1QTSA

Crystal structure of the ap-2 clathrin adaptor alpha-appendage
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C)
publication title Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
pubmed doi rcsb
source organism Mus musculus
total genus 71
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1qtsA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qtsA02
2DWYA 4B0AA 1NH2A 1QN5A 1E42A 1CDWA 2D0AA 1QNBA 1MP9A 1NGMA 2A7BA 2Z8UA 1QNCA 5CN1A 1QNAA 4ROEB 3MNMA 5IYCP 1C9BB 1QN4A 4WZSD 1GYVA 1TBPA 3HS8A 3OCIA 4BCXA 5IYDP 4PY5A 2IV8A 1OM9A 1P4UA 2D0CA 2MJ7A 1GYWA 2G30A 1KY6A 1VOKA 3VN5A 3ZY7A 1KYUA 3H1ZA 1TBAB 1D3UA 1QTSA 1QN9A 1NA8A 3HS9A 3ASMA 1W80A 1KY7A 1QN6A 1PCZA 3ZHFA 1QN8A 1QN7A 1GYUA 5IYBP 2VJ0A 3EIKA 1VTLE 1QTPA 1KYDA 2DWXA 1QN3A 1TGHA 4ROCB 1R4XA 1VOLB 1QNEA 1YTFA 1YTBA 2YMTA 4RODB 2IV9A 1KYFA 3OC3C 1VTOA 2D0BA 1IU1A 1AISA 1PZDA 1JFIC 2E9GA 5CN2A 1RM1A 1B9KA 1NVPA
chains in the Genus database with same CATH superfamily
1BD2A 4GRWE 3D3VB 3HG4A 2LU3A 5T3XH 3AUWB 5AUMA 3WIFA 4PP1C 4WWID 2RALA 5JNYB 4F91B 1DQTA 2DDQL 1IRAY 2MOVA 3EH1A 5FGSA 4AYID 1B4TA 2ZWSA 4BGLA 1KTDB 1NBVL 4JFFB 3DECA 4Q6KA 1A6WL 3S97C 3O11B 4K7FA 4POZD 2Q9OA 5BW7A 2EUWA 1UXSB 3NSCA 3MNMA 5I6KA 3MFGB 5DJCB 3IMTA 5IQ9A 1E28A 1SEBA 4I1PA 2IH1B 4QCIA 1A6ZB 3JT0A 4XP5H 3E6FB 5CFAA 2E46A 3TS8A 1QSFA 5DTFB 1QBML 5ESQA 5CF3A 2C4XA 1M56B 2L04A 2P80D 4GRLD 4LFHD 3WSQH 4LKCB 4GRWF 3SE6A 3WFHB 4GUQA 1GOFA 3X13B 4YE4L 2FNBA 1IAKB 1JI1A 4FQ1H 5HBBA 4PG2C 5DFVC 1UVQA 3II3A 4QRPD 3CDFA 2CD0A 3WUWA 2F15A 5ANMA 3O4LD 4P5MA 4QTHA 4FG0A 4Y4HB 3GI9H 3DXAA 4X6DB 1JZHA 2FX9L 3KPMA 2DYPA 3CFDA 4QOKB 5EC2A 2MJWA 4BZ1A 2XN0A 4IBSA 4JHWL 1UM4H 5DO8A 2N56A 1C5DA 3ZZLA 4WI0B 4KXBA 3FT3A 1JPEA 2WW8A 5ID1B 3BUTA 3JZYA 1IBZA 4DKFL 5HPMB 2EKJA 4GQ9H 2LLGA 2YAFA 3BP7A 2ZX7A 3PUCA 4NIYE 4JG1L 2DYRB 1GSMA 3KGSA 1GYUA 1JUFA 2PABA 3GXTA 3MBEC 4JMNA 1KJ2A 1T89A 3FFCD 2X88A 2JKRM 2CM6A 1L5GB 4B27A 2J8UA 2ZAHA 5IVZA 3NESA 1LDSA 2YK1H 3LN5B 5I6XC 4KVPA 1J05B 3TJEH 5IMOB 4XMKL 5L2JB 2ZCKH 1VB9A 1CT8B 1CBVH 4JRXD 3HN8A 3KS0J 5DMKA 3MHZA 4TVPE 1OWWA 3GZQA 3ZJAA 1IEAB 1S9YB 4Z7WB 2CO6B 2E47A 1DLHB 3QVAA 2ZCLH 1QFWL 3BSZH 4O4YH 7FABL 3MXVL 3K4ZA 1LEGB 1DSFH 4M6NH 5D2NE 5GGTH 3GXPA 3QA3A 2HT3C 1R3LB 2AK4A 2P8LA 3RWHB 4ZOEA 2PXYC 4YO0B 1SFHA 3JVFC 3EOTL 4O2FA 5LUMA 1QBBA 3EYFB 5IM7A 3PWNB 2NCMA 3P0GB 3M8OH 1J9CT 3TWCH 5IQ7L 1ZGLB 4LLMA 4QF1A 3O41A 3QXDB 3APNA 1MH5A 1XIWC 2CKBL 5FA4A 5IBTL 3S3CB 2CCVA 2EXYC 2JH2A 4YC2B 3RX9A 4PJIB 4W93A 1HZHL 1HQRA 5MI0B 5CJBA 3IGKA 4H8HA 1ZXQA 3BIBX 4RAVB 4M3JA 4JRYD 3VI4B 1O6VA 2Q0ZX 3GTNA 4KMTH 5E2UH 4F1SA 2OR7A 2WZAA 5EO9A 2XDHA 4DETA 1FC2D 1TENA 1H9VA 1U8KA 3FPXA 1YEHH 3MLXH 3NCWA 3CWAA 4WW1A 4D8OA 1G9MC 3UBXG 4Z76A 5K33A 4WWPA 1QA9A 4BH8A 4OZHF 3MOQA 3C5XA 3D18A 3QEUA 2WTPA 1A9VA 5K9JH 5F9WB 1CD8A 1GRWA 2D7OA 5I1JH 5INDA 4P9ML 5A2AA 5MERB 3EYOA 3FQRB 2IANA 2W9EL 4NXKA 2C3WA 5BQ7B 4GSXA 5HI5D 1LO4H 1JNNL 2NTFA 2TAAA 2YPLD 3DGGA 3MBWA 5EIQA 5BZWA 5IVNA 4JFXB 4P9HL 5EUKA 1FVCB 1I9IH 2Z93A 2C3HA 2W07A 4MCMA 3ROLA 1DEEA 4BKLA 1KEGL 3J7HA 3G3LA 3KH3A 4KROD 4R5XA 2X0WA 3OPUA 3H3PL 2WB1A 3VGDA 4AZ8A 1T7VA 4NUJB 1B3IA 1RIUH 2OMYB 3ERXA 4GS7B 1U3HA 3DIDA 3BLKA 4I3SL 4OLWH 4WFED 5DA4A 2Z7UA 4JM2C 4MJHA 4NN7B 4UT9H 4ZPTA 3WMQA 3WNLA 1GZHC 3EAKA 2F19H 4QHNA 2E7CA 2ZYSA 2CR3A 1JDCA 5F89B 5ERWA 3CSYB 3U7YL 4G5AA 4X4XB 4OCMC 4P59L 3NA9H 4LCIL 1CGWA 3QXTA 1SJEA 1KENH 2A6JA 1DBAL 3F8UB 4K3GA 4XO9A 5H37H 1UOVA 4V1DA 1JSYA 3MU3A 4HIIB 3BYYA 2B4CL 1HH6A 2EDYA 2Q20A 2VL5B 4ANVA 3PIQB 3RILA 4PWEA 3QIUB 2OTUA 4X4YA 1MWAB 2YMTA 3H0TA 4HK3J 1DVYA 4N20A 4PS8A 4GUCA 4AYMC 5DSCB 1LEIA 1MWOA 1MCSA 1LEKB 3MYJB 3OX8A 3RUGA 1NGQH 3CX2A 3MRIA 2EQDA 3SJVE 4Q97A 3MJ9A 5SWSA 1F3DJ 2NDFA 3T6XA 3VH8G 4LB8A 3D2UD 1PZ5B 5DHYB 4FA7B 4L4VE 5IHZA 4NZRH 4CAGA 4EUPB 3PLYA 1BEXA 4LFHG 3GSQB 2DQ6A 5B3SB 4DULA 1HAUA 1RJYA 1HTYA 2EE6A 1DEDA 4WK2B 2B08A 1SVCP 4AYSA 2KUTA 2ZT9C 2LAEA 1OGAE 1F3RB 2FO8A 2X3AA 1EUUA 1OAYH 4HISA 1UQSB 3BFQG 1J9SA 1S7SB 3OKOB 1HNGA 3C2AL 2HJFB 4NNXB 4ZTPL 3BE1L 3RPBA 4HX1A 1TZ8A 2F53B 2WQXA 3QIWC 3IEAA 4H20H 2BP8B 5FUOL 1ZT1B 2CRMA 2YGPA 3ETSA 2AQTA 3HE7A 5I15L 1J88A 3E2HB 3BH9A 4YDIH 1U8QA 2F54D 2HJLA 2J6EH 2F5AH 2WXFA 4H26B 2VQ1B 4UZSA 5FWQA 4YR6A 2Z3FA 3MA9L 4PJCB 3MLWH 3QG7L 1CMOA 2R29H 2WUBH 3QG6B 2XWJA 2ILLA 2Z7ZA 3PV6B 2YQ3A 3ECVA 2CO3A 1EEUA 5ICXB 4IDJH 1E2WA 1D5XA 1WBXB 4WTZA 1L7TH 2VDPH 5DVLA 3UTZA 3ZKXC 3BRDA 3HE6B 3INUH 5DS8A 2HTLD 3IE4A 1PNCA 3A4DA 1TQVA 3R1GL 3UTOA 2BHUA 1DQJB 4A39A 2BSED 4YBQC 2G5BA 4JZOA 4F9LA 1HE7A 2G75B 3EJRA 2Z35B 3LX9A 4RBPH 4Z7IA 3MOAH 1KPVB 1HXMB 1W8EA 3MRBB 3OAZK 4WFFE 2DMCA 2O5XH 3BPCB 3CSPA 1T1YB 2HXAA 2HLFD 3HVNA 3L6FA 1CFTA 4RMWA 3DRQA 1ADQH 3T77B 3SGJC 5T33L 2PCFB 2YRPA 3W9EB 4PB9L 3WMSA 2ZIDA 4JDZA 1IC7L 5E6RB 1CDYA 2E7LA 5B39B 4UQ2B 2YEVB 1SLXA 2X12A 3EBHA 1M6UA 4L3FA 3C09B 3VFVB 4TVPD 3KBFA 3VRIB 4ZOCA 3OXSA 4M8UA 4WO4D 4G6KH 4DO4A 3AMLA 1SGKA 3O8XA 3HAEH 1CB4A 3EO9H 3HNSH 4IRJA 4HJ0C 4WI9A 1CL7H 3KPPB 4U3HA 3HZ3A 1FO0H 5JQIB 1KOAA 3WXWH 5DC0A 1R5IA 1F6LL 3W39A 4AJVA 1F6FB 3GSXA 3D85A 3WXVL 1MEXH 1SLWA 2VR7A 3ET9F 4HG4K 3N89A 1YTBA 3TV3H 3KPSE 4FAAB 1MUJB 4KI5F 4U1GB 4KJWC 5D1ZA 1AIFB 2Z7WA 3NPZB 3VFMB 3TVMA 2F6AA 5GJTH 3PP4L 3U4BH 4ICWA 2AQRA 2OP4H 5CUSH 4IKNA 3VSQA 1W6LA 1QNZL 5J8OA 1MRCL 5J9PA 3KS0H 1RIVL 2LQRA 1VADB 3AAZB 2H9GB 4JL2A 3T09A 4Y1AA 2P8PA 3FBQA 5B3NA 1IBGH 2DWSA 2JHNA 5C70A 1QRNE 2XTJB 4NWTL 1WWCA 2C1PB 5DJ2B 2HL9A 2WC7A 1ZLSL 4QYOA 4OD1L 3U1SH 3WHXA 5A7EA 2Z8UA 1U93A 3FQTB 2MPVA 1D2PA 4YZFE 4PJ7B 3S34H 3HG1B 3TZVB 4QRQA 2X41A 1QOKA 4YX2L 1NGXB 4LARL 4JM0A 2BVQA 5EZPA 2VSKB 3PV7A 3D0VA 3MV8E 1IM3D 1KTLB 1MCKA 5GGQH 3V6FB 5C0EA 1WUZA 2VC2B 1WLHA 4P99A 1MCNA 1D5BA 4P3DA 1MFNA 4G8EB 4F9PC 2WYZA 2IC2A 4MA1B 3PU7A 1NC2D 1ZRUA 2A83A 2RQ8A 2BZCA 3MJWA 4M5ZH 3BGMA 4OLXH 4ZJ9A 4Z6AT 3BZ5A 5EUOB 3HZYB 3HCVB 3WIIL 5JHLA 2X9WA 4YSRA 1KIUB 1YQ2A 1U8PB 3NP3A 3MV01 3BKYL 1BZOA 3HG2A 4YZFF 4RGMC 5I8KH 5IVXB 2PN5A 4PWKA 3J07A 1HX0A 5I23A 4PGCA 3IJHB 2ZTBA 4R26L 1MFAL 3WKPA 1MNUH 1ZA3A 3IS1X 1IBDA 3JV6A 1DL7L 4AM0Q 2FWUA 1ZSDA 4UBDD 1DVZA 1E8WA 1OTUD 1OP3K 4MB1A 4WHDA 1ES0A 2CBOA 1T2QH 4JPKL 4XNMA 3RPIA 1K6QH 1YPZE 3ARBB 1OKEA 2JXMA 1IILE 2YBRB 4N2FA 2GC4C 3FT4B 1DTUA 1BZ9A 2R0ZH 5CEZH 2QDWA 3VU1A 1PAMA 2WKOA 1ZE3H 3V0HA 4KUZL 3U0TA 3T1FB 5C0JB 5I0VA 4ZK8A 1OARH 1MREL 4NQDE 5LHDA 4ACTA 1DE4A 1HWHB 3IMVA 3H6JA 2XKUA 2G0LA 4ENZA 1ZANL 1OCWL 4LCWB 3TBYA 3OR7A 4UB0L 3REWB 4WI2A 3SJVD 4JRWA 2VUOA 2FZ3A 5DZOA 4BZ2L 3WFDL 3N85L 1YPZF 4UTAH 5CJOL 3O2VL 3STZA 1OHQA 4TSBL 4ZS6C 5FYLL 4ZXBC 1T0MA 2Y4SA 4UTBL 1XF4A 4H1LG 1ZIBA 1JNJA 2YMOA 3CX5J 4FL4C 4EZMA 2XRAL 1USZA 3F6IA 1A4JA 4OFIA 4PH8A 4X80H 2NSMA 1SXZA 2W95A 5IEKB 2EHBD 4KZDL 2BRRH 1JTPA 2BOLA 4JRLA 1OGAD 1U3YA 2X4UB 1KELL 5AN4A 1UA7A 1ZHLB 2JELL 3VFNB 2VDOL 4L1DA 3L9RA 4YS4A 2CDEB 1QW9A 3RWJB 3GRWL 3SCMA 1EEZB 5EO1B 2XVLA 2D0AA 1PCXA 5L2KE 1MCOL 1LP9B 4H2AA 4LEEA 5IHBA 3DI3B 1WZMA 1GCFA 4UYPA 3CU7A 3VRLE 1F3DH 2FBJL 4WDIA 1U8IB 4S1QL 3RJOA 1LE5A 2HL8A 4UOQA 5KTEL 1P4IL 1R17A 1JWUB 3D52A 4EDXB 3KJ6H 5F7WC 1C9BB 1KBGH 5DZPA 2EDLA 4XNZC 3X1GA 5JOPE 3N06B 3QUZD 1UC6A 1FNHA 2GAZB 4FQQB 3B5HA 5EOTA 1PFCA 4RNRA 4FJZA 5C92A 3IB4A 1R9FA 4AXWA 5LGHH 3SQOH 1IGIH 5F1KC 1SVBA 3L3KB 4UT9A 4YHIA 1ZGLP 4N8VB 1CICA 3WAKA 3QS3A 2WQWA 4N2GA 3W81A 1MCFA 4Y19B 3K91A 3PNWA 5DJYA 1S78D 4JGJA 4CMMB 3S3PA 4AGNA 3X1BA 3UP1A 1I8LC 3VRLF 4HS6B 4L9LB 4YGVA 1BJ8A 2DH3A 3APDA 1MWAL 4EAEA 4KJYB 2E8YA 3BPNC 4WFFD 4XPTL 5EBMA 3PGCB 1FYHB 1TZIA 5IJVA 3EGSB 1U8CB 3ARDC 1XGTA 3K4DA 1HEZA 4JFDB 1SHMA 1W72L 2JQZA 3KM2A 2ODIA 2AJ3B 3BXNB 3FCUB 2C9XA 1QUNA 3NIDB 1S5HA 3KWWA 1YMMA 3DVNA 4JNXA 1KCRL 3RFZB 3NIGB 3RNQA 1ONQB 4WO0A 2EIZB 2XXCB 1JZ7A 1KB5B 3ILQD 1K8DA 3LIZH 3WUZA 3Q6GH 4TVUA 2UZYB 2ZOKA 2DQHL 3RJDA 4GRLA 3ZKNC 2YGOA 3QJUB 4ALAL 1OAXL 3CXDL 3NJLA 3O6LL 3Q48A 3T3PB 2L4OA 1TJGL 1O7VA 2WGNB 1U58B 2WLYA 1DQML 5LAXB 1MI5E 2V2XA 4DW2H 3K3QA 3SDAD 3SPHA 3F10A 4JFVA 3KPSD 2RQEA 3LVEA 1NKGA 1AI1H 3DO7B 1N39A 4RDBA 1RVFL 2AEOA 2BNQB 4JFZH 2OK0H 2Z0FA 2ISDA 1WDAA 3KXFE 5DJDA 4PW3A 4ODHH 4A38A 2X6AA 4HJGA 4MMYB 3KPQB 2MSPA 4O00A 4L1BA 3RGBA 5I1KL 3MRFB 3GF8A 4RZKA 1B4LA 4B3EA 4HHGA 1ZLUK 3CFUA 1NCNA 2VRQA 3DWTA 1CFBA 1QRND 1T4WA 1HL9A 4TL5A 1I9JH 1I7UB 3RA7L 2J6EA 3HPJA 1JD9A 4OIBA 2A74B 3TEYA 2MCPH 4JR9L 3SDDC 5I73B 2GJJA 4Z78B 5GS0L 4TULH 3FUHA 3RHWK 2JKSA 3HMWH 1NCBL 3GBNL 5KS9E 4FG4A 2R2BA 4J3WA 2W60B 3GSNA 5FHAL 2CR0A 1SXAA 1A4CA 2CJTA 3MV8D 1FLRL 4P2QA 3EYUL 3TEUA 6TAAA 1FNFA 2EINB 2ZFDB 1LHZA 1ZCRA 5E51A 1I1AB 1YMHB 2GJRA 2HFEB 4OQTL 3VXUA 4Z3GA 2NX5A 4F7TB 3U9PL 3KWXA 4P4KB 1MHPL 1LO2H 4G83A 4L8CA 2VLKB 2EABA 3OMNB 1M71A 4LLUA 1TQCC 3QRBA 4JM2F 3WIHH 2H32H 1ZHKB 3L4VA 2DIAA 1RHFA 2R15A 5KS9F 1AE6L 1KJ3L 2MKWA 5FM4A 3JTSA 1TJIL 2WXGA 3I6KB 5IMKA 4P9HC 1XBRA 1Y7VA 1IGJB 1BVZA 3BUYA 2XV0A 2F8OA 4FFWD 3NIFE 1L6XA 2NNAB 5IVOA 2AMGA 2ICEA 1R0AH 4RRPA 3UABA 2HLAB 1G84A 2XPZA 1CFNA 1ZV5A 3G6JE 4ZS7H 3U9WA 2D7MA 2SEBA 4ODXA 1UURA 5IHHA 4D7BA 3VFOA 4FQXA 4ERSH 1FNGB 2IALB 4JE0A 5LN8A 3HS0A 1UOKA 2J2ZA 4B9PA 2XXFA 4ODBD 5HGDA 3MLUL 2VERN 2H3NA 4NQDD 4QRRB 4TXVB 2AS5M 5C6PB 1EAQA 5M95B 2FWOA 3O9WC 4DGUA 5J11C 3NBNA 3NIFF 5CLZA 4MDJB 4L3EB 1XSKA 3SEPA 1BIIA 4X9GA 5DZNA 3ZK0A 5KVGH 4M61A 3VAEA 3Q1SL 2B4CC 3QFJE 1ZPLA 1NC4B 3H7BB 1QHOA 3IJSB 4OLYL 4E41E 4ZMZA 4WHTB 1S7UB 3IGUA 1BFVH 3K2UH 3T0BA 3G6JF 3SDCA 4E68A 3DETC 4ZMQA 5HHMD 2AKRB 4QTIL 2R23B 4Y9BA 3V52L 4A7GA 1MCBA 2CK2A 2GYSA 1GTFA 1EH9A 3EH2A 4P23B 4O58L 3UGUA 1ZGLM 4N6RB 4YL4A 3WS3A 5I1GL 1LNUA 4B50A 1BZEA 3LEXB 3TYFB 4H40A 4L37B 4TNEA 2CK0H 4O02B 1AGCB 1XH2A 2EE0A 5B7MA 5L2KD 3MBED 5HGAA 1CLYH 1BJMA 2CLRB 5D9SB 1KYOJ 1TF4A 2Q10A 5D7LB 1BQLL 3QUMB 1Y1DA 5DD1L 3HRZC 4Z77A 3KCWA 2EDKA 1AG0A 1P5VB 6FABL 3APCA 2GBVA 5JOPD 3HJEA 1AMYA 3L5IA 4M29A 4TNWF 2GCYA 3S4SG 2UZXB 4OJCA 1RQ5A 5LBSH 3IMWA 4PRHA 1PX3A 4K8RC 2NYKA 5LDSA 3F7QA 4KKBC 3RWCB 2Z4TA 2JF1A 3D6GA 3GC3A 5FM8A 2AGJH 3H4FA 3V0VB 4ENED 2HT3D 3GINA 3ZT6A 4FLRA 1AKJD 2EDRA 1H3WM 2WINB 5D55A 3UZVA 2R1XA 1QHQA 3I02A 3MVSA 2XWRA 1W0VA 2AJVH 4HUUB 1M3QA 3L1OL 3PGFL 4LKXB 1F1AA 1G4MA 3QXVA 4OZFH 4HPYL 1E8XA 1MCWM 4HQQL 1X5ZA 4KXAA 1F42A 2FX7H 2X0UA 1XIWD 3NZSA 3KL3A 4NQTA 4PVLA 3MGOA 3RL2B 4LT7A 4PRPB 4OH2A 4F15B 2DLTA 2EYSA 4K23H 2AJSL 1TVDA 5D1XE 1TYRA 2WTRB 4NKOB 1DN0B 3RB5A 4F7PA 4TPRL 1PZUB 4IHOA 2IBGA 1XSJA 4JJHA 4UTAA 2IAMD 4KNSA 4XAKE 5CBEB 3KJ4B 4DHLA 2XPGA 5B38G 3BH4A 3UO1H 4G8GA 4P5KB 4DFHA 4NQUA 3QORA 4NO2A 1A3RH 1Q9WB 1VGKB 3HUJE 3EFOA 2R8SH 4C7PA 1RULL 3JWOC 1MI5D 3QJQB 3FSAA 4MNQA 3B9EA 3RZWA 4L1TA 4WKZB 3ZE1B 1TVHB 2Z8RA 3BDYL 4NLHA 3KAAA 4XC1H 4M43H 1HHHA 2AC0A 3K6SB 5F8QC 3K6FA 3CQFA 1JK9A 2EC9U 3V4PH 4Q4EA 4A7TA 2EVGA 3IJYA 4FP8L 4F20A 4TV3A 5T1LA 2ATKA 2EDWA 2CRIA 2K1MA 3BWAB 4JFQA 5JW4N 3P2DA 4ORGB 5SX5K 2JCCE 3U4EB 4MA8H 1AQ8A 2BSEA 1TTAA 1RMFL 3FB6B 4FXKA 3IFOA 3HUJF 4QHLA 1IBHA 5GZOA 4LHUD 2CWRA 2E7BA 4NC1E 1H15B 3G5YA 1S8DB 4Q7DA 1TQUA 1M5Q1 1O7DC 1NBQA 3CZJA 5C7ZA 4HV8B 1PCMX 4KVCH 4KX8A 2FTAA 4KO7A 1AD0A 1KB9J 3CLFH 3FUEA 2Q7YA 2V9UA 3JWNC 4L3CA 4ACPA 3U4KA 3QFDB 4KKRA 3ZMRA 1EMTH 4MMZA 4QRTB 3UAJC 2R56L 5A2BA 2HH0L 2WPGA 2F7QA 3GB7A 4WO4A 3MODH 3S8GB 2JCCF 4WUUD 1OPOA 1K4CB 4LLVB 5DS1A 2YEQA 3SIKA 1B2YA 3WHE0 3VWKD 4Z1PA 1EO8L 1C16A 1ZVNA 2DF3A 4MMXB 2BH0A 4PBDA 1KB5L 4YN3A 3EOAA 3ZE0B 4PREB 1REIA 3NJNA 3P4NB 2A6DB 1OM9A 4GW1A 3LNHA 1WCBA 2WXRA 2BIQA 3V7AG 4HIJB 5KJ7E 4Z0BL 4NQSA 1AY1H 1WUNT 2IGFL 1YN6B 3BVWA 4XPGL 1ETA1 3QCUL 1FJ1A 2X53A 5DC4B 2OX5A 3V55A 2J4WL 2NZIA 4OZHA 4F24A 2DQJH 5L6YL 2QPFA 5G5DB 4X7SL 1RV6X 3VD2A 1CFVH 3HPLA 1L4IA 3QQDA 4FEIA 5IQLA 5H35B 4MAYB 2IMNA 3L95B 1VDGA 4L8BB 3FN0H 5EU5A 4WEUD 5IT2L 2WSDA 4X2UA 1BJ1H 2YA1A 3MRGA 8FABB 4S11A 3KL5A 4MB3A 3GJFB 1KDIA 1CO1A 1ZJBA 5DJ8A 2I69A 4H0LC 3NJJA 2IQ9L 3F58H 3MV7A 1K3IA 1GHFL 3QIWD 2Y8LA 1JBJA 1C5CH 1X5JA 4YC2C 4N2LA 3UX9B 2ZOLB 2FX8L 3MRKB 3KYAA 4GQRA 1A6UH 3II1A 5AVXB 5MI0C 2ZUQC 1JVLA 2DD8H 4JDVA 5IB4B 1FBIL 3QFJD 3DX8B 4UIKH 5DJ6A 5JUEH 4NCDA 4G6FB 3GXFA 1WZKA 5JPMA 3S37H 4NCC2 2IQAB 1T7ZA 2BOBB 4FULA 2FH8A 4HEMA 2QKIA 4Y2OB 4POYA 1J18A 1LD9A 4Y16A 4L18A 1S7WB 4NKQB 1HOEA 5E0FA 1CFQA 2DKUA 3Q1EA 2IDSA 3A5VA 4XCFH 3BQUA 3CE1A 4YNYA 4YBQD 4HWZA 1JFIC 4AYFA 5KYNA 5F9WC 2AV1B 1Q90A 2Y0SA 4PJDE 3WS6C 4PJAE 1MJ7L 3FN3A 2O5NA 3N0PB 5LLIC 4J1UA 1SBBA 4MJIB 5BVJA 1ZLWK 4N5UA 2DRUA 4IIQB 3NK4A 2Q8BH 2ARJA 2OYMA 5B1JC 4DAGH 2HFTA 5EA0L 4BRJA 35C8L 4G43A 2XIDA 1L0PA 4PRDA 4U6XB 1JTTA 3WIHA 2H32A 1NGYA 4QNPE 2WXIA 1M1SA 3CDYA 3FTYA 3P0VH 1ADWA 3D51A 4JANB 5C0AB 3GMQA 4U49A 1L9RA 1UM6H 4HJ0D 2BMKB 3H2PA 4GS7C 5MEPA 5J13B 1OCZB 3L4TA 4G1MB 4KV5E 3VFGH 3EF4A 5E94A 4E5XB 3QDMA 4PJGE 1BVLB 4PJDF 4J8RA 2XKSA 3GJEB 4PJAF 3UG3A 5C0DB 1XMWA 1Z3GH 3EH4B 2BXYA 4GEIA 2IDCA 2WVVA 4HUKB 1TVBA 1AZBA 1XBDA 3WG7B 5TDPA 3VXOB 2XWBA 4KJWD 4FHKA 4L4VA 2B9AA 1FN4A 2DM3A 2CU9A 3OKNB 1J48A 5F6HJ 4G80B 5H2BA 1FH5H 4M5YH 3D4GA 3D4VA 2AJXL 5T1KB 5J1AA 1KFAH 4WRLA 4MZIA 4XPAL 4Q9QL 2E27H 4PP2A 3VX0A 5JHBA 4IIZA 2HFGH 3B9KA 3O3BB 1OGAA 1W8NA 3QIUC 5F9AC 4KV5F 1WC7A 5A2CA 1Q9UA 1XGRB 3BX7C 5D1XD 1UT7A 4GRMA 4X5XB 4PJGF 1R19A 4ODUA 4Z3TA 5DEZA 2BVPB 3O2DL 3BKJL 1TNNA 3D8MA 5GSRA 4XAKD 2OMUA 3ULUL 3FQXB 4JPQA 4KKZA 4X8JA 5CSGA 3VXSB 3BP6B 2KPNA 4PJEA 1R3JA 1NIBA 5CJXC 4BV1A 4O02L 4JL1A 2J8HA 4OCSH 4YBLB 5CP7B 5F7AA 3BAJA 3JT2A 4JVWA 2EIJB 4LHUG 5DMGC 5CLWA 1N0LA 4TUKL 3AACA 5K9OA 1NBCA 1ID5I 3IJEA 4DGVH 3AUVA 1BM3H 2WANA 4GG8B 2Z4QA 4ZYKB 4K2UL 2MQCA 4FQJH 5AOKA 1U8LA 2NOYA 5GS2H 2V5RA 4HUWA 2FEEL 2CHNA 2OSLA 4DQOL 2IV9A 2VXUH 1GGTA 3MJ7A 3V4VL 1TZHA 3E2HC 5TQ0H 2VDMH 3HZMA 3DX9B 5BS0B 3QJHA 4LDOB 5CBAB 2J5LB 2WOBA 5HVWA 3TEZA 4BZYA 3P4MB 5LBSA 1RJZA 3Q01A 5C0CA 2IJ0C 3BC9A 4Y4KA 3RWEB 3TFKC 3TU6A 3D12B 4PJXF 5JIDA 2ED6A 3HE6C 3WTXA 1S7QA 4NZTH 3REVB 2BFVH 1ZY9A 3IDMB 2JJUA 4PV8B 5GS0C 3LH8A 4OSUL 3VXMB 1K8IA 2LVCA 4GQZA 3NFSH 3N44B 1G7JB 2RA1A 3O45B 1NAML 4RISH 5FYKL 5FM5O 3VSUA 3ARFA 2M8XA 1ZT4A 4FI8A 3SDAA 1MDAA 3RTLA 2XVKA 3UC0H 4ODSL 1U8HA 4Y2DB 3UGXA 4MBOA 1MHEB 3MACH 3UCQA 4IKJA 3GS0A 3TCXA 3FOMA 3OSEA 1EEQA 1MFDL 3AG2B 3ARRA 3C09C 3DBSA 4TLKA 4Y8DC 4OZGE 5E8DH 4ZS6D 4ZXBD 4APQA 5L8KB 1FL6A 1RUQH 3ZPDA 4GMTL 5EU6A 3X12A 3Q44A 4E9LA 5B38A 4FD0A 3OKKB 1H6EA 3FS9A 5SX4I 5DI8A 2FJHB 4LSVH 1KCUH 3ZXAC 3SYOA 4WWNA 5JO5A 5T3ZL 4Y4FB 5DQ9A 3L4ZA 1OW0C 3ZUNC 5DRNA 2GTZA 2Y7NA 4MX7A 4IOSD 4U1GC 4XP4H 1AZNA 4P05A 1OD9A 3ECBA 2CG9X 1JZ4A 3IGAA 1J5HA 2WXKA 3SDXB 2QMJA 1MSPA 3FO1B 5AW3B 2NY4B 3CFJA 1RHHB 4TLUA 3BVNB 1FCCA 2FD6L 2D7TL 4XCNA 2ROXA 5IHLB 4BQ8A 3CNKA 3UH8A 1NIEA 1CF8L 2B15A 4GBXB 3UPCA 5E00A 1NCAH 5D5ME 2XTJC 1CXHA 1YYLH 2ENYA 3B2PA 3LPOA 2OMVA 2VXVL 4IRSB 3NFNB 4Z7VE 3TA3A 1JK8B 3STLA 3TZVC 1IGFL 2PTUA 3RVUC 1KCVH 3QEHB 1D5RA 3C8HA 2EP6A 1HI6A 3ISRA 2NY5L 3M6DA 3OHMB 2QSCH 4HLJA 1P7KB 4Q11A 4UILH 3RVTD 1IAIM 1LQSR 2YOCA 4DWHA 1A3QA 4JY4B 1BPLB 4MA1C 4OJDH 2WXLA 3VGBA 2VIRA 1OE2A 3OWRA 3ARDD 4NT6A 1N10A 2M83A 1I53A 1J0JA 2V33A 2HJKA 4RFEB 5D5MF 2DQDL 4RA0C 4B9YA 3B3BA 5IKCB 1F4WL 5MENE 1WBYA 1YPZA 4PRBA 1CXFA 4HIQA 4OV5B 1LDPH 3FO2B 1OAUL 4Z7VF 1E5CA 1ZTMA 3N42F 5C97A 4MNGA 1A7OH 4CJ0A 1PJ9A 4ATWA 2DM7A 3L7EB 4OJFH 4NKDA 4P3CL 3D3VE 4KY1L 5HHQA 3ZKND 5KBLA 1CE6A 1VPOH 1I8KA 3W57A 1SLUA 3U9UA 3X14A 1CQYA 2F08A 2X3BA 3CFCH 4XVTL 1SEQH 2PTTA 1SDYA 3T8XA 3L2LA 2NXZB 4JFFE 4PG2A 5I0XA 1DVUA 5JXAH 1ED3B 3ARBC 2YD1A 3AS3A 3SPJA 1BD2B 3WIFB 5AUMB 2AEPH 3N1MC 2PW2A 4QO1B 3ZHKA 3QZNA 1KG0A 3OXRA 4JS7A 1N3AA 3VFWB 4PBVC 2CMRH 3UTTA 2DQUH 1WZLA 4QXVA 1JL8A 2FLRT 1ET8A 3D87B 4K7FB 4QXWA 4U1SB 1U8JA 3FRPB 3U7AA 4WF7A 5IJBC 3O6FA 2X3CA 1WV7T 1IBYA 4JFEA 5TF1L 1UM5L 3WNPA 5IQ9B 5F9JA 2LHAA 1E28B 2DJMA 4JVUA 3G08A 3TX4A 1JYWA 1OGPA 1NM9A 1QSFB 1TBAB 4LGPB 4BGDA 1OT1A 2BOCA 3MBEA 2G3MA 3BFWA 1FIEA 1DLFH 3SDDD 3ZGHA 3FB8A 1O7DE 4X6DE 5DZ9A 1R33A 3H2WA 4QOKE 4LOFA 5K59F 3WOVA 2FATL 3TTYA 4LSSL 3OJMB 1TTUA 1PZ3A 1UVQB 1WCQA 1TZGH 1IJ9A 2HX7A 3G6DL 3MUHL 2BHFA 5F3FA 5I8CA 4CADA 5BUAA 4P5MB 4QTHB 2WXJA 4XXDB 1R75A 4NS0A 3DXAB 3STBA 1J1OH 1J8RA 3KPMB 5EC2B 1N9PA 2VDKB 1KN2H 3CSBA 2NY2B 2PPCA 2CUMA 4KAQL 2IDFA 2ZSWB 4JAMA 1WD8A 1C5DB 1E4XI 1JTOA 2ALWA 4YHMH 1AKJA 5AVUB 3FT3B 2PXYA 5I2IA 1EFXD 2I5YL 3CFBA 3HN3A 3BP7B 4X6DF 4HXBL 1A1MA 1MFBH 4I3RH 2FBRA 1T22A 5K9QG 3F83A 5AKTA 1NGPL 1JUFB 2HLEB 5D72L 2Q87A 5ICZA 5LQBL 1QI5A 3RDTA 3TTSA 1MF2L 1RPKA 3X1FA 4Z7WE 5E70A 2GHZA 2R4SH 2J8UB 2VR4A 3EO0B 3U83A 3TESA 4FRWA 1WFUA 7PAZA 2FR4B 4KXDA 1VZHA 5GGRB 4GO6B 1LO5B 2K4AA 3GK8H 3Q6FA 2IGLA 3B5TA 3V95A 4MXWH 4AEHH 2BWDA 4EI5B 1I8IB 2AVFA 5DMKB 1IKFH 4ZDHA 4LAQH 3GKWH 2LT9A 5MEQA 1AOZA 4TOYH 4CW1B 4L9LC 2DKSA 3TO2B 3NZHL 3PP3H 1TEFA 2YAOA 5C0RH 1H19A 1QP1A 4X5LA 5IFAH 4F7MB 3QA3B 2P8LB 2AK4B 2R0WH 1VERA 1YYCA 1FFNA 1FGVL 1T1XA 1NEZG 5AW4B 43CAA 5I1CH 4BFIA 5HPOA 4ANKA 1X5FA 1Y18A 5IM7B 3FT0A 4Z7WF 3O9WD 4PJIE 4LL4A 5B21A 2XFXA 4LLMB 3O41B 1ZS8B 5E5UB 1GGIH 2VMCA 1MH5B 4HS8H 3VI4E 1JGEA 3KXFA 5FA4B 1XZ0A 1GYVA 4ZT1A 3DETD 3NT0A 2VMFA 2VB5A 2QQKH 3QWRA 4N2HA 4PV1C 1HQRB 5CFHA 1E43A 4BCZA 2FT7A 4KKAD 3OJDA 1PY0A 3BN9C 3FBKA 1N59A 2G0KA 5L8JB 4U7KA 3JWDL 1RZKC 4YGAB 2Q6WA 1Z9PA 1T04A 4PJIF 3TT3L 4Y9EA 3S88H 4ZFOL 3U7WH 4JM2A 2YSTA 3UG5A 4JFOA 5KVMC 2X44D 4UWQB 3VI4F 4KVNL 1TXKA 1OSZB 3HS9A 5IF0A 1JYVA 1CXLA 4OKVA 4ETQA 3MBXH 3HVDA 3OKLB 3QEUB 4D9LL 4ODVL 4Z0XA 4RLDA 3NZ8A 5INDB 5SWQB 5FECA 3EYOB 2IANB 4PTTA 1BYOA 4OLZL 4KRPB 4ZMOA 1L9SA 2NTFB 2FKMX 5GSVA 5BZWB 3LN4B 4DZ8A 4L5FL 3RL1B 1OT4A 5EUKB 1QLEL 1Z0MA 2A74C 3SKNA 2R1YA 2W07B 1DEEB 3BJ91 4BKLB 5I73C 2HN7A 4HIXH 2YA3A 2UZIL 2R9HC 2OTPA 3C12A 4AZ8B 4Y8AA 4FFZL 5IR1B 4PD4K 2I9LA 1OTTC 1U3HB 2E0PA 4NO3A 4MD4A 4W9CC 4HWBL 4ZPTB 5HGGS 5D6DA 1I1AC 5TK4A 2W8CA 1EZVX 2WYHA 1GGCH 4QHNB 3TNNA 4B3VA 3P2BA 4P4KC 1FZMA 4WTWA 5A2JH 1WQVT 2GJ6A 4KZEL 5MEND 1JCKA 2AABH 5C0NC 1MFMA 3G6JA 3CU1A 2YC1A 1LGVA 5KBPA 1AHMA 1SJEB 4N3UA 3VRJB 4TNVK 4WW2B 5DJ0B 1LVEA 1YEJL 4JGUA 3QNZA 3B2VL 3RY5A 1J11A 2NYYD 3CV5A 3MLTB 3TIEB 3WO4C 3I6GA 4W9DC 4X4YB 1UB6A 3X2QB 3H0TB 1MXGA 1HK6A 1A5FH 1GIGH 4G3YL 4E9XA 3S8WA 1TUPA 3OX8B 3RUGB 2IH9A 4ONFH 1MPAH 1R34A 5SWSB 2B1AH 2HX9A 1ZTXH 2V9QA 3QZLA 5IOKA 2X7LA 4HCGA 4RWHA 3D07A 1T66C 4D0CA 4E41A 5FO7A 1UWGL 5AKSA 1EX0A 4M6AA 1HSBA 4LAJH 4AL8C 4L4TD 2XY2A 1RZ7L 1YNKH 1AYOA 1BQSA 2CXGA 3I75A 2FUVA 1RAMA 3NZUA 1IBFA 2F53E 1IT9L 4N2OA 4PS3A 1PNDA 3KLAA 4NQVA 3HR6A 5IGXH 5DD3H 5F9OH 3ZQWA 4CN1A 1RUPH 1VFUA 1P5GX 3QCTH 4L29A 3UBFA 3ZZSA 1QMUA 1DBMH 1KNOA 1CLCA 4YHKH 3T4YB 4GKNA 4PJCE 2XYCA 1KPUB 3SGJA 1UG9A 2VYRE 4Y4HD 1Q0YH 4RGOL 3F6LA 3Q2CA 2ZP0T 4QOKD 1SUJA 3QWOA 4AC2A 3BDXA 4FQ2L 1OCOB 4EDWH 4YAQB 3I6LD 1WJ3A 4P23C 4YSDA 4YHPA 3TLRA 4PU2A 3UAJD 3ULUC 4N68A 2YIHA 2C9PA 1TMCB 5FCSH 5FO2A 2XWJB 3TPUA 1PJWA 2C7UB 1D5XB 3SY0A 3EIKA 1XQ4A 3AWGA 3MA7B 2QQLH 1TGHA 3IS0X 2OMZB 4N0UA 5EG6C 1YJDH 1YEIH 4YHZH 1JI2A 1HIML 5K5YA 2BJMH 4PJCF 5F7KC 4ZNEE 4JREB 2P24A 1T0NA 3V4UH 2G5BB 4JZOB 2TRHA 1NINA 4ZMYA 1B3JA 2FEDD 2UWEB 2Z1KA 2ZF9A 4Q6IA 1V05A 3T6VA 4BM7A 1CFTB 1IUZA 1TJMA 1P1ZA 3DRQB 3DTUB 4HWNA 4LBEB 4MASA 1Z6JT 4ETYA 5ADOL 4IL8A 4OCLC 3O3EB 3DVIA 5F1IA 3D25A 4JDZB 1YEGL 5DFTA 3LVTA 4G8FA 4WTQA 4DN4L 5I6OA 1WIOA 2DMBA 4M7KL 2HPTA 2W9DH 4Q89A 1D3CA 3OAYH 3FMGL 5DK0A 4S1SL 4RAHA 1C1EL 2FNWA 5E7FA 4XCYB 2VAAB 3O8XB 4E9TA 4IRJB 3R0NA 3IBOA 2BK8A 1JYNA 2DWYA 3W39B 5E8PB 3IKCA 3D85B 5JHMA 1F02I 4IK7A 4X4KA 4G72B 4Z7UA 2K0RA 3SPIA 3OGOE 3HUJA 3LEVH 1ZWIA 4BSVA 2YD4A 3LPWA 5D1ZB 3CN4A 2XZAH 4CU6A 5I5MA 5JORA 5D7JB 3DHPA 3PDOA 1UXWA 1XR8B 1ICTA 3MLZH 1KFIA 1A64A 3F0ZA 2EXWD 2K3TA 3CLEL 1OP4A 3S2CA 2XTJE 1K9TA 3AGWA 3BFOA 4M02A 2HUHA 4JKWA 2BY1A 4URKA 3KJ4C 2V92A 1CXIA 2J3SA 2VDKL 2P8PB 4BZ1L 4PJ7E 2YAPA 2JCCA 3HG1E 4N86A 1PX4A 1AP2A 4ZUWA 32C2A 3ESPA 3QR2A 3QQXA 4F37K 4OFYD 1OGSA 3GZPA 5D71L 5KVEE 3MLSL 2GI0A 2Q1EA 4NC2B 2ICWB 4R4NC 25C8H 4TLSA 4UQAA 3P9MB 1F4XL 4QYOB 5FYLD 4I9XA 4K8RH 1U93B 3OB8A 5D4HA 2Y1YA 2XKNB 3P3UA 5IMMB 2W0LA 2BVQB 4HKJB 5B4MC 2Y5TA 1SHWA 2J8OA 2EH8H 4F1ZA 5EUOE 1KTJA 1XSIA 1KJ2L 2PPDA 3KYNB 5C6TL 4PG9A 2QQQA 4ZZKA 1D5BB 1AR1B 4FN0A 3DX3A 3CHQA 3LQAC 3KYMA 5IVXE 2A83B 1OCCB 4TUJA 1YCSA 1B0RA 4HEPG 2DWDB 4NFBA 2GIXA 1CLOH 4JO8A 3QWNA 1DVFB 2G3XA 2OOYA 4WI4A 3MRRB 1MLCB 2XQBL 5AYUH 3TYGL 4EAJA 3JYBA 4GG6A 1ZHBA 1FNSL 5ENWA 3CMOH 4WI3A 4PGCB 1QFWM 5B1AB 2AEQH 2NUPA 2Y22A 5PCYA 3SSGA 4FX5A 1I3GL 2E7MA 1VRSA 1ZSDB 2ZXWB 3L54A 3QJOA 1XF2B 2DKCA 3NJMA 1ES0B 4EI6B 2VZ3A 5IVXF 4D7QA 1GJWA 3RPIB 3MNVB 2FL5A 1NAKL 1NEZA 3RZCD 4NUQA 3FU7B 3MLPA 3GNML 2JXMB 5HI3C 4MMXC 2RCSL 5E4AA 2EVFA 4NBYB 1BZ9B 2O93L 3QIUD 1B6UA 2XA8H 3SD2A 5IG7A 5ELIA 2P5PA 3HMXA 3TBTA 3U0TB 1CWVA 3WTYA 4LCWE 1WEJH 4OD2B 4FZ8L 2VO8A 2Q3AA 1LO0H 3FH8A 1DE4B 2YFOA 5B7EA 3FF7A 1QR1B 5IB1A 1INDH 4HG4J 3OLIA 4MD0A 3TBYB 3V5HA 3Q43A 1M2VA 2Y7SA 2FZ3B 4MAYC 4BHUA 4HZLA 1Q1JH 4YE0A 1DR9A 1DBKL 2OL3H 3STZB 1IO4C 4E9VA 3GBML 1T0MB 3BLPX 1IGCL 2Y7QA 3ETBF 4C57C 3S37X 4JPVL 5AB2A 3MRNA 1LYQA 5ITFA 3B2UD 4YQXL 1B0WA 1JGVL 1LP9E 4HK0A 5C0BA 3ARXA 3QO1A 3VNZA 3JWNH 2KBGA 5DD0H 4A7QA 6CGTA 2F53D 1Z2KA 4KY2A 3F7YA 2Q76B 1DQDL 1I8LA 1Q0XL 4FADA 1SUHA 3COOA 4PY5A 3SCMB 4Z3HA 3P3TA 3PE9A 5HYQA 5EEZA 2DQIH 3BVUA 4PJAA 1G9NL 3I0WA 4Q0XL 3ARDA 4WDIB 1XCQB 1LE5B 4PYHA 2IADB 2VH5H 4DP1X 2ZCHH 5FO9A 1ZK5A 3WLWD 4JFPA 2QVFB 5MHSE 2ZX5A 3ZTJH 1UWXK 3HE6D 3AMKA 3X3GH 3UACA 1LP9F 2JKIS 2WP3O 4Y19E 3IXTA 3SQBA 3HB3C 4N2BA 1Q72H 2FUTA 4RNRB 1G6VK 3DURB 3QDGB 4JN2A 2QHRL 1FN7A 2I5WA 4AXWB 2F5BH 5GS0D 2R7EA 3NCJL 1E9QA 4W6YB 4WV1A 1PCZA 2QR0B 1CICB 2PYEA 4B9KC 1DVXA 4PJGA 3NABL 1QBLH 4N2MA 2L7EA 5DJYB 2NQDA 3FF8A 4JFDE 5T5FH 4M1CC 4IIQC 2EEAA 3MROA 5F44A 5CCKH 1N2RA 4TS6A 1OQXA 3W9DB 5CINH 1IEBB 3NIDE 2WP3T 5I30L 2PP8A 4XO3A 3NIGE 3V0EA 5CILL 1TZIB 2ICCA 5GRVL 5KZCB 3MJ9L 1BHGA 1UB5A 1QPKA 1XGTB 2D3NA 3HN5A 4Y9GA 4TPSA 4KTDL 5KYXB 1W15A 1T5XB 2ZXGA 3BUQA 1S7TA 5J13C 1S5HB 3KWWB 1YMMB 2LE9A 3DVNB 2YAHA 4HFUH 5EF2A 3RNQB 2K45A 1VEOA 2V6HA 4OGYH 3S48A 3T3PE 3MTXA 4HH9A 4PY7B 3BEWA 5BV7L 3B2MA 3EW3B 3FTGA 4BH7B 1K8DB 3GHBH 2O30A 2VZVA 2ZOKB 4Y5VA 1M7UA 3NCYS 3WKQA 3NIDF 2BNQE 3ATFA 4J28A 1AAJA 1NIAA 2H6OA 3MXWL 2EUVA 4ZD3L 3QEGH 1J3MA 2V2XB 3CVBA 3O0RL 2I25N 1MIEL 1C5BH 1AXIB 2QV2A 1BLIA 5KSUB 3VQLA 4XVSL 2XXMB 2YMXL 3TNMB 1YQMA 2I26N 3O4OB 3FTVA 2VLMD 1BLNA 1WGOA 3UAAA 3T3PF 4KBPA 4PJXA 2XTJD 2ORBH 1D6EA 3AS0A 3I84A 4U6VH 1OOAA 1J5DA 1XGQA 2B1HL 2C9VA 2DH2A 2X1OA 3FKUS 2AQQA 3OMIB 2GSGA 4YSEA 4XBEH 1EFXA 5IEHB 3HC0A 5EB9A 3TZVD 3RVUD 5KW9L 1FL5A 1JERA 2QFRA 4YBLC 1VEMA 2XZQL 3VFUB 1SBSL 3AM8A 4WNQB 3I9GL 3ILDA 3MUY1 3SE9L 4M4RA 4UINH 1Z9NA 4AH2B 5JMRA 2OR9L 3T04D 3HFMH 1UYWH 1MOEA 2FGZA 3BEVB 2WBJC 2VDPB 3K2MC 2DJUA 2CJSA 1USQA 3ULVC 4YHOH 5LXGL 4R9HA 2OLDA 4P2QB 3JWDC 3P4OA 2FJFB 1ZKAA 2B59A 2VLKE 4XXCA 3S7GA 5J5EA 3SOBH 4XN5A 1DQLH 5B1KA 5A2KH 1FRGH 5CEYA 3C08L 3MKKA 4H88H 2NX5B 1NUFA 2NOFA 3Q3GA 1F11A 1QSED 2VQTA 1HJBC 5BUGA 3GMRB 2J5LC 1EO7A 4LLUB 1DVQA 1AGEA 2L8AA 2VSCA 4U2ZA 2CHZA 4L8SB 1H8SA 3SZ6A 5AW9B 1IB5A 2BERA 2GSIA 3GMNB 3JTSB 1ACXA 1L3WA 5DQDH 5E99H 3ARBD 1Y07A 4JN1H 3Q8BA 3HAEB 3PJSA 3S3DB 1PGRB 3GDBA 4Z3IA 3ME0A 4EUPG 1FO0B 2JSFA 2ICEB 1SJHA 3T3MB 2YN5A 2DB8A 3ARZA 3DNKA 3RGVA 5TPWL 3U2SB 3TA4D 5ID0A 2WCPA 4U3XA 1W0WB 4QRRE 1VGEH 4XP5L 2SEBB 4GO8A 5E9NA 3C6LA 3VFOB 4FQXB 3VMNA 3CFKA 3WSQL 3HS0B 4Y2DC 3UPRA 4LCWD 1RIHH 4L3EE 2G5RA 4BXSV 3CBJB 1NIFA 2CGZA 5HGDB 1PW3A 3VB8A 5FYJL 1FA4A 5DUJA 2GVYA 2GT9A 1LK3H 3AT8A 1WF5A 4YK4B 1LE9A 1ZVYA 2EEXA 4LXFA 3GI9L 4FA6A 2QR1A 3HRZA 3ZL4H 4Z7QB 4YXKH 2CLVA 5FGBC 1BIIB 4M61B 5C0FA 4TSCL 4X7DC 1A7RL 2RJMA 3ASWA 4Y4FC 4X7FC 1M9WA 4YSOA 3SDCB 4AK1A 3ULUE 2I7OA 3LOWA 3Q8AA 1SLVA 5F3HB 4ZMLA 3VXTA 3VFPB 2NLJA 1QKZL 3GMLA 3P30L 1NGMA 3M88A 2HZSA 2XIBA 1IM9A 4XNUH 4UAHA 4Z7VA 4R83A 2XQYA 1AQHA 2HKAA 3WS3B 3P77A 2FECI 2NQCA 1TFHA 5D7LE 4CSSA 5JHLL 3H9ZA 2O26U 3V6ZB 5F3BB 5JA9A 5DLLA 2EDNA 4PI2A 5I8OL 1L7IH 1JFQL 1OM3H 4AE1A 3HZKA 3TJEL 3T2QA 2ZCKL 4A7VA 1TU2A 4LNVA 2BCMA 1WYJA 4W4OA 2RR3A 4M5TA 3TJHC 3ULUF 3K6IA 3LD8B 2WQRA 5TH2A 5L4IA 4Z77B 5MHSD 4FNTA 1WHOA 2ZCLL 2H41A 3EJSA 3H85A 1CIDA 5T5NF 4B96A 1NCUA 1NANI 1MAMH 1DSFL 4ZO8A 1KWKA 5B39G 4WNJA 2QADB 2GCYB 4Y19D 4M7JH 2HT4C 5ANHA 1N64H 4PRHB 5MEOA 2N1TE 4F7KA 1MQKH 3LKPA 5DJAA 4TUOA 1NWOA 4CVZA 4R84A 3I0XA 4K3HA 3D3VA 4KK8C 3TWCL 3UZVB 1G7HA 1X5HA 3I02B 1W0VB 4PRPE 4JFDD 4JFFA 1RZJL 4JZJA 4JO3H 3O11A 1KGWA 4H0GA 2DLFH 4MZRA 1EAJA 4UMGA 1UXSA 4Y1TA 1E8YA 5DJCA 3VWJC 3ZTNL 1BM7A 3LXCA 2HG5B 2IH1A 2XZZA 3PHSA 2Y06H 4J3BA 3GIVA 2P26A 3VG0H 5DTFA 5E2UL 4DGYL 1W91A 4YPJA 4D9QE 1PZSA 1QNEA 4JJ5A 1YTFA 1J0ZA 4EQ3A 3X13A 4F7CA 4F7PB 1XH3A 3BN9D 1IAKA 4IHOB 3O6KH 4YDVB 4ES8A 2NXZC 1YY9D 2UYLB 3ZE1E 4I5BA 1F4YH 2XPGB 4FF9A 2QQNL 4G8GB 2NSXA 4HULB 4LSTH 5K9JL 2BNQD 1U95B 3QORB 4X6DA 4AMKH 1T5WA 4HAGA 3EFOB 2FJSA 1T5KA 3MREB 4XPHH 5T3ZE 3GDCA 4MNQB 2JE8A 1AS8A 4TRPL 1LO4L 3HI5H 1V27A 2YRZA 4AK2A 1RK0B 4FYTA 4QAMB 5TE6H 5BW7C 1I9IL 3WE1A 1FZJB 5J1TC 4HCIA 2OCCB 1JK9B 2HTKC 2NTSP 3NYKA 1HESA 2FUQA 4JFQB 3GLZA 4HXAL 1RIUL 4RMVA 5KJ4A 5JHDA 1G6RH 4OLWL 3PQYB 4AEEA 4Q9RH 4NP4H 2QEJA 3MYZA 3VU2A 4UT9L 2R9HD 5DVKA 3TO4B 5IMOA 3WKNA 3BVXA 2F19L 4KTEL 1OTTD 3G5YB 3KYOA 1IEAA 4Z7WA 1WH0A 1I1AD 3QPQC 4PQXA 1DLHA 1EHLL 1HE8A 1AD0B 2Q7YB 2DMKA 3T0VA 3S9DB 4P4KD 3OSVA 4L3CB 4MYPA 1NLDH 2VLKD 1KIRB 5T5FA 4UIMA 5C0ND 4P5SA 3ZE0E 5GZNC 2ZJSL 1M7IB 3EYFA 3GB7B 3PWNA 2HZMA 3MRLA 4X4MA 2AP2A 4MYWB 5JW5B 2FJGA 1ZGLA 4GAFB 1WITA 3NRQA 1P7BA 1J1XL 4MRCA 1C16B 1X5YA 4E2OA 3LZQA 3EOAB 1T89C 4NOFA 3WFEH 1Q1PA 1OB1A 4NZRL 1WCBB 1QN7A 2BNRA 2PWDA 4WU7B 4NQSB 4XMTA 4EI5C 1TLMA 3VI4A 4K5MA 3IPEA 1T66D 4GLRH 4HHAA 1FJ1B 4V2BA 2OX5B 3RU8L 1COBA 1GC1L 4OZHB 3ZE0F 3HNTH 1OAYL 2AJUL 4KJQD 3CZFB 3EOYG 3HPLB 3QQDB 1D7FA 4GAJH 4LPVA 4TSAH 3SBWC 2WGXA 1E2VA 1WAEA 2NY1C 5E4OA 4FLSA 4QRRD 5DMYA 5HSFA 2EDEA 4IKIA 3VG9B 5F7EH 4F8QA 1FNEA 1CXEA 1L0YA 4H20L 3MRGB 1CGXA 2H0JA 3DX1A 3EGDA 2ED7A 5GQBA 1Z9SB 4L3ED 3WS6A 1X5AA 2R4RL 4YDIL 2YZ1A 5CKAA 1NC4D 3FQRA 4OF0A 3MV7B 5D2LB 2J6EL 2WAHA 3FUIA 4M1GH 5BQ7A 2ID5A 1WD9A 3ZBMA 4GMSH 1FVCA 4G9FA 5B1JA 2YS4A 4M93B 1WFOA 4FA8A 5JHAA 5C0GB 3BD4A 4JDVB 3NDZE 5AVWB 4P23D 3U79A 3UZEC 1RUAH 3FULA 3GSNL 3INUL 5DJ6B 3OMAB 1FVEA 2HP4A 3KR3H 4HCRH 4LPWA 3RVWC 5I16B 3ULUD 1AANA 2NNXA 3RX8A 1FAIL 2OMYA 1QZNA 1X7QB 3EYQC 2B2XL 2FGWH 1AS6A 1E4HA 1LD9B 2GFBA 4Y16B 4DEUA 2W65A 3ENEA 3AFLA 3WAJA 3MOAL 4N8VG 1CFQB 1YZZA 3IMSA 4MJIE 5J57B 5BPPA 3LIUA 2I85A 5F89A 1T2XA 3Q7JA 4HWZB 1CD0A 2Z64C 5CS7A 4X4XA 4D2NA 3TBBA 2HCZX 1BPVA 4J1UB 4LVHB 2ENQA 1RUMH 2FHFA 5KUMA 5C0AE 4B9GA 4P46B 3QBTB 3IGFA 4G11A 4KRPC 4HIIA 1T6VN 1JYXA 4BSJA 4LSPH 2I32A 5DXWA 5EN2A 2EEBA 5ICYA 1U9KA 2QVIA 3EO9L 3PIQA 3TH3T 2H32B 2K7PA 3QIUA 1CL7L 4F2MB 3G5XA 1T1ZB 1RH8A 1G9NC 2JPIA 1HL8A 4XODA 2Z0UA 3GMQB 1LEKA 1UCBL 3QUKA 3AXLA 4Y2NA 4ZFZB 3LKQB 3LXBA 4MAUH 1MEXL 1CXKA 1DFBL 2E3VA 5MEPB 5DHYA 3SODB 1EK3A 1VESA 1B4JH 3QDMB 3TWYA 5FGRA 4J8RB 4EUPA 2XETA 1X4YA 3BN3B 4X83A 1OSPL 2WJ5A 5CJXA 2RMNA 3U4BL 5EOCL 4PRPD 4DP5X 5CUSL 4FQCH 4BBWA 2HKFH 2WVVB 3GI8H 1TVBB 3HW7A 5EF1A 5TDPB 2XWBB 2ETWA 4WW2C 1UQSA 3ILEA 3D08A 4JHAL 4PAZA 3VCLA 2A1WH 2FQDA 1IBGL 1R3IH 5J1AB 2Y23A 3OKOA 2ERJB 3WNMA 3RX7A 3ULAB 2WHVA 4NNXA 4K3EH 1IAIH 3B9KB 3PWJB 4V2CB 1J5CA 4UV7H 3FU3A 3VXSE 3A0OA 2E74C 4GRMB 1JWMB 4YL9A 4ODUB 3WD5L 3LRMA 2VDLL 2P5EA 3WJJC 3D0LA 2AJYH 5FFOA 4HWEH 4H26A 4AQAB 2VQ1A 5FCUH 4X8JB 5GGQL 5CP3A 2GBTA 4YLBA 4PJEB 4QGTA 5AL8A 4RQQA 2ZWNA 5B4MD 5LNEA 1WVZA 4UU9B 5T3ZD 3ULVE 1I7TB 4YFLF 1AZCA 4DP6X 1AQKH 1N0LB 2ZYIA 1E6OL 2ZX6A 1DQJA 4ONHB 1EEYB 3SE3A 1U3JA 2H5UA 3U2JA 5CJ5A 1E5ZA 2IBBA 2Z4QB 4Z7AA 1KPVA 5I8KL 3KRMA 3ARGC 2W80C 5BS0E 1T1YA 5GRUL 4G1EA 3X3FH 5ES4B 1INQB 5TK2A 1KDJA 1QRKA 1MNUL 1F00I 2X89D 5AW2B 1KXVC 1LTXA 3LS4H 3BKCH 1QFUH 3MJ7B 1TZHB 3ML9A 3HZMB 1YQVL 4J4PD 1FF5A 1T2QL 3QJHB 3IMRA 5HHNA 1V3JA 5BQDA 3ULVF 2ZE0A 4HC1A 1DBBH 1RJZB 3NEXA 2IG2L 5C0CB 3FRUA 3NJGA 3VRIA 3NACH 4F8TA 5F1OB 5BMFH 2R0ZL 4A2HA 3L5XL 3VXME 1OZUA 1A7NH 1TBPA 2KZBA 2MQGA 4NM4L 4NRXB 3WFBL 2DLGA 3GS4A 5D96B 3PWPE 1S7QB 1P4BL 2C3GA 2XX1A 1OARL 4DOHB 3RBSA 1OW0A 2BLFA 1T3FA 1E6JH 3KWVA 4JREC 3QJRB 1BQHA 4OZFB 3VI3B 2MHAA 4F9LC 3DPBA 5AG8A 1MUJA 2PUQT 1KY6A 2VWEC 2MNJB 4QWWC 3ARFB 4UDTA 4L0YA 1P2CB 1ZT4B 4TL4A 4UTAL 5JW4R 4NM8H 1BP3B 4MRBA 2MZ8A 5TFSH 1D3UA 1HNFA 1L3NA 1U8HB 1VADA 4HMEA 4MXVE 3TC9A 3S0PA 4YHYB 1Z1WA 2H9GA 4MAYD 2Y7LA 3N44F 4X8GA 2OOXA 5AWNL 2APWA 2Y24A 4NUGL 4APQB 1JOIA 2ATAA 5E6ID 2BRRL 5DJ2A 3O8XC 4FFVC 1FL6B 2LGNA 1JGLL 2V5YA 5EU6B 3EADA 3HI6H 2AK1L 3FQTA 2YLKA 5LBVA 4MQSB 2JI3A 4KKCC 3HG1A 3PF2A 5JO5B 1NGXA 3LNIA 4XX1E 5DQ9B 2WLNA 3SDXE 5FUZH 3C5SB 2Z65C 1A1OA 3HLAA 3PHOA 4N0YL 4PCKA 2VDRH 4YPGB 1HXYB 1KTLA 3EDFA 3V6FA 1V7MH 4MXVF 5T5NG 5D7JC 4GAYA 4G8EA 3ZYIA 4UNVA 4Q9BA 1KBGL 1IIKA 3IGAB 1P9MC 3V4PB 3CSFA 4EQ2A 1D6VL 2H45A 5KJRL 3CFJB 3QNFA 4G6FD 4GI6A 1EERB 3HCVA 4KK5C 1IU1A 4L1SA 4HHWA 1G6RA 3US0A 5LGHL 1IGIL 1U8PA 4NYLB 5LDUA 1VFMA 5IWLC 1XGYH 3DK0A 4M48H 2HWZH 5KEZA 3SDXF 3EBIA 5AKRA 3IJHA 4KO9A 4NBZB 2OMVB 2NR6C 4TVPL 1Z9LA 5AB9A 4NP9A 4DTGH 3TA3B 2D03L 3GSRA 3STLB 1H3PH 4X42A 4YEEA 4KXZH 1JNHA 4MJID 1SYSA 2JIXD 4M1CD 1HI6B 4XO8A 2W94A 1A7QH 1S3KL 2PTVA 3ARBA 1P7QA 2ZYRA 3F2LA 3GRBA 5CSBA 4EN3A 3FT4A 1FAKT 1AR1C 4M62H 1L9QA 1UUNA 4W9JC 1UH4A 5JIPA 2VIRB 4OF3A 5C0AD 3WIAA 4G7YH 2V9RA 4AT6A 3RPJA 5AVYB 3A47A 2C4FT 1QN4A 3BD3A 4MLSA 1DVFC 1WBYB 2WSPA 2XZCH 1CD1B 5GHWL 3S3BB 2MQ3A 4PRBB 4LOEA 3H42L 4JO2L 3IWUA 4XZUB 1QLFA 4UT7H 3EJPA 1DFXA 1JPSH 4MTMA 3UMTA 4C55A 2CIIA 4MNGB 5G4MA 4LCWA 5F0LB 2VW4A 1T0OA 2DJSA 3ARSA 4HMCA 4HSAC 5SX5H 2YBGA 2EZ0D 4MA7H 1INEL 1BD2E 3QNXB 1NCJA 2ADFH 2QL1A 5HDLA 1CE6B 3EJQA 2N7SA 1I8KB 4KK6C 3U9UB 3X14B 2VJ8A 1Q94B 2OI9B 4JFZL 2C1OB 2PTTB 1WICA 5T1KD 1SQMA 2V8LA 1VACB 4ODHL 3T8XB 2YD3A 3U1QA 2W92A 2A4CA 3OKMB 4WWKA 5IEKA 5AVSB 4PCYA 2Y36H 2X4UA 2NT0A 3CWSA 3CVCA 2PW2B 1N6QH 2O1AA 3NCBB 3EH3B 1KG0B 2CDEA 3RWJA 3OXRB 3B1TA 5HYJA 2DQTH 5EO1A 2WZPD 3UTTB 2OQJB 1L9NA 2D7PA 3JUZA 1QSFE 2V7NA 1A7BA 4GSQA 2D7NA 1WT5A 2Y7OA 4EXPX 3UJTL 1U8JB 4XNQA 3DUHA 3MC0A 3VXSD 1U8IA 5KVFE 1F5WA 3O6FB 1URZA 3EYSL 4WAFA 5ACLA 4JFEB 4TULL 5F9JB 1J8SA 4WQOA 1JWUA 2WLLA 4EDXA 5LG1A 3G08B 5F6IB 2FVNA 3RG1C 4HIPA 4OF8A 4Z7NB 3KBHE 4Z9KB 3L08A 2GAZA 4FQQA 2COQA 4R7DA 4X99B 3FB8B 3G9VA 3DXAE 3K1KC 1QBAA 4OF6A 1JZ2A 3APMA 4ZFFA 4RMUA 5I6XB 1IZKA 1RFDH 2HRHA 1GKOA 3ULVD 3B9VA 5I8CB 2DI7A 1FE8H 4IOIA 1TTCA 4NJAH 1HKLL 1E5UI 1HSAA 1LO2L 4X6BA 1AISA 2AEWA 1NL0H 3KLSA 1DSYA 5IROA 1EZVY 3OKEA 4L9LA 2YRLA 3SCMC 5D7IB 3WIHL 5JDJA 1S9WA 4JAMB 4IM8A 3M17A 4Y7MA 1ZS2A 5BS0D 5LB1A 5B8CB 1UEMA 3EGSA 4H8WH 3BSHA 4KO5A 1T0PB 2J8UE 3IMUA 1A1MB 2AJ3A 4NHCL 5DK2A 3HOGA 1VHPA 4M5SA 4CDGC 1NSNH 1T22B 2FYVA 1SNRA 2QBWA 1GYAA 4ANWA 1R0AL 4WEBH 5ICZB 1ONQA 2ZKHH 2JB5H 4RWYH 3RDTB 2BSRB 2WUCH 3DLQR 1CI5A 4J5VA 2GUYA 5CIPH 1RURH 4AW7A 5JXEC 4GI8A 1YQLA 2QKSA 3IRCA 4UANA 4A04A 3IRPX 1J8HA 2EE9A 3EUUA 4ERSL 5DGRA 2AK4E 1CICC 3Q6FB 1JXFA 2FSEA 3QXUA 3K4AA 2FB4L 5MEQB 3SBPA 4WSGA 2OZ4H 5AAMC 2EDTA 3WI9A 2BIMA 2J8UF 3W2DL 1JPGA 3DK2A 4Y2DD 3V6OC 3KLDA 1R5VB 4UDUA 3HKZA 1GAFH 1T1XB 3B6SA 4NNYB 43CAB 3EDJA 5HP5A 1TQBB 5IBLC 5KVGL 1X44A 1OE3A 1U3ZA 3QZMA 1AXTL 3KWUA 3ALWA 4G2AA 2DI9A 4WHYH 2XFXB 3VN5A 4P2CG 3UYRH 1X9RA 1BDYA 4K9EH 4PJFA 1OL0A 4IKLA 1JGEB 1C12B 1XZ0B 2EDMA 2X6UA 4G7VL 4LQFL 4ONOA 4Y4FD 4AYGA 4G71B 2NXYB 5IV2A 3UTSB 2CKNA 4FJ6A 3I3WA 4HBQA 2C9UA 5F21B 1IMHC 2GIYA 4EJ1C 4Z78A 5H8DA 1DQVA 2X05A 1NMAH 5DMJB 3FONA 5JR1H 4J3OH 4I89A 4J7RA 1N59B 3PFQA 4M6MH 1OK0A 2NY4D 2Q6WB 1TQWA 2DIJA 2WXQA 1T04B 1AZUA 4NN5B 2DY2A 1YAZA 2R0LL 4DFIA 1KACB 2F9BT 4JFOB 1BF2A 1I1AA 3GTVA 3O4OC 4AWJC 2IANE 5AVZB 3WEXB 2FT6A 1CBJA 4GBXD 2DDQH 4ZOAA 5IF0B 3ROOA 4OKVB 4F7TA 5JW3L 1XH0A 3MLVH 4ETQB 1NBVH 3RIFF 3GXIA 5LBSL 2ESVA 2AEIT 1A6WH 2Y1VA 2YKKA 4Z0XB 1HCVA 4IRSD 3NZ8B 4KH9A 5FECB 2BINA 4PSPA 1OVZA 4ZOBA 1WTLA 1UJ3B 4RMSA 2VDMB 3US9A 1JXDA 4I1RA 1CDCA 2Y07L 1KZYA 3RKDC 4DZ8B 1OPGL 3I6KA 3V0IA 4LSQH 1QBMH 1M7DA 2R1YB 1HHKA 3V6BR 1JMZA 5FOJA 5BMPA 1UENA 2X1PA 4KK8D 2HN7B 4E5XG 3UJJL 4DO6A 1XX9C 2WQ8A 2ZOUA 2FX7L 3BIKB 1F45A 1TZAA 5DO2C 4W9FC 3OB0K 5DHMC 2I9LB 5BRZB 4JX0A 3B2XA 3ZRCC 1DUZB 2B77A 1K35A 4EKJA 3BZDA 2AZUA 2VN5A 4JHWH 2IALA 2VGLM 4LLWB 3TNNB 2HT2C 1FZMB 4GKSB 4BDVB 4P48A 2OXHA 2GJ6B 1M3HA 1JNLH 5D1QC 4W70A 5AAPA 3MO1A 3POHA 4QRRA 2OJZL 3G6JB 1BVKB 2YC1B 2NZ9D 4NJ9H 1MVUA 1LWWA 4L8SC 4DKFH 5DJXA 3UO1L 3RUGE 1PSKH 3QNZB 1SXSA 1A3RL 2QZQA 5SWSE 1KEMH 4JG1H 4MDJA 4Z23A 4ZMPA 2NXZD 3I6GB 3CVHH 2R8SL 1WWAX 3O3AA 3N0AA 5E6ZA 3H7BA 1BD2D 4WHTA 1UB6B 4JVPA 3SNSA 4E36A 3DJZA 4U1NA 3NAAH 5K9QI 3T2PA 4HUCA 1NWPA 1QO3B 4WW2F 4M43L 2R23A 1N68A 3W11C 2JLPA 4XP6H 1QEXA 2X7LB 3QHZL 2V8QA 3F64A 4P23A 1SXCA 2JKJA 4D0CB 3VA2C 2VABB 1UD5A 4N6RA 2H1XA 4OAWA 5DVPA 4FGMA 4FQXC 1QFWH 5AZ2L 4EIBA 4RX4A 3TYFA 1L6PA 2CA4A 4BWTA 3RUGF 3I75B 1OLZA 4J3UA 3B83A 4L37A 2HTKD 3WNOA 2VITA 4AGQA 4WXAA 1AGCA 3GD1C 1QSFD 4A67A 2YXMA 4KRMB 3WL9A 2JB6A 1G0DA 4NQVB 1KBVA 3KLAB 4YK4C 5D7LA 2I9TA 2PPFA 3QR0A 1BSIA 4KVCL 1J5OL 3CLFL 1KMGA 4K5OA 5IK3B 4TQEH 1LQBC 1F1DA 5IBTH 2FT8A 4LOUC 3SDCC 5C0IA 3DXAD 3QPQD 4LSUL 4HU8A 2NY2D 3L2NA 5AW8B 1HZHH 2AF2A 3RWCA 2Z8SA 1JZIA 2K3HA 1MIML 3QCVL 4FYRA 4NFCA 5L4FA 3WCYA 4YHPB 2B7DT 5JIMA 4GKLA 3TPUB 3TEWA 3DX0A 3SY0B 2UWEE 4OFKA 3BO8A 4XP9L 4KOCA 3INOA 3CFNA 2YD9A 3FXIC 4X4ZA 4XVJH 1PAZA 4N0UB 1KGXA 3RL2A 3KW7A 4PRPA 4ZRGA 5GRVK 2NOEA 1T0NB 3LD8C 4XI5C 3F7RA 2E76C 3WBDA 1ZDQA 4PD4J 3UP6A 4B7IA 4Q6IB 4UOZA 3IPFA 3L9BA 4PYGA 1LWJA 3TN0B 5FK9B 4FQHB 2QADC 2WTRA 4EI5D 3H53A 2W9EH 1M9SA 3L7FA 4IBUA 4QRUB 1JNNH 2H0FA 4K71B 4XBGB 5FO8B 2XHNA 2VT0A 3D25B 5T3XE 3R18A 1B2WH 1NCDL 1ASPA 2ZOOA 2AK4D 2UWEF 1JZEA 2E86A 1SXBA 1VFBB 2GTWA 1VGKA 2FBOJ 3C9NA 5DJZA 1IFHL 2WOYA 3H3PH 2R27A 3RTQB 1NMCC 2R69H 1DZBA 2XWXA 3EZJB 1C5CL 4I3SH 4YXHL 4WKZA 3US1A 3T8VA 4MD5A 1A6UL 1ZE3C 5GRJH 1ET7A 5KOMC 3SGDI 4Z7UB 4CFFA 1T83C 2OPCA 2DD8L 3KWTA 4O5LH 4GY4A 4IW4C 4XX1G 1ZWIB 3LMJH 4UIKL 1N7MH 5JUEL 3SDYL 4MQXC 3U7YH 3WTTA 3BWAA 3UJIH 4P59H 5J1SC 5JORB 3S37L 1QATA 1OAKL 4DEPB 1UXWB 3U4EA 1W8OA 4EZJA 5JIHA 1GZPA 3DX2A 2WZ5A 4IGBA 1G7MB 4XNBA 3FH5A 4XCFL 1DQIA 1AZVA 1XZWA 3DYOA 3RY6A 4OCNC 4PLOB 1QUPA 3ILPA 4PJBF 1FFPB 2NNFA 3FFOA 3GUFA 3OQ3B 3QORC 4ZUWB 2X6VA 4U1IB 2QRDA 2MOGA 1IX2A 3GMOA 3ZOAA 1I1FB 4X5WB 2Z1PA 1HCZA 2JTYA 1HNYA 2Q8BL 1G5GA 3QFDA 3EG9A 4QRTA 5IW3A 2IAND 2NOBA 3HC3H 4HLEA 2Y5TB 1K4CA 3ZTDC 4KRPD 5F7YC 4PVBA 1BFSA 4ZPVB 1YN7A 2BSTA 3L9YA 4LNRB 1E9OA 3DIVA 3N3EA 4UTCA 4F8LA 1IVTA 3LHPL 2EDFA 2WIMA 4MAZA 5AAWA 2O5ZH 1JHLL 4H7VA 3MRDA 3VFGL 1RL1A 3CHRA 4TUJB 2DKAA 3NCFB 2WO3B 3TO4C 3C2AH 1Z3GL 3QC6X 3BE1H 1D9KB 1VFAA 1U3HD 4P06A 4URTB 4ZTPH 1UEYA 3CG8A 5CIPA 3DGDA 4GG6B 4HZ1A 3ES6A 5I15H 3RIAF 5HDQL 3U2IA 1G9ML 1FH5L 1IE4A 4M5YL 3BI9X 4NQEA 3L95A 5DRZA 5H35A 2O4EA 4L8BA 1JGUL 5GJSL 4AENB 3MA9H 4HZAA 2PCXA 2Z31C 4X8XA 1I3UA 4V1DD 3UTQB 2D0FA 3SGEH 8FABA 1P0SE 2EJ1A 5E9DB 2FL5B 3GJFA 2VLJA 1BOGA 4Q8BA 1C8PA 1C7TA 5DD6A 1JG9A 1Z66A 2XHIA 4DNLA 1DANU 3TT1L 3Q06A 3VO0A 2WCGA 3K8KA 3R1GH 5IG7B 1U8NA 2DQMA 2X6CA 5GGVL 3ZDWA 4Y88A 1DN2A 2ZOLA 2HMIC 3TBTB 1M3JA 2Z6FA 4G6JL 7CGTA 2CLZA 5SWSD 4E9WA 2GUOA 2FIRT 3TM6A 1O5PA 4JB9L 3C60B 3DX8A 4KQ3L 5T33H 4B9FA 1HZKA 2OKMA 5IB1B 3G6AB 3CHXA 4PB9H 1JF1A 2BM3A 3D9AL 4MD0B 2H1LM 5E5RB 3E9UA 5IB3B 2BOBA 2EDOA 1HHGB 3VGAB 3LZNA 4Y2OA 1BVNT 4HZLB 1YEFH 1WA0X 2WQSA 1JCVA 5F96H 2XG5B 4FQJL 5FC9A 3RIAK 1EHNA 5I19L 1FYTA 2YAEA 1CD9B 2QSTA 3SKMA 2P44B 4FERA 2VXUL 5ITFB 4XC3L 4HK0B 5C0BB 3QO1B 1KXHA 1A8ZA 2VDML 2X2UA 1M57B 1I1YB 5DVMA 4APXA 3F7YB 3WXVH 3KZ8A 5F72S 4I2XE 4IIQA 3CZEA 1Q0EA 1IGMH 4AGPA 1MG2C 5FDWA 1UD3A 4YIQB 4M93C 3OD3A 4YJZL 4QRSA 3MGTA 3QI9B 4U2YA 1FC1A 4ABVA 4AKPA 4Y7OC 5HYQB 5IW1A 3WE6A 3PP4H 3OZLA 4XAWL 3QULA 3OTTA 4GAAA 5T1MB 1QNZH 3QDGE 1M05A 4NZTL 1MRCH 1M1XA 2B0SL 3VDBA 2AQ1A 2BFVL 1RIVH 4JFPB 2D73A 5CZRA 5C08B 4G1MA 3VJ6B 2EC8A 4Y16C 4E5XA 2KQMA 2F7OA 2LOEA 1BVLA 5E1AA 3GJEA 3S36X 3UBXB 4GSUA 5KSAC 1MCIA 4RISL 5KYYB 4NWTH 3A6CL 4WV1B 2R83A 4B9JA 3V6OE 3QNYB 3LRHA 2EE2A 2C7FA 2PYEB 3HEIB 2ZUVA 4ZMWA 4ZUSA 4LVHC 4QWWD 3MACL 3TCTA 2XLLA 4P46C 1FLTX 3OKNA 3UFIA 4LARH 4G80A 2PP7A 3IKKA 4BWWA 3FU8A 1CDUA 2VXSL 5EZIL 3MROB 3M7FB 5F70A 5E8DL 4KUCF 1E7VA 2QPSA 2X4OB 2N0MA 4PRIB 4J2QA 2YD7A 1YMME 4X0KA 3G9AB 5BZXA 4RIRB 1B9KA 1F90H 1UB5B 2H3XC 1UT9A 1KCUL 2A9AA 2BVPA 1IC4L 3CVHA 3O8XD 4FFVD 1YA5A 4GAGL 4IRJD 2X42A 2VLLA 2G9KA 2Q7AA 5T3XD 3FQXA 1SDDB 1P6WA 4XP4L 3VXSA 4KDWA 5DMIL 5EEXA 2E4TA 3D85D 3OBAA 4NXSA 1CN4A 4DEWA 4HH9B 3W38A 1UD6A 3IU4L 2NQ3A 1EWHA 3DPUA 2DIEA 3BH8A 5GRXG 1HOCA 4R26H 5BXFA 4Y5VB 5D1ZD 2E6PA 1TO4A 2FHBA 4XTRC 5D7JD 3TVMD 3CFIC 1T6BX 3L3DB 3WFZA 3WGUB 4QJ4B 1N3NB 2V5SA 2WBJA 4BELD 3LNGA 4GG8A 2ERJC 2WBKA 2X40A 1CYGA 1RKRA 1U3NA 3ECUA 4JPKH 4U4BA 3VUAA 2LU5A 2VE6A 1H3TA 4OBSA 3EZ8A 4KK5D 1YYLL 3B9KC 5AVVB 3QAQA 4G7QB 4HCFA 3D7QA 4WIQA 5HYEA 1BLNB 1M2OA 4AI7A 3TCLB 4XE0A 4KUZH 4PJXB 1UATA 4TNGA 3QGVA 5F7BA 1D6EB 2L7QA 2NY3D 3DX9A 1KCVL 1MREH 1XGQB 1N19A 2NR6D 1WK0A 2GSGB 4Y5YA 3UYOD 2QSCL 3RURA 3GIZH 3HC0B 4RZCB 1GSKA 3RWEA 1NKOA 3SD5A 1ZANH 1OCWH 1JXKA 2IF7A 4UB0H 4LCCA 3WV0A 5J3HC 4P2QE 4BZ2H 2OMWB 3N85H 4S1RH 5I1IL 2OAAA 4M4RB 3O2VH 3UADA 4QRPB 4PMFA 4TSBH 4Z3JA 1AR1D 5FYLH 3O4LB 1NBZB 3A6BH 1PIFA 3RE0A 1AJ7L 2NX5E 4BKSC 1K5NB 4QI3A 3VXMA 3ECWA 4A2FA 3C75A 3ZRFC 1DVFD 4IS6A 2IWFA 3P4OB 1AHWA 1D2OA 2B59B 3E6HA 1A7OL 1DUYA 3PWPA 4GFXA 4H5SA 4KZDH 1A9BB 5F7DA 4B97A 1KELH 3SPVA 1MHCA 2JELH 2V3DA 2VDOH 3B7UX 5CU5A 3AU0A 1VPOL 1C7SA 3GRWH 1DBJL 1TNMA 3JSSA 1MHEA 2E59A 3KPRA 3T2LA 1F11B 1PS3A 4U1JB 4JHZA 2EIKB 2WMPB 2D31A 1AGEB 5G4NA 5LCVA 1FGNL 2FBJH 4FKKA 1JJUA 1CDHA 4KK6D 3ZU8A 1BBDL 5CD5D 2AEPL 3T3ME 3AXIA 4QLRA 4WUKH 1NMBL 2WN2A 2GSIB 1PZCA 4PI0A 3OJ2C 5D96C 1MZZA 1E50A 1GTNA 2CMRL 1U8OB 2DQUL 4Y4FA 1G1OA 3PJSB 4N87A 2R69A 4ODWA 1FV1A 5TQ2H 1X5GA 1RCYA 1SJHB 5JZ7D 1TQSA 1WJWA 2JVUA 1NCTA 3RGVB 3DROB 3EJUA 1YECH 1XGPB 3BKML 5ID0B 4NPKA 4XMXA 4HLZG 1AXSB 2FIKA 3ARFC 4NDMA 1UFGA 1XF3A 4ZNCD 4LMQE 3OR6A 3C6LB 5D8JL 1RHHA 4Z7QE 3CHSA 3H55A 4YHYC 4Z95H 3T3MF 2NDGA 4XPTH 3LS5H 4APQC 1LE9B 3OMZA 5CWSB 1UH3A 1W72H 5CJ8A 3X11B 3N2JA 4JM4L 1KN2L 4JO1L 2CLVB 1HH9A 1KCRH 4PW4A 2ZSVA 5C0FB 3V8OA 4A66A 2TSAA 4YHML 1BW8A 1FQ9C 2P28B 3VXTB 2WY3B 2NLJB 2WNKA 4JQIH 3SCMD 3GMLB 2DQHH 4Z7QF 1IM9B 4WTZG 1T80A 3DMMB 1UA6L 1NGWA 4JY4A 3N42B 1OAXH 2F8XC 3P77B 1TJGH 5DS2A 1XT5A 4RFEA 5E2TL 1LWRA 3N41B 4N22A 2R4SL 4X7TA 2F7IA 4A7GF 3AQYA 3B7TA 5I0YA 1RVFH 3HZKB 4HT1H 3DPTA 4BQBA 1K72A 1R3KB 1S4IA 3CVIH 4MXWL 4AEHL 3B34A 3VWJA 4UNUA 2LFGA 1IKFL 4PRHE 1UKQA 2Z7YA 3GKWL 4KUCD 4LAQL 2DQEH 2PR4H 2I60L 4TOYL 4L2YA 1V54B 3L2MA 3TA3C 4LP4A 1CICD 3MV9B 3S3JA 4M7LH 3V5KB 3NSYA 5C2BH 4Y2LA 3WTVA 3UZQA 3DC0A 3RA7H 5I1CL 3CZLA 1U8MA 3LKPB 4DK5A 1KYAA 5FR3A 4TUOB 4CVZB 3OZ9H 5CEZE 4JR9H 4S2SA 4HK3N 3HMXL 1FZKA 4QHMB 4QO1A 5F0PB 5KZCD 1G7HB 1NCBH 3EDEA 3GBNH 1KBBA 3OLEA 4HS8L 4DP8X 4XXWA 1B0IA 3VFWA 5I1EL 4JZJB 4MS6A 2C8NA 1FLRH 3NJVA 4PFEA 4U1SA 3V0JA 1PY9A 1YMMD 3FRPA 4YSTA 4HUXA 3CW7A 3FQ2A 1DJHA 2DQFB 3VSVA 3LRSB 2W1NA 3U9PH 1UD2A 3DO4A 3NRFA 1MHPH 3GIVB 3GZOA 4G8GE 1PQZB 3K0YA 1IGTB 4JJ5B 3WDJA 2L3BA 3U7WL 5E1HB 1GMIA 4F7CB 2OI9C 5G55A 1XH3B 4MNQE 1AE6H 1KJ3H 3TBSA 2OL3B 5EZJA 5PAZA 4I5BB 3MBXL 4IBQA 3SPCA 4OLEA 4XXDA 3WHE1 1CLVA 1PIGA 1KGJA 4MDRA 1T5WB 3HC2A 1PCJX 1HU0A 4WWOA 1UZGA 3VYOA 2ZSWA 4L3AA 4QGYA 4G5ZL 4N28A 5LO7A 4OD3L 1MY5A 4KMQA 4QIRA 2N01B 1A6TA 3CCHB 1L9TA 2MTPA 5HVHB 1MY7A 5GZNA 2VR5A 2WO2B 2CO7B 3PQYE 4IK6A 3O6FC 4DKAA 3WO3B 3SKJL 5IYDP 3AJ7A 4J27A 2YHGA 5F6IC 3RKDD 1O9WA 3SKUD 2AHIA 4ZX3A 1HU8A 2XJLA 3N55A 4KZCA 5CKGA 5DWUH 5JHDB 4EXKA 4FLOA 5EN3A 4CKQA 5IIEB 3QDJA 3EO0A 3WDHA 1NCCH 2JTDA 2FR4A 2OBGA 1BXVA 5GGRA 3IGLA 1VENA 4WJKB 1LO5A 5DO2D 1GGCL 3U46B 3JV0A 4P2QD 2XY1A 4EI5A 1I8IA 2F54B 4OLYH 2ADYA 3KYOB 5DK3A 2G60L 3T5WA 2OMTA 2AABL 4AQ1A 2QPDB 2WWMD 3VXUD 4LGRB 1JF6A 3IT8D 4CW1A 2AVGA 3TO2A 2NX5D 4QTIH 4LVOB 4UZGA 4LPXA 3V52H 2XV2A 2HT2D 3LH2L 3SBWA 4F7MA 1PDKA 1CK0L 3BZEB 4E42B 4GH7B 4UUJA 3CZKA 4X9YA 3BZFA 4UIMB 1UWEL 5B8CC 2E7HA 1JV5B 1TDQA 2IFFL 4NQCA 2YN3A 1BVOA 1JPFA 3FK3A 3MRLB 4F7EA 1A5FL 1GIGL 2FJGB 4JZNA 4U0QB 1ZS8A 4ONFL 1MPAL 4GUPB 5K1NA 1EA9C 3IDNA 3RDTC 1ZTXL 4G7SB 4XHJC 1UGNA 4NNPH 2IEPA 4LPCA 4G6AC 4IQHA 4OZHE 1ZEAH 2QREA 4UAOB 1IBBA 1OB1B 1BQLH 5DD1H 2RIKA 2LLNA 4I0PB 5CZKA 2QGCA 1F97A 1VCAA 4XB3A 1MJJB 2ZUQB 2BNRB 3W11D 1YNKL 1UGKA