 2YH5A 3IH7A 3F10A 4I8OA 2HZMA 1QN3A 4TPSA 1AISA 1QTSA 4RODB 2HZSA 1N3AA 3HS8A 2NOLA 1CDWA 4ROCB 2NOEA 2O3OA 3ASMA 1QN8A 2I5WA 2FGTA 2VJ0A 1PCZA 2NOFA 3DPTA 1TGHA 1QN5A 1QNAA 2IV8A 3N89A 3ULXA 3H1ZA 1QN9A 1VOKA 1YQMA 1PZDA 4B0AA 3I0WA 2G30A 4EJZA 1KYDA 4EJYA 1VTLE 5AN4A 1KY7A 1FN7A 1NH2A 1N3CA 5IYBP 1VTOA 1EBMA 1LWYA 1HU0A 1M3QA 2D0BA 4Q11A 1C9BB 1JFIC 2NOIA 1QNEA 4PY5A 1YQRA 1YTBA 1VOLB 1KO9A 1E42A 4WZSD 1D3UA 3HS9A 1NGMA 1TBAB 2MJ7A 2Z8UA 1QN7A 3VN5A 3I0XA 1KYFA 2XHIA 4ROEB 1YQLA 1MP9A 3KTUA 5IYCP 5IYDP 1W80A 3F0ZA 3OSMA 1TBPA 1KYUA 1LWWA 1YTFA 1UT4A 3OC3C 2NOHA 1B9KA 2IV9A 1N39A 3OCIA 3EIKA 1R4XA 1RM1A 1KY6A 2D0CA 3SNSA 2NOBA 3OSTA 4DULA 1QN4A 1NVPA 1UT7A 2NOZA 1QTPA 1YQKA 2MZ8A 1M3HA 1QN6A 2LAEA 1QNBA 1QNCA 2D0AA 1LWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN5 A;  1QNA A;  2D0B A;  2IV8 A;  1C9B B;  1JFI C;  1B9K A;  3H1Z A;  1QNE A;  1QN9 A;  4PY5 A;  1YTB A;  1VOK A;  1VOL B;  1QN3 A;  1E42 A;  2IV9 A;  3OCI A;  1AIS A;  1QTS A;  4WZS D;  3EIK A;  4ROD B;  1R4X A;  1D3U A;  1RM1 A;  1KY6 A;  2D0C A;  3HS9 A;  1NGM A;  1TBA B;  2MJ7 A;  2Z8U A;  1PZD A;  3HS8 A;  1KYF A;  3VN5 A;  4B0A A;  1QN7 A;  2G30 A;  1QN4 A;  1KYD A;  4ROE B;  1NVP A;  1MP9 A;  1QTP A;  5IYC P;  1CDW A;  4ROC B;  1VTL E;  5IYD P;  1W80 A;  3ASM A;  1QN6 A;  1QN8 A;  1TBP A;  1KYU A;  1KY7 A;  2VJ0 A;  1TGH A;  1QNB A;  1PCZ A;  1YTF A;  1NH2 A;  5IYB P;  1QNC A;  1VTO A;  2D0A A;  3OC3 C; 
#chains in the Genus database with same CATH topology
 3DPU A;  3RPJ A;  2QR1 A;  2JOI A;  3KRM A;  2YH5 A;  3OH9 A;  1J3M A;  3IH7 A;  2QRC A;  3F10 A;  4I8O A;  2HZM A;  2V9J A;  3OLP A;  2NLV A;  5JN5 A;  4TPS A;  1AIS A;  1QN3 A;  1QTS A;  1QN7 A;  4ROD B;  2HZS A;  2JPI A;  1N3A A;  1UL7 A;  3HS8 A;  4EAG A;  3PMG A;  3I3W A;  2NOL A;  3D4V A;  2F7L A;  1XSZ A;  3RSM A;  1K35 A;  3D7Q A;  4ROC B;  1CDW A;  2NOE A;  2O3O A;  3ASM A;  1QN8 A;  2I5W A;  2FGT A;  2DKA A;  2VJ0 A;  1PCZ A;  2NOF A;  3DPT A;  3CVS A;  1TGH A;  2JHJ A;  1QN5 A;  3CWA A;  2HL8 A;  1QNA A;  3T4N A;  2IV8 A;  3N89 A;  4QG5 A;  3ULX A;  1PCJ X;  3H1Z A;  3UW2 A;  1QN9 A;  4WXA A;  4HJH A;  1VOK A;  1YQM A;  5JMV D;  2HL9 A;  4IL8 A;  1DIZ A;  2OOX A;  2QLV A;  5BMN A;  1TUO A;  1JDY A;  1PZD A;  4B0A A;  4D7Q A;  2G30 A;  3I0W A;  1KYD A;  4EJY A;  2EHB D;  4EJZ A;  2R5X A;  4MRQ A;  2FUV A;  2H5A X;  1VTL E;  5EPC A;  1P5G X;  2DKC A;  4EAK A;  5AN4 A;  2V92 A;  1KY7 A;  2OOY A;  2H4L X;  1FN7 A;  1NH2 A;  1N3C A;  5IYB P;  3CWS A;  1MPG A;  5BMP A;  1VTO A;  4BJU A;  1EBM A;  4EAL A;  3NA5 A;  3BKQ X;  4CFF A;  1LWY A;  1HU0 A;  1M3Q A;  2D0B A;  2PWW A;  4Q11 A;  1C9B B;  1JFI C;  2NOI A;  1T6A A;  2V8Q A;  1QNE A;  4PY5 A;  1YQR A;  1YTB A;  1VOL B;  1KO9 A;  1E42 A;  1PCM X;  1P5D X;  4WZS D;  3CVT A;  1D3U A;  3OH6 A;  1EUV A;  1Q9U A;  2QRD A;  2YA3 A;  3HS9 A;  3PDK A;  5KL0 A;  1NGM A;  1TBA B;  2MJ7 A;  2JHN A;  1KFI A;  1C47 A;  1KYF A;  2Z8U A;  3VN5 A;  3I0X A;  2XHI A;  1KFQ A;  4ROE B;  3OGD A;  1YQL A;  1MP9 A;  3OSE A;  3TDH A;  3KTU A;  2FKM X;  5IYC P;  1M5Q 1;  3CWU A;  1WQA A;  2QRE A;  1W80 A;  5IYD P;  2Y8Q A;  3F0Z A;  2NWV A;  3OSM A;  3CWT A;  1TBP A;  1WJW A;  1KYU A;  4EAJ A;  1LWW A;  2ZFD B;  1YTF A;  5HSH A;  4C7P A;  3CW7 A;  1UT4 A;  3OC3 C;  2DKD A;  3ENC A;  5F9C A;  3ENO C;  3TE5 A;  2HKP A;  2NOH A;  1VKL A;  3EAY A;  1B9K A;  1PVS A;  1C4G A;  2IV9 A;  1N39 A;  3OCI A;  1V5S A;  3EIK A;  1R4X A;  1RM1 A;  1KY6 A;  2D0C A;  1LXT A;  1K2Y X;  2Y8L A;  3SNS A;  4EAI A;  3C04 A;  3OST A;  4DUL A;  1QN4 A;  2NOB A;  2FKF A;  2NVM A;  1UT7 A;  1NVP A;  2NOZ A;  1QTP A;  1YQK A;  2MZ8 A;  1M3H A;  1QN6 A;  2LAE A;  4WX8 A;  4D7R A;  1QNB A;  1QNC A;  2Z0F A;  2D0A A;  1LWV A; 
#chains in the Genus database with same CATH homology
 3DPU A;  3RPJ A;  2JOI A;  3KRM A;  2YH5 A;  3IH7 A;  3F10 A;  4I8O A;  2HZM A;  1QN3 A;  4TPS A;  1AIS A;  1QTS A;  4ROD B;  2HZS A;  1N3A A;  3HS8 A;  2NOL A;  1CDW A;  4ROC B;  2NOE A;  2O3O A;  3ASM A;  1QN8 A;  2I5W A;  2FGT A;  2VJ0 A;  1PCZ A;  2NOF A;  3DPT A;  1TGH A;  1QN5 A;  1QNA A;  2IV8 A;  3N89 A;  3ULX A;  3H1Z A;  1QN9 A;  1VOK A;  1YQM A;  1PZD A;  4B0A A;  3I0W A;  2G30 A;  4EJZ A;  1KYD A;  4EJY A;  1VTL E;  5AN4 A;  1KY7 A;  1FN7 A;  1NH2 A;  1N3C A;  5IYB P;  1VTO A;  1EBM A;  1LWY A;  1HU0 A;  1M3Q A;  2D0B A;  4Q11 A;  1C9B B;  1JFI C;  2NOI A;  1QNE A;  4PY5 A;  1YQR A;  1YTB A;  1VOL B;  1KO9 A;  1E42 A;  4WZS D;  1D3U A;  3HS9 A;  1NGM A;  1TBA B;  2MJ7 A;  2Z8U A;  1QN7 A;  3VN5 A;  3I0X A;  1KYF A;  2XHI A;  4ROE B;  1YQL A;  1MP9 A;  3KTU A;  5IYC P;  5IYD P;  1W80 A;  3F0Z A;  3OSM A;  1TBP A;  1KYU A;  1LWW A;  1YTF A;  1UT4 A;  3OC3 C;  2NOH A;  1B9K A;  2IV9 A;  1N39 A;  3OCI A;  3EIK A;  1R4X A;  1RM1 A;  1KY6 A;  2D0C A;  3SNS A;  2NOB A;  3OST A;  4DUL A;  1QN4 A;  1NVP A;  1UT7 A;  2NOZ A;  1QTP A;  1YQK A;  2MZ8 A;  1M3H A;  1QN6 A;  2LAE A;  1QNB A;  1QNC A;  2D0A A;  1LWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...