1QTSA

Crystal structure of the ap-2 clathrin adaptor alpha-appendage
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C)
publication title Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 71
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1qtsA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qtsA02
2D0AA 1IU1A 1QN9A 3ZHFA 1TBAB 3OCIA 1RM1A 1QNCA 1QN6A 1CDWA 1VTLE 1R4XA 1KYUA 2E9GA 2DWYA 1OM9A 4B0AA 5IYDP 1QN8A 1PZDA 1VTOA 1VOKA 3ASMA 1KYDA 1E42A 4WZSD 2IV9A 1TBPA 1NVPA 1MP9A 1QTPA 2IV8A 1AISA 4BCXA 4RODB 2VJ0A 5CN1A 1TGHA 1QN5A 1QN4A 2D0BA 1QNBA 4ROCB 1NH2A 1C9BB 1QNEA 1YTFA 1GYWA 2DWXA 1W80A 3MNMA 2D0CA 2MJ7A 2G30A 2YMTA 1P4UA 3OC3C 1YTBA 1GYUA 1NA8A 1JFIC 4ROEB 1QTSA 5IYCP 3ZY7A 4PY5A 1B9KA 2A7BA 1QNAA 5CN2A 3H1ZA 1KY6A 3HS8A 3VN5A 3EIKA 1VOLB 1QN7A 1KYFA 3HS9A 1D3UA 1PCZA 1GYVA 1NGMA 2Z8UA 1QN3A 1KY7A 5IYBP
chains in the Genus database with same CATH superfamily
1CPUA 1FN7A 1F11A 3K5RA 2X28A 1AD0A 3VWKA 2QKSA 4MS6A 5BOJA 1A5FH 2ZWLT 4AVKA 3CPLB 4ONGL 4YMPA 3MQIA 5J1AB 3OLDA 3V4PB 1EFXD 1G7QA 3ECUA 4FTVB 2BMKB 4ZNEA 4JZNA 3GRGA 5D2LB 1E9OA 5I82A 4JRXB 1CXIA 4L9LC 4DVBA 2J71A 1HNYA 1IGJB 1LDSA 4W70A 4YGAB 1QRNB 3FULA 4I88A 1ZS2A 4NI6A 5HDBE 3KWWB 3GI8H 2UZIL 1CFSA 3OXSA 1KCSL 1Y0LA 3N42B 3QWRA 4N1HB 3D4ZA 3Q48A 1A02N 2BSDA 2B77A 4UIKH 2P80D 3D08A 5CSZB 3ZE0F 5E4EB 5MEQA 3HPJA 1BMWA 3UZQB 3MGTA 5HHNB 1MJJB 3S9DB 1XL4A 3H4FA 4P57B 2DMBA 3CWTA 1KJ2A 4HAFA 3LCYA 2WSDA 4LEOB 4YL4A 5FUOL 5D2NB 3ARFA 1NEZG 2WYZA 4MD5B 4WI0A 1PDKA 4JQIA 1R3KB 3MJWA 3PIQA 3CSBA 4BCXA 2XKNA 3T0EC 2DKMA 4D8OA 1HHJA 3PP3K 3NZHH 2ZOTA 3HNSL 4NN5B 2D3NA 3SDDA 4MA7H 5D1QD 5DRXA 3WIFA 3VFNB 4P3DB 4OUUA 4HLEA 3NN8B 2VXQL 1JL8A 4Y5XC 3IE9A 4LSTH 4Z7UF 1BWWA 3IBOA 1R5VA 3V4PH 4F8OA 1DBBL 4G6ML 1QABA 4Y5YA 3MRDA 1S9XA 1XD1A 3CBKB 1MFAL 4UTCA 4BSWB 4U6HA 2DMCA 4JFTA 3ZPDA 1BCIA 4ADIA 3L9YA 2X3BA 4O2FB 5KVEL 1XZ0A 4K94L 1K8IB 3ARGD 5JPMB 3UACA 2ZF9A 3AXIA 1U8QA 2QGDA 5B3NA 4XNAA 1EAPB 1Q9OB 3NFPA 2EUWA 4CVUA 5SWZD 4PBVC 4KK8C 3EOBA 3WJJA 3ES6B 2E9JA 4EIGB 4OT1L 2CO7B 4N2MA 4PSPA 2PPCA 2OMVB 4NNPL 1MVUB 3BAYA 3RAJL 3C6SB 2PWFA 3U4BH 3ECWA 3IAPA 5EZIL 4PJ9D 4TLKA 5E2VH 1WTLA 4AE0A 3L4ZA 3HE6C 1NDGB 2O30A 3QQ9D 2CKBL 1ZRUA 5DTFB 4D8PB 5GXBB 5BOZG 3PWPD 1KNOB 3O6KL 3VGGA 3GJFH 3GI8L 2QQNH 2XWBA 5BS0B 4NRZB 4XPHH 3WN5C 5LXGH 3ZYIA 1JP5A 4HF5L 1HOEA 3VXMA 1DN2A 4GFXA 5I17A 3VD7A 4MQ7A 3LPGA 3SYCA 3B4NA 5H2BB 4Y16B 4PGZA 5AZ2H 5ENWA 4AW7A 3IDIB 4NQEE 4XP6L 3RUGF 1ZLVH 3LVTA 3SPGA 4F7CB 2C9RA 1AY1L 2DM7A 2IAMA 1P1VA 4KHXH 3FQWA 5DQDH 5TDOA 4WXAA 3TPUB 5HJ3B 3S3JA 4CVWA 3T6VA 4RFEB 5TH2B 3RZWA 3UL4A 4MJ6B 4X9YA 4G8FB 5AW1B 3RNKA 3PXJA 4E42B 1WYJA 1CLZH 3OR7B 4K3JL 5DQ9A 4IRSA 2E8ZA 3PHSA 3T3PF 4HUMB 3DPTA 4HHAA 1T03H 4J1UA 5KSUB 1OAYL 4NKOB 3V4VA 2E9GA 4BDVB 4ODVL 5IROA 2PCXA 3VFRA 3VI4F 4MCZB 5HYSG 4J2XA 1ACXA 3GMNB 5FM4A 3QR2A 2K70A 3I6LD 1U8PA 1XXDC 2CGRL 2RFXB 3NJXA 4X6BA 1HU0A 2OX5A 1KYDA 1PSKH 3A4AA 2NY3C 3QUZA 1ID5I 1ETJA 3HZVB 1ZV9A 3FQRA 2VLMD 4L37A 5BV7B 4OGXH 3RI5K 4EN3B 5J3HD 4MNHB 4YNYA 4YDVB 1BBDL 5TK2A 4YDLB 5M95B 2OSLA 3EGDB 3VXME 4FQIL 3B56A 4KI5C 4MA8L 4BH7B 4ZQKB 1DQML 1OLZA 4HQQL 2Q3XA 2EZ0C 1J1OL 4PGCB 4ABUA 1F3JA 5E1AA 1BA9A 4YZFE 3A3YB 3NCXA 1FG9C 3H2WA 3NPSB 3ROLA 3TNMA 1OAJA 4FQXD 4HUWA 4JO8A 3U9UB 2WK2A 3S35H 1FRGH 3LKQA 2ZSWB 3QC6X 2N4IA 4JJ5A 2YEQA 1RZGA 4ISVB 4LIQL 4X9HA 1ITBB 1KLUA 5CCHE 3PL6D 4XPGH 4EQ2A 1U36A 1OT2A 1KC5H 4HJSA 3C2AH 3C6EA 2ZZUT 2WCSA 4WW1B 1BZ7A 4P3CL 4ZAKB 3MRRB 4WJKB 1BXAA 4KZCA 5DQDL 2RB8A 4CILA 3PXHA 3MLRL 4LMQE 3B2MA 4KY1H 1ITCA 1WCBB 2BP0A 4ATWA 4ES8A 3BO8B 2AXJA 1E67A 1F00I 5BMFL 5DMGC 3EHBD 4P4RA 4X4YB 5CMAA 5JOPE 3KHQA 1JF6A 1MXGA 1Q9KA 2BHZA 4JDVA 4ORZC 4DFIA 5DD3H 5BV7H 2EE2A 1SMAA 1JN6A 4OFVA 2ITDB 4A6YL 1CGSL 1HHHA 3OPZH 3TYGL 4HJ0C 4PWFA 3IYLW 4HDIB 3GXNA 4F5CA 1Q1JH 1XTMA 3GUFA 3X3GL 3RWIA 1J8HB 4G8IB 3OJDA 4NO5A 4LEBA 4G1EB 3BFWA 2A6JA 5ETUB 3BKJH 4R2GC 1WCQA 4IBLT 4JFFA 4G42A 3SQBB 2PCYA 3IMVA 4IBSA 4OCYH 3F7QA 4MSWB 1KDIA 4LP8A 1RJZB 3GSNL 4GBXD 3D7QA 5TJWK 4YHIB 4E5XG 4HIJA 1VIWA 2BVQB 1HILB 3DVNA 5DUMH 4X6CA 5ISZB 1U8LA 3ZSSA 4WCYL 3FU3A 4H2CA 1D5XA 4YHMH 4B0AA 1UXMA 5AW0B 1JFQH 1RZJL 2BSTA 5IGXH 4OKVB 4YVUA 3ULUC 3WMSA 1YEGL 3VGHA 4AQOA 2NX5B 3D69A 1J0ZA 4URTB 1X5IA 5IZ7A 2ZNWA 5CGTA 1DJZA 3HA0A 2IALA 1HINL 3V9CA 4NWUL 2QKIC 5BMNA 1Y6NR 4N0UB 4ETQB 3R4DA 3NZ8A 3EOYG 4MAYA 5I15H 3MLZL 2ESVA 3IGAB 3ESVF 4FCAA 3QIWA 4TQEH 4F5CE 1CDBA 3B8YA 4R7DB 4GMSH 5DZJA 1VSCA 2CDEB 4QIRA 2YD4A 2CDFA 5INCB 1CD1B 1IM9D 2JELH 3VXTA 1VFOA 1UWYA 1FIGH 4DP2X 1AGEB 1W15A 3FU6A 3C5ZC 4N90E 4JFFE 1LNUB 3ZHNA 5HY9A 4M7LL 4PGBB 1UZ8A 2AJ3B 5CJXA 1FLRL 3ZO0A 4TUOA 2N56A 1Q1JL 5HYIA 2XTJE 4LAQL 4WUUB 5K93A 4QYAA 4LKXA 4TSAH 5LGHL 4F8PA 1X9RA 3IGLA 1QTYT 2P8LA 3DMMA 3MFFA 4NQDE 4H2AA 4NQVA 2AJXH 1W0WB 1URIA 5JUEL 4X6CE 4IBTA 5JHBA 1YTBA 4IIQC 1AGDB 2NSQA 3HAEB 3LKOA 4BBWA 1KTCA 1W72A 3CXDH 5ANME 3VWJA 3SKOB 2DW5A 2OJ1A 3LKPA 4J6RH 5DSCB 5KYNA 4PY5A 3S97C 1F90L 3V55A 3GUTA 2VDNL 3P40A 4PJ5E 1AJ7L 3WS6A 2ZOWA 3QW9A 2FZ3A 4WFED 1KTLA 3P4NA 2EDWA 3LY6A 2Z0FA 1CB4A 1Y7VA 2IQAA 2EYRB 2L7UA 3QWQB 4YHML 2CHZA 5JDJA 2JXMA 1RJCA 3MJ7B 1FSKC 3QJRB 3T6WA 4Q9BA 5JQ6H 1M1SA 4RGNB 4ELKB 4KVNH 1S3RA 2FYYA 2I9LA 2OMYB 3TZVA 3QXWA 2AXGB 3EYFA 3N91A 4K71C 1T5KA 4OM1H 4O9HL 2WCGA 1BF5A 3SDCA 1C7TA 4PW4A 5JIQA 3NTCH 2CRIA 1UURA 1OARH 4JN2B 4JGMA 4GMSL 2C7UA 3ASOB 3RWJA 1S7QA 1S7WB 3LH9A 3MV8D 5EEVA 4QJ3B 3CMOH 1XIWB 3SY0A 1SQMA 4B9CA 1PX4A 4GXFA 5DD5H 3BW9A 4L4TB 1AQMA 3V95A 3UC0L 3VG9C 2DWTA 4G2AA 1AC0A 1MIEH 4NKMB 4WSGA 4YS4A 5A2KH 4I3SL 2MJWA 3SKNA 5F8RC 1R3HB 1YCSA 5L0QC 2PLTA 1T1XB 4Z23A 1CBVH 1TJIL 1KBPA 1N7MH 6TAAA 2CHWA 2VMCA 4XBMA 1IT9H 1SDYA 3POCA 4JB9H 3VW3H 1QLEL 1QTPA 4LHJB 5EBMA 2E7HA 3AABA 3MBED 4APQD 4MWFA 1DQJB 1NGQL 1MFEH 5BRPA 1OK8A 4WTZA 4CNIA 1WA1X 5EF1A 4I1RA 1Z3GH 2Y5EA 2FJFA 3T1FB 3VD4A 1A6ZB 4XB7A 5EV7A 3L1OH 3G6JB 5E8PB 3O3DB 4JM0A 2EDXA 2ZXBA 4ZSOB 4PUBH 3MV7B 4GRWF 3N55A 4HD5A 1XF2A 3B9AA 3WG7B 3WLWD 1GYCA 2QQQA 3ZL2A 5KVGL 5E0FA 3MUGB 1X7TA 1FCGA 2OMXB 2I07A 3QE5A 3B2UD 5AVXB 2DL2A 1P53A 1S5IH 4PCTA 2IVFC 5B7MA 1I8IA 3ELQA 5JIKA 4HKZB 1KIQB 4G70B 1JPTL 1MQ8A 2CG9X 4Q58C 2IPKB 5AALA 2C1OB 2NCEA 5HHQB 4M61A 4R96B 2DEXX 3LRKA 3FS9A 3RWCB 2Q6WA 2ICWJ 1DE4B 3UTQB 4UUJA 5SWSD 5I6XC 2EVFA 4DK3A 3QXVA 2V7NA 2Y6SC 3L9EA 4YBHA 4GRLB 2YGPA 3FUNA 4HLZH 2B59B 2OTWA 2G5RA 1QN7A 1IGIH 1N5YH 3CCHB 1SFHA 3I75B 4NUJB 5EO0A 3PGFH 4AMKL 4XP4H 3S36L 5HYQA 1O6VA 3RNQA 4KQ0A 5FV1L 4OLWH 3WMPA 4H0GA 2XNAB 2OYMA 4ALAL 1E8XA 4KX9A 2YAHA 4KI1A 1FFRA 5GS2H 1NBVH 5FECA 5DS1A 3TJPA 2L7QA 3HI5L 3WEOA 1M6OB 3U9PL 4BELD 4O00A 3JWOC 4PY7A 1KB9K 2X4UA 4M1GL 3UTSB 1R4XA 4LU5H 3W0WE 4AOFA 2DTSA 4WX8A 1ZPLA 3WGUB 2RAMA 5ID0B 5C3LD 3HG4A 1PCXA 3PYCA 3I9IA 1D3CA 4DKFH 1AANA 2DQHL 3BH9A 3FYIB 4GMTL 2A77L 2JKWA 4CADA 4LSRL 3ZW3A 1P7KA 2QDWA 5EC1B 1MZZA 5JPNC 4XCFL 3Q8CA 3BD4A 4OCWH 4BKSC 2CIKB 4OD2B 3HMXL 2XHNA 3FUKA 3HOGA 5FFOA 4BJLA 1LE5B 5B8CB 1FWXA 1I8MA 2E0PA 1EEZB 3NIDB 2C7FA 2UVEA 3ALXA 3DDGA 1FV1B 5C3IA 2AQ2A 3RVUC 1EFQA 3BPNB 2Z92B 2BSED 2J6WA 4Y2NA 5J1SC 4Z76B 1UFGA 2YPKB 1PW3A 3LZPA 3DTXB 4HK0A 3WS3A 2FAUA 1C08B 5LGJB 1XXFC 1JS4A 1K6QL 3KXFD 5IVXA 1NCIA 1ZHNA 3H53A 5GRXG 2DJUA 3DPDA 2VDLL 4K8RC 2ZF8A 3OGCA 3K4AA 2G60H 5AB9A 3U2IA 5C09D 1MKFA 3MRLB 1A3LL 4IMLB 5JHDA 4JPVL 2EIJB 2KQNA 3SPHA 3IB4A 4YXLL 2YMTA 1RZIB 2VDPB 5CGYC 4NUPA 3MX0B 3OKKA 4JG5A 1DUYB 4P2QE 4Q6IB 4N0CC 3S37H 3LS5L 1HVXA 2P5WB 3IU4H 2WWKO 3FOLA 2YEVB 4Q4EA 3OAUH 3VCLA 4U1SA 4HJJL 2V2TA 2VLKD 1AQDB 3GC3A 4E41D 2GT9A 3D05A 2FUQA 4JFOB 4TLTA 4DTGH 1T83A 1U2HA 2OJEB 4YHNB 2PYEE 3VN5A 2WP3T 4FXGB 3LSOA 2R9HC 4KFMA 3KAAA 3SGJA 2YD7A 1TU2B 1QBLH 2Z4QB 5EPMA 4JFDE 1VESA 1A4JA 5LBVA 1PCZA 1CU4H 1RUQL 1RQ5A 3E8UH 2CO6A 5DEJA 3VSQA 5I71C 3V9FA 3GBNH 4DHLA 1JGUL 3WYRA 3HI1A 3RDTD 1CGUA 3C04A 5L9DL 1EJ6A 3IDMA 5I16A 4Y4KC 1OIOA 5E5UB 4P23A 1S9VA 5HHVH 1TMCB 1AKJA 1UJ3C 2H1XA 2C9SA 4LKCB 3QUGA 2ERJB 1ECZA 2N7BA 5GGSB 5T5FH 1WWAX 2VDPH 2UWEF 2Z35A 1HIML 1QI5A 2G2PA 4L5FL 1KFQA 4JM2D 3SPCA 1YEHL 3TC9A 3JXAA 3JTTA 2XWJA 4DUWA 4M48L 4Z7UA 4ODBD 3SZ6A 4Y9FA 4QKTA 4FC3E 1JV2B 1E50A 4LL1A 5KN5A 3PP4L 2LGNA 1H8OA 5DHYA 2V9QA 2F54B 3HCVA 3TM6A 1WBZB 3CZFA 2WLLA 4AYSA 1BX2B 1BW8A 3V0JA 4W4OC 1UG9A 3SGKC 3W57A 1NGXB 1J0KA 1T2XA 2ZAIA 1MPAL 1UWGH 2DBLH 5B39A 3HZYB 3PHAA 4W9DC 4YK4B 1VACB 2KHAA 4UTBH 4XXWC 3QORB 5FWRA 3QFJB 3O6ML 3N1FC 4U1NA 1JDCA 1E4KC 2RD0A 1NGWB 2WJ5A 3GRWA 4Z7VF 4ZMLA 3UW2A 3WFEL 1M4KA 1HQRA 3MI6A 4DOHB 1NAKH 3CX5J 1AR1C 3AW5A 3NSYA 3S5LA 4B9FA 5HPOA 4Q9QH 1OTSC 3MXWH 1ROWA 5IB3B 5J5EA 3E0GA 5I18H 3GXFA 1SUJA 2EXWC 3QI9D 1DDHB 3TH2T 4M62L 1J88A 1DZBA 1TJGL 2XIBA 2HRPH 4UQEA 4R8WL 4TRPH 5F21B 5EH1A 5G4NA 2BSRA 1A7RH 3F3HA 4PREA 4UDTA 3NZUA 3QDME 3VM7A 1B3IA 1UZ6E 2Q7NA 3ARXA 3RUGA 3EUUA 1LTXA 5E2WH 1FGNL 3O3UN 1T0NB 3N42F 5KJRL 1IC1A 1AG6A 2ADFH 3GSVA 5D6CB 5IV2A 1FZMA 2B9AA 3U46A 4HCIA 3GHPA 4PJ7E 3LH2L 1LM8V 3GFUA 3QIUC 4U1LB 1ACYL 3KZ8A 1PLGH 3QQDB 5C2UB 3O11B 3S48A 3QDGA 3CHOA 3H1ZA 5BCAA 3JTSB 4CW1A 1CQYA 4YDIH 3DDFA 1SVZA 1DQDL 1Z0NA 4N1CA 5KTEH 1KTDA 3VI4A 4EAJA 5IK3A 3VTTA 4AT6A 1TTGA 2CLVB 5JZ7C 3ESMA 2VW7A 5F1IB 2XWXA 1KYFA 1KJMB 2B5IB 2HG5B 4DGYH 5JW5A 1EV2E 2HRLA 2OQJA 4XPTH 3TV8A 1HC1A 4PRBB 4LLMB 3CFJA 2J44A 3HAEG 3HB3B 4P5MA 2NY4B 3KG5A 1IU1A 1P1ZA 2D3LA 5HVGB 4Z95L 2ZYIA 4CC0A 2E7LC 3MLUH 3UJTH 2BWDA 3AC0A 4MNQA 4LSSH 2CK2A 1X7QA 4WV1B 1QFUH 2FHBA 2W95A 4LNRB 4Q9QL 2DQEL 3NSCA 4FNTA 4KQ4L 5DLLA 5BVJB 3ISRA 3BLKA 2LFEA 3OKMB 4Y88A 2QL1A 1UD6A 3F58L 4PQXA 1NFKA 4GI8A 3UTTA 1L9RA 1T66D 3Q2VA 4J7RA 1UH3A 5D4HA 1TEYA 2FX8H 4G6FD 4U7KA 4X5QA 2VIRB 1XR9A 3PGCB 1GJIA 5HHOD 2X44D 1M71B 5HGHA 1CO1A 1C12B 1RLWA 1WFIA 3FU7A 4K3EH 2R2CA 3D25A 4NZRH 5D71L 4ZTPH 3DUSB 5GGRY 3UYPB 4AXWA 3BVTA 2DYPB 4FQPA 2WWOA 1KGCD 3BKMH 1E27A 1IQDA 2PP9A 4CL7A 2E27L 2A4ZA 4HMDA 1HH6B 4XZUB 1WE5A 3UG3A 3F00A 5E2UL 4OZIE 1KELL 2C9XA 1U91B 1YYLH 4XMWA 4TUJB 1BFOA 2AAVA 4XNXL 3TT3H 1SYVB 5IMKA 3GMLA 4C54A 2NXZB 5A7EA 1ND0A 3ETBF 3NCEB 1J11A 1YEFL 2D03H 4XO4A 1FL6A 2R0KH 2HG0A 1BD2A 2V8MA 5K59E 1IAOA 1T3FA 3MC0A 5E6IA 4YDIL 5AUMA 2P28B 1BWMA 1MRCH 2LTQC 3H3PL 4DEPB 5KTEL 2V9JA 4U6XA 2DI9A 1H3WM 3MHZA 2VSMB 5ESAA 4IS6B 3G5VB 4TPRL 3HZKA 5BRZB 2AFNA 3M1BB 3IRCA 1NQBA 4PW9A 2YPLA 2R1XB 3BZFB 3RZCB 4G43B 5DC0A 3VXSA 1VFUA 3LRMA 3ENEA 5EU5A 5ICUA 1YMMA 2ZT9C 2GJ6E 5EU4B 3RJDA 1F4XL 2XN0A 3LEYL 3R1GL 3X1BA 2XWTB 5D6DA 2ZX5A 2FT6A 4JCWA 4LESA 4F33A 3ULUL 1U8CB 2ARWA 3QB7C 2IH8A 2JJVA 5IB4B 4HLZG 4LARL 1EMTL 2OMWA 3GI9L 3PGDB 3SN6N 3NSFA 2OW7A 4OD3H 1CYXA 4UQIM 2EDNA 2DTMH 1P4BL 2JK5B 4W1TA 2OCJA 1MCWM 1KXVA 1FNSL 3K1KC 3IGFA 5CKGA 3DKHA 4MJIA 2YPVH 2RR3A 2UUDK 4JRYD 4RH4A 2H6PA 2IADB 4YLQT 2HCZX 5DZOA 3K3QA 3EW3B 3Q13A 1KXTB 4MB3A 4QYOA 4XCEB 4EI6B 1UCBH 4RRPM 1RZ7H 2WN3A 1CFMA 3CFQA 1JAEA 4N85A 4RFOH 2YGQA 3QJTB 3HW7A 2G75A 1JPFB 3PABB 3BKML 5I1GL 1BD2E 4LLAA 1R1CA 2CCWA 4D7RA 1GH7A 4I18C 2JJTC 2VLRD 1KPUA 2GK0A 4UIMA 3F84A 4Y0GA 3SDYL 1T04A 4HWNA 3KDMA 1OALA 4HFWB 3VXPA 1KMGA 5KSVB 5C0EA 4L3CA 5JIDA 3D0VA 2OSWA 2WBJB 4GO9A 4TSCL 2WYHA 1WIPA 3ZT5A 2XXFA 3FO2A 3KNBB 1EFXB 2XG5A 4QXVA 4PIRF 1FFOA 4DAGL 4OFQA 3TJHC 3FN3A 1PKQA 5I76B 1HL5A 2AJUL 2NDGA 4PLNC 1KPRA 1OW0C 3TH3T 3F10A 1U8NA 1T6VN 3ZR6A 2IC2A 2FEEL 4TNVK 2OAAA 4HVBA 2QT6A 3QDJE 2PPDA 4RODB 1XO8A 1XMWA 2VJ0A 4MJIE 5CBEA 3GRBA 4JO2L 1TGHA 5LBSA 4X7CC 4JGNA 5JXAH 2VWEE 2IH3B 5DA4A 5B3SB 4OD3L 2R0ZH 3MMEA 1QQDA 3RGVD 4BM7A 4U1IA 2VT0A 3KRMA 4KVCL 3O4LD 2WINB 4QI3A 1FNEA 2WUBH 1NGPL 2BC4B 4IBQA 1VEPA 3ULAB 2WMPB 3VI3F 2NYZA 1VFBA 3MLYH 2BNRD 2OL3A 3GZPA 2IDTA 2AC0A 1ZY9A 1LQSR 1FZOA 1E4XH 3GHEL 4NN5C 4P46D 5D1QB 5FK9B 1YEEL 2VXTH 1HFUA 1NCUA 2R15A 4PLKD 3C8DA 3GWJA 1JRHL 3QUXD 2Y5QA 4BFEA 3NA9L 4H8WH 1MCWW 1D5ZB 1LJMA 3QNXB 4ZFFA 1P4IH 5C6PB 3SE3A 2ZX7A 2VMEA 4IKLA 3CV5A 3FQUA 4IHBA 3MACH 1M2VB 3STZA 1PKQE 3Q6GH 3V6ZA 3ARGB 4WU7A 3QPQD 5KW9L 4Y1SA 1ZTMA 2FECL 5TE7H 5CU9A 4XMXA 5F7BA 1P9MA 3EIKA 2MOGA 5SWZB 1L5GB 3V5HB 3ZQ9A 2NW2B 4G9FA 2VITB 2YN5A 5IREA 4G9DA 5JO5B 2EECA 4NM4L 2FBJH 5E56A 1MY7A 2R4SH 4PJ9B 5D9SB 3ECQA 1WP6A 1T1ZA 3CZUB 1KCVH 3MR9B 4OLZH 3VFPA 1I3RA 3AM8C 3KPNB 2ZTBA 5HYSA 3PWPB 4LLDA 1ZTXE 2MPAL 3IFNH 2HT4D 3Q6FB 1OQOA 2XN1A 1PS3A 5F9AC 1G1OA 4EEEA 4HPHA 2YR3A 4HXBH 4PWGA 2YH5A 1OV8A 2R23B 3KHOA 3H54A 2ZAGA 4GSQA 1U8HB 1ZDQA 1ZLSL 3IMSA 3QO1A 3OCIA 3RVVC 1FHGA 3TT1H 5D7JA 2XN9E 1ZT4B 4ZUSB 3ZE1B 1A9BA 1MHPH 1KYUA 1U33A 3H42H 4HEME 5DGQA 4WAFA 2WXFA 2E6PA 2X3CA 3RTQD 5IW1B 1OSZB 1T5WB 3QULB 4KX8A 4G5AA 4AEEA 5IFJB 1JWSB 4PM1A 5F89A 4K5LA 4QOKD 1BXUA 1SYSA 4K3HA 2EIBA 1JV5B 3QNYB 3KLAA 4FNRA 4AUYA 3PFUA 4ANUA 4D0CB 3K7UA 5HJDA 3WD5H 3REVA 2VXTL 2Q5BA 2HT2C 4PSRA 1J05A 2DI7A 5FM5M 4MX7B 1N70A 3O4OB 2BY0A 2ZPKL 3OR6A 5EUKA 1S7RA 3GMRA 5GGTL 5IBLD 5L6YL 1QSFE 1BAGA 5D7LE 5LVEA 3MZGB 4G9FE 1C5DB 3EH4B 4E0RA 4RMBA 3RFZC 3DI3B 3VD1A 3PJSA 5INDA 1NC2A 1QLFA 3UOAB 3E6HB 5JIIA 1BVLB 5EIQA 3CK0L 1RUMH 4FYRA 5KZCD 5TE7L 5DO2C 1OAZH 3DSFL 4G6AC 2E6JA 2HPOA 3OKEB 1URZA 1RHHA 2FX9L 1INEL 1YYCA 3FTWA 4LCYB 3RIAK 1UWEH 1C1EL 5TDPA 4JN1H 5C0CE 2K3TA 2IXQA 2V9TA 2X3AA 2CHNA 4MJ5A 5I1KH 1P5UA 1MJUH 4ZX4A 1EWHA 4K23H 4KXZH 1HAWA 2NOBA 3JWOL 1E28B 1BIIA 2VDOB 2Y7QB 1J5IA 1BIHA 3BLBA 3NJNA 5LBGA 5FYJL 2FECI 4FQXB 2OA9A 4QAMB 1VEMA 1ZLUK 1IZKA 5IWLA 2X6UA 3ZGIA 3SE6A 1M42A 4JFHD 5F0MB 3LN9A 1ICTA 4QDGA 4YE0A 3IXAB 4N5EC 1PCMX 1BQ5A 1KEML 3B43A 3PL6B 4WO0A 2I7SA 3CZGA 1OP5H 1RFDH 2ZOKA 4JY5H 1FHNA 2ZKHH 2DIAA 1BZDA 3FB7B 3TV3H 1HH9B 1KUMA 2V17L 3EF7A 4PB9L 4UQDA 3F01A 3HC3L 3BGAA 1QEWA 3AT8A 5E6YA 3QNFA 1XL6A 1VCBC 1XH2A 4X8JA 1J0JA 1QW8A 3EHBB 4FQJL 4WHYH 3NFSH 1SEQH 2J8UB 1F6FB 4OI9A 3PHOB 1ZPUA 2VDQL 2ODIA 2C9PA 4HIHB 5IFHL 1JZEA 4R4BB 1QWUA 1MHEB 5D1ZD 4EIBA 2EP6A 5K9KA 5AVQB 4K8RL 1T6AA 1BBJB 2VDOH 2YO3A 5DFVC 3AG3B 5E8NB 5CD5D 3EJYC 1BXVA 5AW5B 2P5EE 3B9KC 1G94A 3L7FB 1W6WA 5HYEA 1IKFH 4BKLA 3U6XA 3A6BH 4H26B 2MSPA 1TSRA 3PAYA 4GH7B 4LQFL 1TCRB 4AM0A 4P4KA 1WSST 3NIGB 4HWZA 4XI5D 4AEIL 4MFHA 3H3KA 4GBXB 4NRXB 1I1AC 2KZ1B 3QUYA 1G9HA 5E5MB 3A6OA 4XNZB 1BZ9B 3DX4A 3DPUA 3G08A 5FHAH 3T0XA 4W6YB 5B3JF 2E76C 1Q0YH 3DV6B 2VABA 4MCMA 4LCCB 4NZTL 3LKRA 3DSNB 4HSAC 4ABVA 1NLDL 5BUAA 5DDHB 1XBRA 1XGPB 1KCUL 3EYVB 4JQXA 4Z0BL 4LCVA 3T6ZA 1D7BA 4AQ8A 2JKTM 2B1OA 2B2XL 1L7TL 3GJEB 1CE6A 4JO1L 1NBYB 3OKNA 3EDDA 3PDDA 1R5IA 5I73B 1BOGB 4MCYA 4AGLA 3NJVA 4YL9A 3U2SB 3VWKD 1H5BB 4LSDA 1RFDL 5F44A 4KZDH 1I1RA 1CURA 3UZVB 4UTAL 3CDCA 2CCLA 2DKCA 3FSZA 3ME0B 1RK0B 1T4WA 1RCYA 2Z8RA 1GL4B 2OLDA 2BDNL 1YN7A 2EC9U 4TNWK 3MV11 1UD5A 3K0WA 1LL1A 3UTOA 1RAMA 3EFDH 1YEIL 5KBDA 4LF3B 3RY5A 2FK9A 2PP8A 5F1NA 3X1NA 1R75A 1IM9B 3QHFH 1DBJH 2M26A 2YUVA 3KE0A 3O9WA 1U3HA 4M6ML 2QHLA 4P2AA 4R4FL 5CEZL 3X11A 2QBWA 3ZX1A 2HWZH 3QWRD 2A73B 1R0AL 3OH9A 3GZQA 5F96H 3RWFA 5ITBH 1AQ8A 5I0VA 1XT5A 1H8SA 1G4MA 1U4FA 2UWEA 5F1KC 4MBOA 1S9WA 5C92A 2JKLA 4K7PL 2CKBA 3TEUA 5KOMC 4Q0XH 3IU3B 1EBAA 4YQXH 3G5XA 2ATKA 3ARBD 2EDYA 5D72L 4O02B 5ITFA 4XWOD 3MOAH 1MHCB 4JY4B 4TOYH 3LHPL 3BZEA 1CYWA 3IF1B 4Y9CA 3S4SA 4PI0A 1OANA 3B5GA 3DYPA 2OR7A 3MZTA 4ODWB 5TDNB 2UZYB 1ZK5A 4UF7C 3C2SA 4K4KA 1MREH 1IBGH 4YZWA 1HQ4B 3KD4A 4X7EC 4FFVC 3TASA 3R0NA 2CJSA 3WENA 1BJ8A 5C07A 4P5KA 3JV4A 1S7XA 4KK5C 5ECJE 4FXKB 1EQWA 4RGNC 3P9WB 1FL5A 3D4VA 1B0RB 4Z7VA 3T4AC 3EJCA 5F3HB 2FCBA 2GBTA 3ABZA 5KVEE 4RMRA 3EGXB 1AZNA 3CPLA 2FR4B 2IOIA 3V4UL 3L4CA 3N9GL 2C3VB 2KLRA 1S5HA 2YS4A 1FNGB 1TZIA 4P2YA 4HC1H 4UANA 3UP6A 4YDJA 2ADJB 3FAXA 5BJTA 5DK0B 2DICA 1UXWA 4I9XA 4KI5F 2XA8L 4MAZA 1XSIA 2GTQA 4OZGE 1YNLL 1JHKL 1N3AA 1QRNA 1EZVY 1VFMA 2GITB 3DX6B 2IO5A 5IB1B 3KWWA 3MV8B 4HETA 2Q9OA 4O02H 4WZSD 3EBIA 4BYHA 5C0RH 5BPPA 3WIHH 4AENA 4NBZB 3VXMD 4XVJH 3L5HA 4XR8C 3BKQX 2WBKA 3L16A 1JI1A 1I53A 4N8VB 5H37H 4C4BA 1ZT7B 2CO3A 5KJ7E 3HFMH 4IDJH 4P57A 2OP4L 4WENB 4L8DA 4KTDL 2IAMD 3SCMC 1SF5A 1BQLH 3UBXB 4N87A 4LEOA 3ZRCC 3KW7A 1FNAA 4MD5A 2C3XA 2OW6A 3GJFA 3W56A 1R3KA 1RV6X 3OHXA 1T6BX 1RZFL 3T65A 5DRNB 5DHVA 3MOAL 1K35A 5DJ8B 3MBEB 3UROR 5C07E 4APQB 1JMXA 4R6UA 3NP4A 3W1ZA 4YH6A 2FX7H 1EDQA 3U4EB 2R0LL 4Y1AE 3VFNA 4P3DA 1FZJB 3ZLQC 4PP1D 5JHMA 5JW4Q 3NN8A 2A9ML 5TPWH 3SGDI 5IROD 1C5BL 3MUZ1 4M9OA 4FZ8L 3F5WB 3TA3C 2ZXDA 3DPBB 2PP7A 5EOQL 4XCNB 1E5AA 3WKNA 3WIIL 5DHEA 2GJRA 4Z3IA 4O2FA 1QBBA 3LEVL 3QUZD 2O1AA 3BUTA 1K8IA 4R7NB 4V1DE 5FF6B 5IF0A 3O6LL 5GRVL 4HCRL 1JNLH 5KBMA 2Y06L 3W82A 3EFFB 3LNFA 5D96C 2CO7A 4KK6D 4OTXH 5DMIL 2OMVA 1MVUA 3OX8B 3C6SA 2XJLA 3NVQA 1E40A 1NBQA 3T4NA 1G9EA 3E6FA 1KNOA 4OGZA 5AKVA 5E5LA 2BRRL 3VXRA 2MZ8A 2V6HA 3DGGB 3KH4A 3UIYA 5H4ZA 4YX2L 5SWSB 3NPZB 4BV1A 4RMWA 3II2A 3ZDYE 2ZCZA 5H2BA 4Y16A 2ATAA 2ORBH 1IBZA 1QWHA 3IDIA 1LILA 1OGTA 1VFAB 4HKBA 3SD5A 5DI8B 4LIQE 3REWB 3V6OE 5TGBB 1RPQA 2AITA 2XBZA 5GQBA 3TX4A 3PE9A 2EDTA 2M2DA 5HJ3A 3VSUA 4GW1B 5TH2A 4DKAA 5AVSB 4MJ6A 5FYKH 4G8FA 4N28A 1V27A 2Z31D 3ZRFC 4E42A 1SEBB 2EE3A 2G3XA 3OR7A 4Y4FC 2JJSA 4QRUB 5HHPA 1B2WH 1LO3H 2J88L 3D51A 4ZMXA 4NKOA 5DUPH 2YBRA 3M8OH 3MDJA 4AEFA 2CAKA 1LEGB 4KHTH 4MCZA 3T4YB 2OJZL 1Q9UA 4WEEA 1NINA 5KYUA 2XYCA 1J12A 2AXHA 1FO0B 2MTPA 2O5NA 2B39A 2F7QA 2V2WA 3SBWA 1DO5A 1J0YA 1AD9A 5CM1A 5TK4A 3ESPA 3FL7A 1U4EA 4N90D 4PJ8C 4JFFD 2ZP0T 4GIOA 3SE8L 4FJYA 4MNHA 5HVHB 2LR4A 4YDVA 1I9EA 5DK2A 1D9KD 4NN6B 1E2WA 3TYFA 2XRAH 3QWOA 1UL7A 2XTJD 5E03A 4UOQA 1JZJA 3BKCL 3EGDA 4PTTA 5GIRB 4ZBJA 4NQUA 3QK0A 3D48R 2X4SA 3I9GL 2XG4A 5IVZB 3KVDD 3FHEA 3BPNC 4NQDD 4PGCA 2WLMA 4UM9D 5F9WB 1NBCA 1Z9MA 4BQCA 2DDQL 2VZUA 3CFDA 1OAXH 1YNKH 1VF5C 3U9UA 2BSCA 4GIAA 1YC7A 5D1XC 4FQQB 2VUYA 1GY1A 3KXFB 5C71A 1V8HA 3FQXB 3LKNB 5EN2A 5L88H 2FATL 2NXYC 4PJ5D 5E0QA 3VD9A 2ZWZA 4D2NA 5CF3A 1DBMH 4JKPH 4OIBA 1QI3A 5C09B 4BZ1L 4WW1A 1AO7E 3B3BA 3C87A 3L3OB 4HIXL 1UM6H 3AG4B 3BQUA 4M7KL 1E9QB 3IFPB 2YGOA 1O6SB 4JPQA 3HPLA 4WHYG 2HKHL 2WAQA 3OV6A 3LRGA 4J8QA 4HFUL 3L6FB 4PRIE 5I5JA 5B4MD 1KIRB 2NUPA 4JDZA 2XX0A 3FSWA 1KB9J 1P7QA 3E2HC 5DO8A 3TIDA 7FABH 2WVTA 1A3RL 4W9JC 1DP0A 2VLKB 2X2IA 2YKLH 4PLJD 5IQMA 5E99L 3HS9A 4ECNA 4L3AA 3M8OL 1W0VA 3TU6A 4E41B 2ITDA 1KY7A 1N6VA 3CDGB 4HULB 2A74C 4PW3A 4FXGC 2YHGA 1DL7H 3PREA 5FWQA 1LWWA 2WVVB 5BUPA 1MUJB 3RVTC 1HZLA 1J8HA 2IJ0C 4G8IA 4QNPE 1A3QA 4I1PA 4JKKA 4YAQB 5ABDE 1YEJL 2J72A 5LCVL 3EO9H 5GS0C 2X2HA 4QHLA 3G5WA 2J8OA 4YEEA 2BP5M 1MCJA 3TCXA 3LVEA 4PBDA 4CDHA 2Y8LA 3NESA 3RDTB 3HMWH 4BFKA 2FO4B 5HDOA 5JR1L 3S2CA 3BDYH 4OKDA 4EMZA 1U92A 1P5VA 5CZVH 1QKZL 4LP5A 1WFOA 2ZYHA 1R46A 1HILA 4ADGA 4PRPE 3VI3A 1FGVH 1VOKA 2X4PA 3NZSA 1XSJA 5ISZA 4MS8C 1T0MB 1MI5A 4JM2B 4AJYV 1MCOL 5AYQA 3BSZH 4I2XE 4HLJA 3WFHB 3QJUB 3PS6A 5C0BE 2XDHA 3MLWL 4Y2DC 3IJ9A 1FAIH 3UMTA 4KQ3H 1UEMA 2IWKA 5AD0A 3WY1A 1HEHC 3UAFA 4ETQA 4BFNA 3KPQB 4K7FA 3GB7A 3WGVB 4ZW3A 4JREC 4HPYH 3KYKH 4YFDB 3W38A 2HKFL 4WIQA 3IGAA 2IDUA 3H4HA 3DIDA 1NTDA 1U3YA 2WNWA 3ET9F 4HS6A 4AIEA 4BZ2H 2APFA 4CSSA 1MCLA 3D30A 2X6MA 1SBBA 5INCA 2R69H 1UB6B 3KLDA 2DQ6A 5F9JB 1AGEA 3QSKB 4PBWD 4A55A 4PJEF 1LNUA 3P30H 4G3YH 2AJ3A 1WZMA 2UX6A 1J1XH 3VUAA 3PV7A 4YR6A 3P1VA 5F6HJ 4HMCA 3QI9B 3MCLL 4TUKH 4DN3L 1SHXA 1XVSA 4ACPA 4Q6KA 4CSTA 2APSA 1GA2A 4PMEA 1CD8A 2OS7A 4FJZA 1UD2A 3TA4D 3VI3E 2YAOA 3W11C 1W0WA 4P5TD 4B50A 1HJCA 5CEXB 1R9FA 1F6LL 1AGDA 3VXQA 4MJ2A 1QPXA 3KEHA 1MI5E 2HTKD 4WWPA 1XEDA 5AZEL 3UERA 4EBQH 2ZXGA 2MIZA 4QWWD 1ZLDA 2VDMB 2F68X 4C83A 4DPRA 1ZSHA 4LLUB 5IQ9B 1RL1A 1U58A 2EYRA 4F9PA 3O8XA 4WJ5B 4NZUL 4WNQB 3DTDA 4F57L 1ZDSA 3NQIA 3FCGA 5JYLA 3MJ7A 5EOCJ 2IBZX 3II1A 4LLYA 3KVQA 4HV8B 1MCPL 3WL9B 4X8XA 4IGBA 2DIBA 2H3NB 1L7IH 2AV7A 1DYZA 3GKZA 1MFBL 3LV3B 5HBBA 4F8NA 3W0WD 3IWVA 2JKNA 3QIBC 3D39E 3HZMA 2WOYA 1UACL 1RIUH 1I8AA 3AITA 4RGOL 5CHNA 3GINA 5KVGE 5T3ZL 3MBWB 1IB5A 1DFBL 2MNWA 1UD4A 3QNZA 4WHTB 2YAFA 4QEGA 3DETC 5I23A 2EJ1A 2ATPB 2GVYA 4L1DA 2BOBB 5TFSL 1XIWA 2V33A 2MCAA 4X5XB 5A2IH 3KBEA 1QWNA 4GG6B 2YOAA 2O5YH 4L4TA 4OIFA 1KGWA 1ZANH 4U3CA 3B5HA 4MZRA 2KDYA 1ES0A 2Q8AL 5CJQL 2Q0ZX 2VDMH 2APXA 1R3HA 4JPWH 4HUCA 3TVMA 4IBUA 4WWKD 1YQMA 4G59C 2FUTA 4XOCA 3D6GA 4CSZA 1WEJL 2HFEB 4G6FB 2N0KA 2WXLA 2QFRA 2W9DH 2X42A 1NIFA 3DJTA 4X6EB 3CIQA 5HHOB 3OKOB 5TE4H 4M6OH 2R7EB 3SZKC 1K5NA 1T20B 3AXLB 3PV6A 5KS9E 2XV2A 4DZ8A 1CFNA 1KTJA 2R2EB 5FO7A 4FXTA 1UOLA 5ALBH 2D0CA 1D6EB 1G5GA 2JV6A 3A0OA 4P2QD 3T1FA 4E9YA 5ILTH 5EC2B 1AHMA 4RISH 1I1CA 5DJXB 3O3DA 1MEXL 1XTLA 2M83A 3LIZH 1TEFA 2F7OA 4ZSOA 4TF4A 4ZTEA 3MV7A 4G6JL 3ORJA 4N8VG 5CJ8A 4MLIA 4EUPA 2PYED 1JF5A 4I7ZC 5GGUB 3DECA 3TEZA 3LQAH 4YHKH 2C9QA 3U30C 1LEKA 1TVBA 3UBXG 2UVFA 2IANA 5T3XL 2GPZA 4CKQA 1N0LB 1F6AB 3Q9PA 2YRZA 1NSNH 2XPYA 2ENJA 3L4YA 3ZTJH 4ORGB 1KIQA 1YECH 1NL0H 4OFDA 3ULVC 4R4NC 1CQKA 2IPKA 1O7SA 3DURB 5DWUH 3IM1A 3QEHA 5FFGA 4R96A 4Q6YA 3RWCA 2PWWA 2K8MA 2RJMA 1DE4A 3UTQA 5JOEA 4GRLA 4ZJ9A 4J4PD 4C7PA 1WBXA 5SX4I 3CCHA 3I75A 4MZIA 5DRZB 4WTXA 4JDEB 4JRYB 2QTEA 2Q8BL 2JTYA 4K2UL 3QXDA 3IVKB 4N20A 2W9LA 5J6GB 2RIKA 2OMTA 1C47A 2VB5A 3GK8L 3PJNA 4LSUH 5IFAL 2GSIA 3JV0A 1QN6A 1OAUL 5DJ6A 2NSXA 5E6ZA 3T0WA 1OZUA 1QYGL 5FGCB 4FULA 4ONFH 1SJMA 1UXSA 5DJCB 2W0PA 4KKBD 2VLRB 3AQYA 4HT1L 4RMQA 3ZKXC 2C1PA 1TQCB 1Z5HA 3FT3B 4OVUA 5I1EL 3OB8A 1YC8A 4M02A 1HZKA 3UTSA 4HS3B 4JHUA 1LO4H 2Q86B 2QPEB 3RLSA 4UOJA 4YUEL 1R3JB 1E42A 1IARB 2N0MA 4G71B 4NZFA 3ZKMD 3LS4H 4NQCE 4XAWH 2HA1A 1S7VA 3SSGA 2Y69B 3F7YA 3P11L 2IANE 1JNNL 2GW5A 4JFQB 1IUZA 2EIMB 4ZO9A 3O3BA 1BEXA 2IGFL 2IWEA 4W6XB 2XYBA 2E47A 3C6LD 3GMQB 1E30A 4NUQA 4FZEL 3T0EE 1IIKA 1JWUA 1PJWA 4JCLA 5B8CA 4PVMA 5BO1H 4NAMA 5I19L 1EEZA 3CFMA 3TBSB 1LWJA 3OD3A 3NCYP 2GUYA 3N1QC 4P23D 4XNUL 3UZEC 1CFBA 5MERB 1PX3A 1AKJD 3RYMA 5DZLA 3CZKA 3QDMD 4EIZC 1YQLA 2X41A 1HYRC 4N9OB 5C6TL 4RAUB 4NNXA 3DYOA 3EJQA 2OTUB 2LU5A 3FC8A 4RWHA 1A2YB 1C08A 5LGJA 4L5FE 5CFHA 4LDCA 1YN6B 3RGVB 5DXWA 2LW3A 4GRMB 2RCSL 3HBGA 4F91B 1D2OA 3O4LB 3WKYA 2HTLC 4KKAD 3ZY7A 3PAUA 1GHFH 3MRLA 3MBXL 4P2OD 4CU8A 4IBWA 2BNRB 3ZDXB 2RGSA 4GW4B 1OM3H 5T5FA 4LSQH 5AB1A 4P46B 3MRQA 3W2DH 5L2KE 4Q6IA 4KKNA 2BVPB 2YC1B 2HVJB 2P5WA 3BD3A 2J56A 3QUXB 3VXNB 4KRLB 4PJXB 4DVRL 1WBYA 4EJYA 1CFQB 1EO5A 3CQPA 3BWUF 4WTWA 1X3DA 5JORA 1AQDA 1YMHB 2BWIA 3WBDA 3FH7A 5M94B 2VJ8A 2XV6B 3HKZA 4JFOA 4LCUB 4D7PA 4AKPA 1TJHH 3HTLX 3AREC 3J7HA 3T0DA 5C70A 1GYVA 3WFCH 1FYHB 4MD4A 5C0JB 1AOZA 1F4YH 3WUWB 5GSVB 2YA3A 1D5IH 4K0OA 4EZMA 2Z4QA 1G7HB 1KIPB 4UTBA 4KRPC 2P24B 5DD1L 2HFGH 2WWMD 2R5XA 3FQTA 3RWDA 2JI2A 3BIBX 1G0DA 1SMDA 5C97A 4QRRE 4FTDA 4KJPD 2TRHA 2ZG3A 1ZD6A 1V55B 1I9RH 4GQQA 4HPOH 2DY2A 4NDMB 1EJ8A 3ECBB 4J2QA 1HS6A 4N8PA 3MLPA 1MRDH 2F8IA 3MODL 1SJVA 2AJSH 1WFTA 4X6DB 4NQQA 1GSMA 3DYMA 5T1DL 2NOIA 5FAAA 3QDGD 1QI4A 3HIZA 5IBTL 2QMKA 1MCNA 2Y22A 5IHZB 1S7SB 5DJYA 3OJMB 1L9NA 1AHWA 2A4EA 4GW5B 3SKJH 2GFBB 4OGAD 4KKRA 1K9TA 3BCDA 3RTQB 3WLBB 2WBWB 2Q76A 2A4CA 4PB0L 1LDPL 4JL2A 2DLEA 3EYOB 2H8PB 5F7YC 3RX5A 1WBZA 4EF3A 1YYMH 2X1QA 1P2CA 4KZEL 4PJBB 3RVWD 2ZUWA 3P0YL 1XDTT 3QJFB 4J3VA 5ICZA 3L81A 1DBAH 3IPFA 4KI5E 3VRIB 1NGXA 2HYMA 2BJMH 4QRAA 3S5ZA 4FD0A 4XX1E 2NNFA 2PTVA 2WXPA 4Z7WB 1TLKA 2D0GA 2HJFA 5DVLA 1NGWA 3MYJB 2CXGA 1PNDA 4P99A 2DQGH 1Y1DA 3MV01 4MNQD 5D70L 2AABH 5IJKA 4X4ZA 4WEUD 2GJ6D 3KJ4C 3MREB 2HUHA 3LZRA 3BYYA 1DDHA 2WOBA 2F58L 2D7TH 3HC0B 5FYKU 3HS0B 4P49A 5I74C 5KZCB 1F1GA 2J1WA 4GKOA 1AACA 3OGDA 2NOEA 2CLZB 5D93B 4TSBL 2EDRA 3UYRH 1NLBL 2HFGL 4M93B 4W93A 4LSVL 1EZVX 2A1WH 1JNHB 3IMRA 2CCVA 4ZMTA 1JGLH 1BVKA 4HJ1A 1T0NA 1KLFA 1OSPL 1IKNA 3CXHK 4GS7B 2BO0A 3O0RH 4G7QB 4CFFA 2GC7C 2V9RA 4KVPA 5HY9B 4AG4L 4HAKA 2D9CA 2Z1KA 3ULSB 3RY6A 1DUZB 3TWYA 3OKDB 2K6WA 3QQDA 2W0KA 4UZUA 5JXEC 1A1OA 3QCTL 3QZWA 3OHMB 5TQ0H 1D3UA 1BD2D 2AHIA 2Z8UA 5EFIB 2GAZB 35C8L 3F12B 4RVBA 4UT9L 4ZDHA 4NO0D 4Z3FA 3EO0B 3FT4B 3OAYK 5F6IC 2GTWA 4GJTB 4BA8A 2R56L 2R0WH 3FNKA 3RILA 4KO5A 3BCFA 1RURH 1SXCA 3QXAB 3V7AG 3BPOB 5MEPA 2WTPA 4W9KC 4I3GA 1GR7A 1Q8MA 1TLMA 3W81A 2YPLD 2IOOA 2HX9A 1OCWL 32C2A 4YBLB 4PRBA 4LLMA 4C57C 4F3FA 3KYOB 1P0SE 2J6EH 4OAWB 2F1EA 2JQAA 4PJGE 4M8QB 2QSCH 2V3DA 5D1ZB 5FR3A 4P9HH 2NY2C 3TN0C 1FG2B 2OKMA 3WHE0 4S1SL 2WB1A 3VXUE 3BAKA 1T21A 5EBLB 5I1DA 2QPSA 4WV1A 3WFZA 4LNRA 3ZYJA 3ISWA 3ULUE 3GTNA 1KFGA 3ASMA 3FU8A 1SN5A 5HDBB 3LMJH 1OT1A 2LLNA 2Y72A 1F4WL 3LZLA 3OKMA 2YD3A 3FFDB 3B2DC 4XRCB 1EJOL 3J8F7 4POUB 2NY7L 4MJID 2HPTA 3IGKA 2VIRA 2DWEB 3PGCA 2IV8A 1M71A 4LVEA 1ZA6A 4UAOC 3V10A 2NLVA 3UYPA 1CL7H 3DUSA 3QJHB 2CRYA 1J9RA 2X05A 2DYPA 1HSBA 1CD0A 3VJ6A 2G9HB 2YWZA 5AG9A 2C34A 2OK0L 3O0RL 5K33A 3IMTA 4L8SB 5CLZA 1RK1A 5GGRB 4BSJA 1ODUA 4JMNA 4XPFH 2D3JA 4OR1A 3GYRA 5GS0L 5I73C 3I6SA 2F8XC 4XXDA 1NUGA 3NG5A 4M7ZC 1J1PH 5G5DA 1AXIB 3LB6D 4PU2A 1H5BC 3VWKB 4XGZB 3HE7C 3EG9A 1UZGA 4OLVL 2Z7UA 4M9PA 1G7QB 3Q2NA 4FKKA 2GHZA 2W80C 1E9OB 1JXFA 3BZFA 2APBA 1SQ2N 1DQVA 3L13A 2X6AA 3Q3GA 1MAMH 3QEUB 4G43A 3CD4A 3N40P 3U6XS 3WFBL 1GGIL 5EU4A 4TLSA 1EGJH 2MH4A 2XWTA 4I0PC 4FP8L 1CFSB 1Z1WA 4RDQG 2LLGA 2OZNA 2AMUA 2Y25A 1Z66A 2PR9A 5IEKB 1UCTA 1WA0X 2E5EA 2WY3B 2QTVA 4YE4H 4JKMA 2QADD 1TZGL 5MEQB 3HPJB 3T8XB 3UC2A 3E3QC 3MGTB 4Y19E 4EO5A 2HX7A 2BS8A 3GSOA 1RU9L 4NHCH 2HH0L 5E95B 3BP5B 2JK5A 1KJ2B 2AEQL 1L3NA 3QRGL 5KYXA 1UEYA 5CIPB 5EU6E 3NAAH 5KVDL 4RQQB 3ARBB 1PDKB 5AOZA 2IADA 3PIQB 2JIXD 2XN9D 2EEFA 1KBBA 1THAA 2ED7A 1LO0H 2W59A 2XKNB 4QRPA 4XCEA 2NUTA 4APXB 4EI6A 1DVFD 3HJ0A 3RU8L 1BEYH 4LPYA 1PD1A 1CL7L 5DRXB 4TUUA 2OMZA 3PABA 4OUUB 4M1DL 4Z78B 1NAML 2CHXA 5IT2H 2I5WA 1U8MB 4Y5YB 4KMLB 1S9XB 2P49B 2P45B 3OLGA 1OF0A 3APCA 4K3DH 1GC1H 2P5PA 3FKUS 1N6UA 4H13C 4U6HB 5CJBA 5KSVA 3EYQD 5I8CA 3OSEA 1PIGA 3MA9L 3ARDC 2WBJA 3C5SB 3V6FB 2X6VA 5GRJH 5EORH 4PJEA 1XZWA 3NFPB 1QSFD 3MJ9H 5D7LD 4BKTC 1SY6H 2R2BA 2WIIA 4U3XA 3EOBB 2WQVA 4G9FD 2VR4A 5AVVB 3KCPA 3K6SA 3MJGX 5GGTA 2EDOA 4NKIL 3LXUX 2NNCA 5AENA 4OF8A 5J6HA 5I76A 2F18A 3BVXA 4HK3J 1A7NH 4O4YL 3QH3A 1KJ2H 3KBFA 4HOXA 3C09C 5CIPH 4YFLF 4U7MA 4PG2A 3G3LA 5FUZH 2F5BH 2XWBB 2XWRA 5IEHB 3P3TA 5C0CD 1NH2A 2FTAA 4S10A 3VXMB 3NH7H 1QATA 1HZHH 1SXSA 3MU3A 2Y24A 3M1CA 1QNZH 4MB5A 5D7JD 4XMLL 2DEWX 4IOSA 1IQWL 5ENWB 5KL0A 3KBPA 2IH3A 2IAMB 3L54A 4BFFA 3FQWB 1YLBB 2IG2H 2BFVH 2VO5A 3WNLA 5EUOF 5LWYH 1FA4A 2YSTA 3AVEA 4KFZC 3RNKB 4FNLL 4XOAA 3WXWL 1JHLL 4GB9A 1JFIC 3AS3A 5D5ME 3MBEC 1LO0L 2AANA 2XXGA 1AG0A 3BP7A 2PR4H 3CDYA 4IRSB 2E56A 4KAQL 4N0FA 5FW8A 1MW0A 4JM2F 4HHAB 3C60C 4JRLA 4J1UB 2PXYD 4N8CL 1IGML 2L04A 3QHZH 3V4VB 2PMZA 2ETWA 2FWLB 4DP8X 1RY7B 2FLMA 4A67A 4B97A 4PJEE 5BNXD 4FQ1H 2D7QA 2W91A 3ZBMA 3KDPB 3ISYA 1U8PB 2YXVA 1X5HA 4JDTH 3VSVA 3CLFH 1SXZA 1U8JB 2OX5B 5LB1A 5M7QA 2MNJB 2PPEA 3QUZB 1NC2D 3ARGA 2WAHA 4IJ3C 4V11A 3CFUA 3FQRB 3BLPX 3ZDZF 4L37B 1NCDL 2JKSA 5CZXD 3V5HA 4HBCL 2NW2A 1AZUA 4FQCL 5LG1A 4A7SA 3IFLL 1Q72H 4JFXB 5AOIA 5JO5A 2OSLB 2CMRH 4HA1A 2P5ED 4OJFH 4PJ9A 1LD9A 1L9SA 3AWFA 3MR9A 4U3HA 5E70A 1FI8C 1ULVA 4AV5A 1CMOA 3KPNA 3IK2A 3S34H 3MAWA 3PWPA 3ROLB 4HUWB 3Q6FA 4WUKL 2LAAA 1TFHA 2XZAH 5FYJE 1G9MC 2R23A 1G1CA 5DS8A 1U8HA 1RZGB 3L1GA 1S9KC 3BT2H 2Q1EA 4TULH 1KLUB 4WWID 4ZMNA 1X9QA 3V4VH 1ZT4A 2VRQA 1F8TL 3P0VL 5FKPB 4ZUSA 5F7UA 4GQ9H 1EHKB 2HB0A 1BZ7B 4QHNB 2NZ9D 3QZPA 4F2MA 3BAIA 4PJCF 2N3JA 3WUWG 1OSZA 1T5WA 2QQLH 2Y7NA 4Y9EA 2XZQL 2H4EA 2BP0B 4XP1H 2Z31B 1AMXA 1PYWA 1JV5A 3QNYA 1KBVA 4D0CA 2ED8A 1MFDH 3CVHB 4YDKL 2SEBB 4N2NA 3ULVL 1CJYA 3C8KA 3FCBA 4GAJL 2NR6A 4JFSA 4MMYA 1JN6B 4MX7A 2DQIH 8PAZA 12E8H 1HHHB 4LASL 2MCPH 4DN4H 2QHRH 1J87A 1JVKA 1OAKH 3TBVA 2JOIA 1SM3H 2XCMC 2CU9A 4IRZL 3RWIB 5F93C 1L9TA 3DK2A 2J1KA 1IFRA 2RMNA 2ZUXA 1A6UL 5F3BB 3N40F 3GBMH 2A6JB 4GT7A 4JFFB 4G42B 1WHPA 5GHWH 4MHHG 4YXHL 1HEJC 3OC5A 3VB8A 1KENL 2EEXA 4D7QA 3LEXB 1RUPH 4NN6C 3KWVA 4P4KD 2FQFA 3ZJAA 4LCYA 1TENA 2XTJB 2CUHA 3BKYH 4OLXL 1WT5C 1KCRL 5FYLD 5CCKH 2FRGP 4X6FB 1TEGA 4KKLC 3IBEA 3X1FA 3QAZC 1E28A 2GI0A 4NQDB 4GG6F 3FCTA 3RVXD 4UM9B 3DVNB 5JNYA 4X6CB 2X87A 4Z8FL 3F7VB 4FQXA 4W4OA 4DWHA 4LBAA 1C7SA 5HDLA 1L4IA 4F15B 1KFIA 4F2ME 2DJ4A 3PG2A 2TRYA 2BSTB 5I8KL 4EOWL 3CVHH 3B2PA 1EERB 1GOFA 4PJ5B 3SODB 4XXWA 3QJQB 4QRSB 3OBAA 1H3TA 3D69B 3UAAA 5E8DL 2IALB 3L3OC 3FB7A 2BVOB 1HH9A 4WKZB 1Z32X 1GGTA 3KS0J 3NZ8B 4PN6A 4TMPA 5B1JA 1EEYB 4GYBA 4D94A 2YK1L 1YJDH 2N59A 5MP6H 2P1YA 3HBZA 4JO4H 3G5ZA 4J3XA 4XNYL 3S88H 4ZFQA 4WGVB 4QXWA 3BGFB 1ZXKA 4F27A 3MFGB 4OM0H 1DJIA 2ZOLA 5SX5K 1OO2A 1EXGA 4OCRH 2FGWL 4OJAA 2CDFB 1DJGA 2Z7ZA 3EAYA 1BQKA 4HIHA 3MKKA 3QPKA 3VXTB 3N04A 1U3HD 2F53A 1MHEA 2VDKL 3QO0A 1QHQA 2XV3A 4JG1H 4Z3JA 4HUKB 3ROOB 1DVYA 1A6PA 2QLVB 3RX7A 1UOWA 4TUOB 2A6KB 3GMPB 4HU2A 4JFPB 4MNGA 4NN7C 1BBJA 2W38A 1TTFA 5CEZE 2IQ9H 5E8NA 2I5YH 4LKXB 1GIGH 3KJ6H 2F5AL 1BHGA 3QIUA 4PJDE 3U83A 3V4LA 3U0WH 4OCXL 2Z8SA 3Q8FA 4H26A 1T1YA 4JFEA 1EH9A 2BIMA 4AIOA 1TCRA 1AR2A 2V7HB 2XU9A 5TE6L 2L3BA 4UZGA 2IGTA 1EZLA 3LKPB 4ONHB 3VX1A 2ENQA 1M7IB 2DQCL 1BZ9A 3CBRA 3GUTB 3DX7A 4RBPK 5AOMA 1SLUA 4S1DD 2I69A 2FZ3B 3RL2A 1KTLB 3P4NB 2QVTA 3QS3A 4LCCA 5E7BA 2TSAA 4AI7A 2IQAB 2EYTA 2ZP8A 5DDHA 1QFOA 4Y9BA 1NCJA 2DQUL 1AFVL 3ATEA 4DPCX 1RULL 1J86A 4DKTA 5C07D 1NBYA 1FUNA 4Y1AD 2IDCA 4A2LA 2FYYB 4CN1A 3U2SA 3FZUC 2Y7MA 3EYFB 5JW3L 2HFFA 1Z9NA 3EAKA 1WFJA 1RIVH 3ME0A 5AWNH 3T09A 2F53E 2VXSL 4ZNCD 1JZIA 4XP9H 1WUNT 1YJDL 4U1JB 4FFYL 1RVFH 4V1DD 3MOBH 1SN2A 1XGQB 4MNGE 4LF3A 3ZMNA 2C7UB 4UILH 3RWJB 2B0SH 1MCRA 5AAWC 1O5PA 2IWFA 4GAGL 4HZLB 3LIUA 3BW9B 3GEWB 1KIUB 4JFEE 3RFRA 4OJEH 3FT9A 3HRZB 4HC1A 4DNLA 3SKNB 4HKXB 3CDZB 4L3EE 2WXKA 2NY0D 3QZOA 1HEZB 2JF1A 3CX2A 4C55A 1ASPA 4P5TB 4GAYA 2BP3A 5JQHC 4O02A 3T3MF 1E5YA 5J0BA 1MHCA 3WIHA 1L0XA 5EBMB 2VR7A 4MA1B 2OI9B 2B3RA 3VG0L 1B4LA 1F02I 4AL8C 2XY1A 5AYTA 2K1MA 2ENYA 4KJYA 5H37A 3D3VA 1ONQB 1T1WA 3ARPA 1ZKAA 2X4NA 4CJ1A 5DLMH 1HHIB 4KMTH 4XNMB 4QAWA 4CNIB 2ZE0A 5ADPH 3FB6A 2H2PD 5EZPA 3DV4B 4E9WA 2PNDA 2N1TE 1YQVH 4JZJB 4PJAE 4TVPL 1NCAH 4ZZFA 3JVGA 5IB2B 4WI7A 4FXKA 5I6MA 3ZDXF 3THML 1B0RA 5EZLA 2F19L 3KL5A 1XF2B 4BFBD 5F3HA 3TCLA 3W0WB 4EZKA 1V5JA 2FR4A 3GMMB 3MNZA 4MQTB 5EZOL 1OHZA 1FNGA 2I07B 3BDXA 4X4XB 1GTNA 2ADJA 4I77H 1AE6H 5DK0A 3GJFK 3HNVL 3SGEH 1A7QL 1RVFL 4K15A 2KKQA 2Z7WA 3D07A 3RA7L 4H25B 1JXKA 3RZCA 4DT2A 4KBPA 5F7EL 2GITA 1L6XA 4PS4L 1EEQA 3RE0A 5IB1A 1G43A 3IDXL 1P4LB 3M7OA 4XZ4A 2FJUB 3D5OF 3VXRD 4M8VA 4M61B 4M7JH 4NI3A 5FEBA 2Q6WB 5EZJA 3JWDH 1UYWL 2AV1B 1JGVH 4HMEA 4UUJB 1ZLVK 2R4RH 4A7QA 1MJ8H 5E08L 3SOBL 1GGBH 5KBKA 1G7PB 4N8VA 1YPZE 3OSKA 5C0AA 3T2NL 4B9IA 3GEFA 4YHPA 2OTWB 3QCUL 2JJTA 4I18A 4X5RA 5KANG 4WWKB 3HN8A 2PPFA 1GSKA 5EO0B 4GG8B 5HYQB 2N01B 3D3VE 5IESH 2AP2A 1H3PL 3NCWA 5ERWB 5IG7B 3IAGC 1NMCB 3F7RA 2WZAA 3FN0L 5BRQA 4MXQC 3U7YL 2B4CH 4OI7A 5DRNA 1VEOA 1L9PA 3VQMA 3ZO9A 4X6DF 1AO7D 3DHUA 3BH4A 3GKWL 3U4EA 2RACA 3DHJA 3IDGA 4HIEA 4PY7B 1IC4H 1I4FB 2X4UB 3ZQWA 1PQZA 2YOCA 4P2QB 2WD0A 4X5WA 3F5WA 4PRID 4X99B 5KWYC 4NJAL 1IAKA 3DPBA 3L1FA 2ZJSH 4XCNA 2UYLB 1HL8A 5EMYA 4MQSB 4PJBF 3VA6A 4JS7A 2B7DT 3BH9B 2QELA 4R7NA 3FHAA 5FF6A 5IHHA 4XMPH 3KR3H 3K4ZA 3S3BB 3FCSA 2PYEB 1IGFH 3FU0A 4NJ9L 4LQ1A 1VZGA 4P9ML 4Z7WF 1DJSA 3CFCH 3OX8A 4TVSa 4DH2A 5G2NA 5DURD 4M8UA 5IMOA 2CZNA 1TPXB 5D4JA 1IBBA 3NT0A 5HGAA 5C0AE 5A40E 1DTUA 3MRNA 2VQUA 4HJGA 5T8IA 4LVNB 3DGGA 3CE1A 4FG4A 4HK0B 3WS3B 3WY4A 4MMXC 2UV3A 1FE8H 1YQ2A 5D4IA 5G4MA 1K2DB 2UZPA 1ZHNB 1A6VL 1VTLE 2FD6L 3H6AA 1Q0XL 5GRUH 1SJHB 3GBDA 3OGCB 3WEMA 1VFAA 4UT6L 3REWA 2ZONA 4DO6A 1GZHA 1G9NC 3BQUD 4NM8L 4R26L 1CICD 4FTVE 3PHQB 1AYRA 1F58H 3X3FL 4BRJA 4G72B 4YXKH 4DW2H 1OPOA 4GW1A 3IFOA 4I3RH 3OKKB 4JRXE 3KLHD 4UBDC 5C0BD 5E6RB 2IFGA 5HSFA 3MROB 1P7QD 4QRUA 3VCLB 1I8LC 1A6AA 4JJOA 4O5LH 4R97C 4U1SB 5GS1C 4IRJC 5I1CL 4ANXA 3GSXB 2GT9B 2JSFA 4UYPA 3D87B 4OIAA 1I31A 1UFUA 1HYSD 1XBDA 3T4YA 3TO4D 3N85H 3SBPA 1Q9LA 1G6VK 3UG4A 2DIJA 3CC1A 4UQ9A 3ILQC 4N1EA 1NCWH 2YAPA 3A22A 2X5PA 1A4JB 4FJ6A 4JLRB 4W9FC 2FIRT 5FS5A 3FSAA 3C6LB 3WAJA 2CO6B 4EVNA 1AI1L 3TGXA 4QRQB 4DPAX 4ZW5A 1IRAY 1XSKA 1UJTA 4PRNA 1CK0H 2WXIA 5GIRA 5K9JL 3FU5A 5D55A 3UCQA 4Z9KB 4WVRA 4P23B 2O4EA 5GZNC 1AKJB 2AVGA 1TZAA 25C8H 2BSEA 3QDMB 3UO1H 1OEZW 5DF0A 2Z35B 5GGVY 1MI5D 1F4HA 3MNWB 4GUPA 1H15B 4FQQA 1IAIH 4AH2B 3NYKA 1LWVA 3JTTB 3KXFA 3P4OB 2XWJB 4ZFOB 1CLYH 1PD0A 2IPTH 1NOLA 3FQXA 3LKNA 4U33A 2I7OA 2BINA 4X2UA 3VFMB 2CM6A 4KC3B 4PJ7B 5FW7A 4WK2B 5KN5B 3MCG1 4S1RH 4XC1L 5LQBH 1Q90A 2CGZA 2Z91B 4FL4B 3HCVB 4OLUL 4M43H 4WJG3 2WLLB 1WK0A 3Q5OA 4P2OB 2VN7A 4LEEA 5A16B 4XWGL 2B1AL 2KMWA 4P46C 1RP9A 1ZK9A 2P26A 2UY6A 5D8JH 2RALA 1KIRA 4KPHL 1T7WA 3FPYA 3L2LA 1Q38A 3QUXC 4S1QH 4E9RA 4IK6A 4JVWA 2BS71 4U3SB 4GEJA 3UAJD 5BS0E 4V2BA 4U1NB 2VLKA 4QY8B 2NOHA 3CSFA 3FAWA 3L4XA 4HJTA 3MV9E 4DGVL 1HQRB 4MAUH 3D39D 3CDGA 5E7FA 4E9QA 4AQAB 4JFUA 4TTDD 1J5OH 4OCSH 4DKEH 4H20L 3UGXA 1P5DX 3U36A 1GZPB 1E9PA 2EDDA 4XN8A 4BXVA 4F80A 4DF9A 3BVNA 2ZG2A 4YAQA 1CIDA 3PWJA 2LV4A 3VQ1C 4BZ2A 4HWBL 4QPEA 2NY6D 3IH7A 4UDTB 5E00A 4R5TA 2D4FA 2LE9A 4W6WB 4GKZA 3RDTA 1MLBB 2FO4A 2DLHA 4CA4A 2ITFA 4POYA 1EJFA 1FZMB 4UV7H 5EUOA 1F0LA 4X80L 4TLUA 3G6DL 4ZO8A 2QV2A 4J3OD 1T0MA 3N50A 1IGTB 3IDJB 3O8XD 4JM2A 4ZTOL 3QDGB 4CW1B 1CF8H 1V7NH 3WFHA 3MRMA 4EZLA 4OZIB 3GRWH 4PV8A 5IK3B 3RTQC 1SHMA 3DX8B 4IGBD 4AT6B 3WEBA 5I2IA 4BWWA 4RMTA 1BVZA 2ZSVB 1JWMA 1CLVA 2VKWA 2WGXA 4UM8B 4XP5H 3BRGC 3AAZB 3ZK0A 3KPQA 5DVNA 4ZPTB 2J12B 4ZXBD 5JW5B 3KPLB 4HSCX 5L8LB 2OQJB 1L6PA 4PVBA 3KL3A 2Y07H 3B9KA 4MMZC 4K5PA 3FU9A 4OD1L 3NBNA 1CUOA 3FT1A 1HNGA 3NABH 4P5MB 5DVMA 3CLEL 1G9ML 4OCLC 2EH7H 5T3ZE 4G7YL 3ELAT 5EA0H 5F9JA 3FMGL 1MPGA 5ADOL 3BVUA 3SDAD 4MNQB 3TBCA 1X7QB 3MUY1 4XPAH 3E1ZA 2WTRB 1UM4L 2QQKH 4Z7OF 2GJ6B 1J5OL 1TQSA 5DYOA 4UU9A 3LDBB 1UM5H 5I28A 1CGVA 1BGXH 4XAKD 3VSTA 3QI9A 5IMMA 1O6TA 4X98A 3TVMD 4OLEA 4XMZA 4HXAH 3U7WL 4ZMZA 1UA6L 2CUAA 5EUOE 1KGYE 1D6VH 1XR9B 4G7VL 1DIZA 1A14H 4KTEL 5C0DA 2CSPA 1QPPA 4ZPVA 5HGHB 2EVJA 1I75A 1SJXA 1U6AL 3D25B 3DJSA 1DQLH 3UBXI 2YQ2A 1E27B 4GS7C 4ODHL 2ZXCA 4PJCA 4F9LC 5A3IC 4D9LH 1FO0L 4YZFF 1LVEA 4F93B 1U2YA 1BFOB 4J8RA 4LLUA 3FUHA 2C8NA 1MRFH 3GMLB 2A2QT 1JK8A 1ND0B 4YHZL 4ZD3H 2PWEA 1KSRA 1A6WL 2WVSA 4LPUA 1BD2B 2GHWB 3RX8A 1IAOB 5AUMB 5E1QA 1I1YA 1NANH 4NO0B 3QG7L 2OXGB 3ZDZE 2A9CA 3T0VA 4U6XB 2ZOOA 4B9JA 3WL9A 4GKSA 2HMIC 5ESAB 3TBTB 3HZKB 3LV3A 3ZKQD 1QPKA 1VTOA 4C4KO 4FQHA 4M3KB 4WI3A 1KXQA 3AG2B 3WO3B 5CNHA 2YPLB 1OKEA 3B6SB 5AYUH 4FCHA 4NQCD 4HEPA 5KAQG 1DVSA 1G6RB 5CJOL 2IAND 1FP5A 3M46A 5EU5B 5HHMD 5J6SA 4PYHA 1KJ3L 3LXCA 3MBWA 2QZQA 4WHTA 4EI5A 5D1ZC 3LIZA 2JCWA 3NABL 5T3XE 4WEBH 2EH7L 1IAIM 5I6LA 5FOBB 3T0ED 1KTRL 1LEIA 2ATPA 1WA2X 4XCCL 5C7XL 3BX7C 4KUZL 4K9EH 5AW8B 2OMWB 4WTZG 4X5XA 4GG6A 3QG6A 2VN6A 4C56E 5A7BA 1JF1A 2R39A 4ERSH 1YQKA 4N24A 4Z1PA 4MJIB 1BV8A 4D9QE 2ICWA 4PWIA 3ETSA 5E2TH 2HFEA 1GYWA 2H6PB 5FV2A 1X5GA 3ATFA 3CXHJ 4X6EA 3IDYC 4JG0H 4Q4IA 3OKOA 3T4AA 5DZAA 4MRQA 3I2CH 1UWXH 2EDJA 1N6QH 1AZRA 2PW1B 2X4QB 3AXLA 4KK8D 1SUHA 3IJHA 3GIZH 4UIMB 4D9LL 1E6OH 2GK0B 5A6MA 1T04B 2AAAA 2AKRA 2ZWYA 3KDMB 2R2EA 5EOCL 2JWYA 4AUUA 4IIZA 3A6CL 5L2KD 1D6EA 2B1HH 3V0HA 4L3CB 1G6RH 1PZ3A 3ESNA 4XN4A 5C0EB 3HE6D 2D2OA 2IIJA 5EC2A 2QPFA 2CK0H 1E4HA 3HI6H 1I3GH 2XBDA 5DJXA 3FO2B 3BPLB 1PMYA 2C3GA 5CD3A 2YAEA 3H8NA 1ZVSA 2CJUL 1FFOB 1S7UA 3Q44A 4J27A 4ZO7A 4L3FA 5H35B 1PKQB 2R27A 5A6LA 2BX5A 5LNGA 1B4JL 1HOCB 3POHA 1A25A 1CF1A 3WO4C 4OIIH 3QUML 1MVYA 2WQ8A 1N0LA 1T89A 3X13A 3WNPA 1F6AA 3MXVL 2GJPA 2BRQA 4U1GB 4ZFGL 2AXFB 2JH2A 4HGWA 4DQOL 1M1XA 1TSHA 5CBEB 3QPXH 5CUSH 3ABMB 2QADB 2J57A 4QRRD 4OLYL 4RGNE 3NJHA 3SE4C 3I6GB 1A0QH 2JKXA 4XT1C 4CBZA 1LGVA 4U1IB 3VGAB 3LJ3A 4AEHL 1FNEB 2KS0A 3ARFC 5K9OB 3CWUA 4JDEA 3FONA 4FQLH 1VFBB 2JIXB 2NSMA 2OL3B 2XN9B 4JPKL 4JBSA 4X6CF 5F6HI 4F58H 3IVKA 4P59L 1FZOB 3SY6A 3N5AA 3MLVL 2NY3D 3SDDC 4Q9RH 4OW6A 2BVYA 2W88A 2V8LA 3P2TA 2G3ZA 4QMEA 2XTSA 1N6QL 3ZN6A 1KULA 3BVVA 3M7FB 1ILUA 2LAEA 1MDTA 2CBPA 2YLHA 2X9WA 3WCYA 5MI0B 1FVCB 2OYLA 3MNVA 1X5ZA 3UO8B 2VN5A 4KI5D 4HS3A 2Q86A 2VH5L 4IKNA 4BEIA 2DOCA 2EZ0D 3STZB 1R3JA 3V6ZB 2O6FA 1JMZA 3B3IB 4CKVX 1MWOA 3PDKA 3GM0A 3EOTL 1QSFB 5D7LB 1U8OB 4YFLI 3WJJC 3QVAA 4G9FB 2R29L 4AL8L 1A47A 4OFYD 5KVFL 3K46A 3GMQA 2OZ4L 3GDCA 2WXQA 1MF2H 4NFCA 5HGDA 1ZTXH 1TOXA 5TTRA 1GCFA 5KYYB 1T1ZB 4NYLA 1I3RB 4GSDL 2V5YA 2AJYH 3W9EA 3N0PB 3WNKA 1QOKA 3B34A 4LLDB 3JYCA 2G30A 5FO2A 5IQOA 1KV3A 2OL3H 3CXFA 5C0CB 3KGSA 3LNIA 2EVIA 1GYUA 1FFQA 3FO9A 2VLLB 3VO0A 1JPSH 3AB0B 5DMGD 4RAUA 4Y4FA 5JDSB 4A38A 1PY4A 1U8KB 2OTUA 3GGWB 4JO5A 5D7JB 1TMQA 2DN7A 2VCOA 3CFEB 5CU5A 5T1LD 1O0VA 2IAMC 3RGVA 3UTPE 4GRMA 4D3CH 2NRDA 4RAHA 4NSKB 4YJZL 1EHLL 5IQ7L 2JKJA 3QS2A 2WNKA 3VDCA 3KLAB 4NPKA 1WWCA 4IRSC 1INQB 2XY2A 3QDHA 1RUAL 4O58L 2WQAA 3LPWA 4R2GD 4BQ9A 5E1IA 2PXYB 3WFDH 2R51A 3V52H 4PP1C 4EKXA 4A1RA 3HEIB 4XODA 5C0NC 1JZ5A 3EZ8A 4UT9A 2HN7B 5A2LH 2JKRM 5F0JB 3K2UH 1UVQA 5DJ0B 5JLZB 1S7RB 3GMRB 3K6FA 1YMHA 2EE6A 3F65A 4E0RB 4LCUA 3QCVH 2BIOA 5SWQA 4P48A 3MCYA 1V5SA 1QN9A 3PJSB 4JO3L 3ZHFA 1NC2B 1NUFA 1QLFB 3CU1A 3BIAX 1QRKA 2YUZA 3NK3A 3P54A 4LOVA 4Y8AA 5GSVA 3QQXA 2WWKT 3NCJH 5CILL 3VXUD 1RJLA 4LRIC 1RHHB 4A37A 2P24A 1UWFA 3T3ME 3ULUD 3RIKA 3VMNA 3VDAA 4F7EA 2P5EB 4MJ5B 1A9VA 1P5UB 5JHAA 4N2IA 4K7PY 5JW4R 2PETA 1BIIB 4J28A 1XGYH 1DQIA 1CR9L 1CVSC 3SPIA 1ZT1A 3D18A 3ECBA 4NDMA 3ZMRA 1OCRB 2YWYA 4AC2A 1GMIA 1KCLA 3K1DA 4X6DA 1JPSL 5B22A 2PKDA 1JGDA 1FH5L 1LK2B 2BSSA 2GUOB 2CD0A 1A6TA 1YY9C 3IPEA 4ANWA 1S7SA 2B14A 2Z34A 4IU2A 4GW5A 2A9DA 2X2YA 2ZOUA 4X7SH 2P8MA 3C5ZD 5HDQH 1QN4A 4HISA 4QF1B 3T9WA 2A74A 5CINH 3EYOA 3OLPA 5C1MB 2X6BA 4QOKA 4X8JB 4PJBA 2P8PA 4KXDA 5DS2A 1T6WA 1CDGA 1MY5A 3NIDE 3VRIA 3VD0A 3ENOC 1F41A 3TESA 4UT7L 2W65B 4HJUA 3ILDA 2VDRL 1I7RB 4AV4A 2AQ3A 1FZKA 2NYYC 3P4LA 4AGQA 3SHSA 4Z7WA 4WW2B 3IAQA 4HW6A 3FTXA 3MYJA 3QFGA 2QVMA 1FFPA 4RGMB 5D1XE 5JIMA 5CZKA 1H9VA 1NM4A 3TEWA 4LCIL 3MREA 4R3SB 2XJKA 4ZS7L 3TWCH 4EN2A 1YUKB 3SDXF 5MHSD 3T8VA 5E51A 3U1SH 3INUH 3NRQA 3NCJL 5FPIA 2SODB 1B0GB 2J6EA 2Y7SA 4P4KB 5EU7C 2VL4A 4L4VA 1I82A 4CMHC 1N4XL 4Y19D 3BISA 1JNHA 1KT2B 2JPIA 3E80A 1EDHA 3DX3A 2F7RA 2H2SC 4LCWE 1CG9B 4A7VA 4FABL 3WE1A 3G08B 4A66A 5EU6D 1MLCB 3LN4B 2VABB 5DFTA 3FB5A 3LKRB 5FUCC 4TQPA 4Y5VB 2MCMA 4F15C 4HWEH 3TURA 3VQ2C 3ULSA 5I1HH 1RSFA 4KGLA 3G7TA 4JM4L 3PWLB 1F13A 1CE6B 3A4DA 4UB0H 3PNRB 2P7TB 4NHUA 4X9GA 4B96A 2X7LA 3OKNB 4DSYA 1ETZB 5D7KE 3A21A 3EO1B 2GAZA 1KGJA 3EO0A 3ZU8A 1D5BA 3VFOA 2GG1A 4ONGH 4J3SA 1K8DA 4MAYC 2XWDA 3QXAA 1TG8A 2NVMA 4JGUA 3QIWC 1ZVNA 3CFIC 5CBAA 3CLWA 4F92B 1QN8A 1MCFA 2A5UA 1M9SA 5HPMA 2H26B 5F1NB 2NLJA 1BLIA 3ZE2E 3KYOA 2M1KA 2UZIH 4OAWA 3O9WB 4LL9A 3JV6B 1U3HB 2Y7LA 1XR8B 1KCSH 3X11B 2E7DA 2RHEA 5MENA 3ERXA 2DD8L 5DJ2A 3EADA 4ZW6A 1FBIL 4ELDA 2BVEA 4OZGB 4F20A 5EBLA 5I5IA 1SLXA 1DZ0A 3UBFA 3WTWA 2W0LA 1CXLA 1AZVA 5EPCA 3DMMC 4L2LA 2UWEB 1MVFA 2F54E 1I3VA 3VFGL 9PCYA 2CKBB 3FFDA 5FUOH 3L3JB 4QRBA 2HL9A 1ZLUH 1RZKC 3G5XB 4ZMOA 2EE0A 1EGJA 1TTAA 5ITFB 4PG9B 2DWEA 4WSJA 3VWJC 5I1IH 1J8SA 5KVDE 5FDYA 3HNSH 4ANKA 1P5GX 5F7WC 3BZEB 3QJHA 2FT7A 3L2NA 3S4SB 2G9HA 2VXQH 5IJBC 3N1PC 1DBBH 1I7TB 4G6MH 1XF4A 5GGRA 15C8H 1S3KL 2OYKA 5I8OL 1MWAL 5FM8A 5C0FA 2FWSA 1MFAH 3V9EA 1A8JH 4BQ8A 4F7PA 5C07B 4XH2A 4H8QA 1NVPA 4GO8A 4P5KB 4NQSB 1S7XB 5KVEH 4Y1AB 4K94H 6PCYA 2W94A 4IQHA 3WKPA 3B2VL 3TZVC 3AMKA 4XGZA 4X7FC 2O3OA 1EAOA 3ECVA 4OT1H 3SDCC 1CGWA 1S5HB 2Y6SD 4NNPH 1TZIB 4X4ME 3RAJH 4M1CC 1Q9WA 4B41A 4YDJB 3ZKNC 3TOPA 5BJTB 5EZIH 5MENE 5I1JL 4V1DB 5T33L 1UXWB 5FA4A 3QEUA 1VOLB 2CKBH 1NICA 1VB9A 1HXKA 4ZQTA 3O6KH 3JWNC 1Y6MR 3MRFA 4OFPA 2DLFL 3V0EA 4HF5H 4AENB 1O7DC 2AK1L 2C3HA 3MJ9A 1SY6A 5IEKA 5DC9B 3ZHDA 3K81A 3T8XA 3WHXB 2RBLA 2V37A 2VQ4A 4IOSD 2D0AA 2K8QA 4XP6H 4HGKC 3B1TA 3ML8A 4AQ1B 4J23A 5L4MA 1PTZA 1AY1H 2NY0B 3OKLA 4L8DB 3BP5A 5DD0L 2J21A 5CIPA 5FYJD 4RQQA 3ZDYB 3ARBA 3GJFB 3OHXB 2IDQA 4MQXD 1ML0A 1MH5B 3LNGA 3T65B 4QHUB 5DHVB 4APXA 4K3JH 1UZ6F 1CLOL 4MA1C 4NQEA 4AX3A 5TF1H 5I1IL 2VSDA 2JNZA 4QWWC 2XQ0A 1JYWA 5E23A 5SV3A 1OAYH 2I85A 4ODVH 1PZ5A 3F6JA 4LVHC 3VA2C 4NZJA 1TTCA 4Z78A 1M7UA 1U8MA 2C4FU 4PJ7F 1ZJAA 15C8L 1G7JA 1NPNA 4MD0B 2CGRH 4UQAA 2QR0A 3CWSA 2RQEA 3L4VA 4NC0B 2QREA 2VZOA 2D73A 3RVUD 1B6DA 4BUHA 3C5SA 3V6FA 2ADIB 1X7SA 2YZ8A 1NCTA 4QHMB 5IF0B 1JXGA 4Q52A 4QXTA 2FGTA 3BXNA 1BBDH 4PJIA 3T2QA 5EF2A 4U0RC 3V5KB 1I3UA 2AQSA 2I24N 4FQIH 4NT6B 4G8EA 4K8RD 4MA8H 2BP8B 1DQMH 3BVDB 4N3UA 1IX2A 4HQQH 4DULA 1BYPA 1TTUA 2XN2A 1J1OH 1PCJX 1PG7W 5CO1A 3RWGA 4EKJA 3CN0A 4YC2C 2J5LC 3E6FB 4F37F 4OZHE 1OD9A 3DARA 3VXRB 1V3MA 5CGYD 5IEHA 5DHVH 4FDWA 2JLLA 4N0CD 2VMDA 2C4FT 1NOFA 1XQ4A 3AY2A 4L29B 4LIQH 4UQCA 4MB1A 2LU3A 3GSNB 4R5XA 1XAUA 3CC5B 5CGMA 1LK3H 1OGTB 5DQJA 3WJMB 2IMMA 4HKBB 5BVPL 3SQOL 4P3CH 1ZEAL 3AU0A 4N8UA 3MLRH 4MHHI 4OCMC 1UENA