4ROEB

Human tfiib-related factor 2 (brf2) and tbp bound to rpph1 promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
177
Chain Sequence
PSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 45
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4roeB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4roeB02
1QN4A 1AISA 1W80A 5IYBP 1CDWA 3OC3C 2IV9A 3VN5A 1QNAA 1TBAB 1TBPA 1NVPA 4WZSD 3ASMA 1PCZA 1JFIC 1YTBA 1VTLE 3HS9A 1QTPA 1YTFA 1C9BB 4ROEB 1KYFA 2MJ7A 4ROCB 1QN6A 1VOLB 1RM1A 1QN5A 3EIKA 5IYCP 5IYDP 1VTOA 1TGHA 1KY7A 4PY5A 1MP9A 2D0BA 3HS8A 1QN9A 1QN3A 1QTSA 1QNBA 1KYDA 1KYUA 1QNEA 1VOKA 1B9KA 1QN8A 1E42A 1PZDA 2VJ0A 3H1ZA 4B0AA 1D3UA 2IV8A 1R4XA 2D0CA 2D0AA 1KY6A 1NH2A 1NGMA 1QN7A 4RODB 2G30A 2Z8UA 3OCIA 1QNCA
chains in the Genus database with same CATH superfamily
1C47A 4HJHA 1YQRA 1WJWA 3CWAA 2PWWA 1MPGA 5JN5A 3CW7A 2NOHA 3OLPA 1TBAB 1NVPA 4C7PA 1QN7A 1JFIC 2O3OA 1YTBA 1PCJX 2NVMA 1EBMA 1LXTA 4WXAA 2Y8QA 4ROCB 5F9CA 4ROEB 4D7RA 4I8OA 4CFFA 1LWVA 1TGHA 2NOFA 1UT4A 2FKMX 2QRCA 5JMVD 3KRMA 3OH6A 1QN3A 3CWTA 2JOIA 3D7QA 2DKDA 3RPJA 2EHBD 1QNEA 1E42A 1D3UA 3CWSA 2IV8A 2D0AA 2DKCA 4MRQA 4TPSA 1NH2A 2JHJA 1K35A 2HZSA 2QLVA 2Z8UA 3CVSA 1P5GX 3I0WA 3D4VA 3CVTA 1WQAA 2QREA 3VN5A 2QRDA 3F10A 2YA3A 2NOEA 2NOLA 3DPTA 3ENCA 4BJUA 2ZFDB 2NOZA 5EPCA 3HS9A 4EJYA 1PCMX 2FUVA 1KFIA 1QTPA 2MJ7A 5BMNA 4Q11A 1HU0A 1VOLB 4D7QA 3EIKA 5IYDP 1KY7A 1VKLA 3PMGA 4PY5A 1PVSA 2D0BA 2HL8A 3KTUA 1QTSA 2NOIA 1QNBA 1KYDA 2F7LA 5KL0A 1B9KA 1LWWA 3C04A 2VJ0A 1XSZA 3TE5A 1NGMA 2HZMA 1KY6A 1UT7A 3RSMA 4QG5A 2FKFA 4WX8A 3OCIA 1QNCA 3EAYA 1AISA 2Y8LA 1W80A 3BKQX 1LWYA 2NWVA 5IYBP 1CDWA 3OC3C 1YQLA 2FGTA 2IV9A 3OH9A 1M3QA 2YH5A 3OSMA 1TBPA 2I5WA 4WZSD 3ASMA 1EUVA 1PCZA 2V8QA 1VTLE 1P5DX 1KO9A 2QR1A 2V92A 3DPUA 1M3HA 1C9BB 1N3AA 1JDYA 5IYCP 1Q9UA 1MP9A 3HS8A 3PDKA 4EJZA 2MZ8A 1KYUA 1QN8A 1PZDA 3TDHA 4IL8A 1R4XA 3OSEA 2OOYA 1V5SA 2HL9A 1TUOA 2OOXA 4RODB 4EAKA 2V9JA 1QN4A 3NA5A 3ENOC 2LAEA 3OSTA 2JHNA 3UW2A 2HKPA 1J3MA 1QNAA 3F0ZA 4EAIA 2NLVA 1FN7A 2NOBA 2JPIA 1KFQA 2Z0FA 2R5XA 4DULA 4EAJA 1K2YX 2H5AX 5BMPA 3SNSA 1YTFA 1KYFA 5AN4A 2XHIA 1QN6A 3IH7A 1RM1A 1YQKA 1DIZA 1QN5A 3I3WA 1VTOA 1UL7A 1N3CA 1QN9A 3T4NA 1VOKA 3I0XA 4EAGA 2H4LX 1C4GA 3H1ZA 4B0AA 1N39A 2DKAA 2D0CA 3N89A 1M5Q1 4EALA 3CWUA 1YQMA 3OGDA 5HSHA 2G30A 3ULXA 1T6AA
chains in the Genus database with same CATH topology
1YQRA 2NOHA 1TBAB 1NVPA 1JFIC 2O3OA 1YTBA 1EBMA 4ROEB 4ROCB 4I8OA 1LWVA 1TGHA 2NOFA 1UT4A 3KRMA 1QN3A 2JOIA 3RPJA 1QNEA 1E42A 1D3UA 2IV8A 2D0AA 4TPSA 1NH2A 2Z8UA 2HZSA 3I0WA 3VN5A 3F10A 2NOEA 2NOLA 3DPTA 2NOZA 3HS9A 4EJYA 1QTPA 2MJ7A 1VOLB 4Q11A 1HU0A 3EIKA 5IYDP 1KY7A 4PY5A 2D0BA 3KTUA 1QTSA 2NOIA 1QNBA 1KYDA 1LWWA 1B9KA 2VJ0A 1NGMA 2HZMA 1KY6A 1UT7A 3OCIA 1QNCA 1AISA 1W80A 1LWYA 5IYBP 1CDWA 3OC3C 1YQLA 2FGTA 2IV9A 1M3QA 2YH5A 3OSMA 1TBPA 2I5WA 4WZSD 3ASMA 1PCZA 1VTLE 1KO9A 3DPUA 1M3HA 1C9BB 1N3AA 5IYCP 1MP9A 3HS8A 4EJZA 2MZ8A 1KYUA 1QN8A 1PZDA 1R4XA 4RODB 1QN4A 2LAEA 3OSTA 1QNAA 3F0ZA 2NOBA 1FN7A 4DULA 3SNSA 1YTFA 1KYFA 5AN4A 2XHIA 1QN6A 3IH7A 1RM1A 1YQKA 1QN5A 1VTOA 1N3CA 1QN9A 1VOKA 3I0XA 4B0AA 3H1ZA 1N39A 2D0CA 3N89A 1YQMA 1QN7A 2G30A 3ULXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN4 A;  1AIS A;  1W80 A;  5IYB P;  1CDW A;  3OC3 C;  2IV9 A;  3VN5 A;  1QNA A;  1TBA B;  1TBP A;  1NVP A;  4WZS D;  3ASM A;  1PCZ A;  1JFI C;  1YTB A;  1VTL E;  3HS9 A;  1QTP A;  1YTF A;  1C9B B;  4ROE B;  1KYF A;  2MJ7 A;  4ROC B;  1QN6 A;  1VOL B;  1RM1 A;  1QN5 A;  3EIK A;  5IYC P;  5IYD P;  1VTO A;  1TGH A;  1KY7 A;  4PY5 A;  1MP9 A;  2D0B A;  3HS8 A;  1QN9 A;  1QN3 A;  1QTS A;  1QNB A;  1KYD A;  1KYU A;  1QNE A;  1VOK A;  1B9K A;  1QN8 A;  1E42 A;  1PZD A;  2VJ0 A;  3H1Z A;  4B0A A;  1D3U A;  2IV8 A;  1R4X A;  2D0C A;  2D0A A;  1KY6 A;  1NH2 A;  1NGM A;  1QN7 A;  4ROD B;  2G30 A;  2Z8U A;  3OCI A;  1QNC A; 
#chains in the Genus database with same CATH topology
 1C47 A;  4HJH A;  1YQR A;  1WJW A;  3CWA A;  2PWW A;  1MPG A;  5JN5 A;  3CW7 A;  2NOH A;  3OLP A;  1TBA B;  1NVP A;  4C7P A;  1QN7 A;  1JFI C;  2O3O A;  1YTB A;  1PCJ X;  2NVM A;  1EBM A;  1LXT A;  4WXA A;  2Y8Q A;  4ROC B;  5F9C A;  4ROE B;  4D7R A;  4I8O A;  4CFF A;  1LWV A;  1TGH A;  2NOF A;  1UT4 A;  2FKM X;  2QRC A;  5JMV D;  3KRM A;  3OH6 A;  1QN3 A;  3CWT A;  2JOI A;  3D7Q A;  2DKD A;  3RPJ A;  2EHB D;  1QNE A;  1E42 A;  1D3U A;  3CWS A;  2IV8 A;  2D0A A;  2DKC A;  4MRQ A;  4TPS A;  1NH2 A;  2JHJ A;  1K35 A;  2HZS A;  2QLV A;  2Z8U A;  3CVS A;  1P5G X;  3I0W A;  3D4V A;  3CVT A;  1WQA A;  2QRE A;  3VN5 A;  2QRD A;  3F10 A;  2YA3 A;  2NOE A;  2NOL A;  3DPT A;  3ENC A;  4BJU A;  2ZFD B;  2NOZ A;  5EPC A;  3HS9 A;  4EJY A;  1PCM X;  2FUV A;  1KFI A;  1QTP A;  2MJ7 A;  5BMN A;  4Q11 A;  1HU0 A;  1VOL B;  4D7Q A;  3EIK A;  5IYD P;  1KY7 A;  1VKL A;  3PMG A;  4PY5 A;  1PVS A;  2D0B A;  2HL8 A;  3KTU A;  1QTS A;  2NOI A;  1QNB A;  1KYD A;  2F7L A;  5KL0 A;  1B9K A;  1LWW A;  3C04 A;  2VJ0 A;  1XSZ A;  3TE5 A;  1NGM A;  2HZM A;  1KY6 A;  1UT7 A;  3RSM A;  4QG5 A;  2FKF A;  4WX8 A;  3OCI A;  1QNC A;  3EAY A;  1AIS A;  2Y8L A;  1W80 A;  3BKQ X;  1LWY A;  2NWV A;  5IYB P;  1CDW A;  3OC3 C;  1YQL A;  2FGT A;  2IV9 A;  3OH9 A;  1M3Q A;  2YH5 A;  3OSM A;  1TBP A;  2I5W A;  4WZS D;  3ASM A;  1EUV A;  1PCZ A;  2V8Q A;  1VTL E;  1P5D X;  1KO9 A;  2QR1 A;  2V92 A;  3DPU A;  1M3H A;  1C9B B;  1N3A A;  1JDY A;  5IYC P;  1Q9U A;  1MP9 A;  3HS8 A;  3PDK A;  4EJZ A;  2MZ8 A;  1KYU A;  1QN8 A;  1PZD A;  3TDH A;  4IL8 A;  1R4X A;  3OSE A;  2OOY A;  1V5S A;  2HL9 A;  1TUO A;  2OOX A;  4ROD B;  4EAK A;  2V9J A;  1QN4 A;  3NA5 A;  3ENO C;  2LAE A;  3OST A;  2JHN A;  3UW2 A;  2HKP A;  1J3M A;  1QNA A;  3F0Z A;  4EAI A;  2NLV A;  1FN7 A;  2NOB A;  2JPI A;  1KFQ A;  2Z0F A;  2R5X A;  4DUL A;  4EAJ A;  1K2Y X;  2H5A X;  5BMP A;  3SNS A;  1YTF A;  1KYF A;  5AN4 A;  2XHI A;  1QN6 A;  3IH7 A;  1RM1 A;  1YQK A;  1DIZ A;  1QN5 A;  3I3W A;  1VTO A;  1UL7 A;  1N3C A;  1QN9 A;  3T4N A;  1VOK A;  3I0X A;  4EAG A;  2H4L X;  1C4G A;  3H1Z A;  4B0A A;  1N39 A;  2DKA A;  2D0C A;  3N89 A;  1M5Q 1;  4EAL A;  3CWU A;  1YQM A;  3OGD A;  5HSH A;  2G30 A;  3ULX A;  1T6A A; 
#chains in the Genus database with same CATH homology
 1YQR A;  2NOH A;  1TBA B;  1NVP A;  1JFI C;  2O3O A;  1YTB A;  1EBM A;  4ROE B;  4ROC B;  4I8O A;  1LWV A;  1TGH A;  2NOF A;  1UT4 A;  3KRM A;  1QN3 A;  2JOI A;  3RPJ A;  1QNE A;  1E42 A;  1D3U A;  2IV8 A;  2D0A A;  4TPS A;  1NH2 A;  2Z8U A;  2HZS A;  3I0W A;  3VN5 A;  3F10 A;  2NOE A;  2NOL A;  3DPT A;  2NOZ A;  3HS9 A;  4EJY A;  1QTP A;  2MJ7 A;  1VOL B;  4Q11 A;  1HU0 A;  3EIK A;  5IYD P;  1KY7 A;  4PY5 A;  2D0B A;  3KTU A;  1QTS A;  2NOI A;  1QNB A;  1KYD A;  1LWW A;  1B9K A;  2VJ0 A;  1NGM A;  2HZM A;  1KY6 A;  1UT7 A;  3OCI A;  1QNC A;  1AIS A;  1W80 A;  1LWY A;  5IYB P;  1CDW A;  3OC3 C;  1YQL A;  2FGT A;  2IV9 A;  1M3Q A;  2YH5 A;  3OSM A;  1TBP A;  2I5W A;  4WZS D;  3ASM A;  1PCZ A;  1VTL E;  1KO9 A;  3DPU A;  1M3H A;  1C9B B;  1N3A A;  5IYC P;  1MP9 A;  3HS8 A;  4EJZ A;  2MZ8 A;  1KYU A;  1QN8 A;  1PZD A;  1R4X A;  4ROD B;  1QN4 A;  2LAE A;  3OST A;  1QNA A;  3F0Z A;  2NOB A;  1FN7 A;  4DUL A;  3SNS A;  1YTF A;  1KYF A;  5AN4 A;  2XHI A;  1QN6 A;  3IH7 A;  1RM1 A;  1YQK A;  1QN5 A;  1VTO A;  1N3C A;  1QN9 A;  1VOK A;  3I0X A;  4B0A A;  3H1Z A;  1N39 A;  2D0C A;  3N89 A;  1YQM A;  1QN7 A;  2G30 A;  3ULX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...