4ROEB

Human tfiib-related factor 2 (brf2) and tbp bound to rpph1 promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
177
Chain Sequence
PSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4roeB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4roeB02
1KY6A 1PCZA 1E42A 1W80A 3HS8A 2VJ0A 3VN5A 1KY7A 4RODB 1VTOA 1KYUA 1QNCA 2D0BA 3HS9A 4WZSD 2IV8A 1TBAB 3OCIA 1QN8A 1QN7A 1RM1A 1R4XA 2IV9A 1NVPA 1QN4A 1C9BB 1YTBA 3H1ZA 4PY5A 3ASMA 1KYDA 1JFIC 1D3UA 2D0CA 4ROCB 1CDWA 1QNAA 1QNEA 1QNBA 1MP9A 3OC3C 1YTFA 1NGMA 1QTSA 5IYBP 1NH2A 1TBPA 5IYCP 2D0AA 1QTPA 1QN3A 1PZDA 1QN6A 3EIKA 4ROEB 1QN5A 1VOKA 1KYFA 1VOLB 1B9KA 2G30A 1TGHA 2Z8UA 1VTLE 2MJ7A 5IYDP 1QN9A 1AISA 4B0AA
chains in the Genus database with same CATH superfamily
1PCZA 3IH7A 1W80A 3OSTA 2NLVA 2NOIA 4EJZA 1KFQA 2R5XA 3CWTA 4IL8A 3CW7A 3T4NA 2HL8A 3KTUA 2DKCA 3TE5A 3I0XA 1RM1A 1KFIA 3C04A 4QG5A 2QR1A 1C9BB 3H1ZA 3ASMA 1KYDA 1MPGA 1VKLA 1LWWA 1N3CA 2QLVA 1XSZA 2NOLA 1KO9A 1QNBA 1MP9A 1YTFA 2F7LA 1QTSA 3EAYA 5IYCP 2D0AA 1QTPA 1HU0A 1PZDA 1FN7A 2OOYA 3OSMA 1KYFA 1YQMA 2PWWA 3TDHA 1M3QA 1P5GX 3ULXA 3UW2A 1YQKA 1E42A 3HS8A 2H4LX 2YA3A 5KL0A 2VJ0A 5JN5A 1KYUA 1YQLA 1M3HA 3OH6A 2NOEA 2ZFDB 1K35A 3F10A 1R4XA 2IV9A 4EJYA 3PDKA 2V9JA 2XHIA 1C4GA 2JPIA 4PY5A 3D7QA 1D3UA 2O3OA 4ROCB 2Z0FA 2NOHA 2HZMA 3OC3C 2I5WA 2HKPA 3I3WA 2NWVA 1P5DX 1QN3A 2DKAA 3OGDA 1QN6A 2QRDA 3EIKA 5BMPA 2LAEA 1DIZA 1VOLB 1TGHA 3SNSA 4BJUA 2Z8UA 3PMGA 3OLPA 3DPUA 1WJWA 2HZSA 1LWYA 3CVTA 3OSEA 1AISA 4MRQA 3CVSA 1UL7A 4CFFA 1KY6A 1Q9UA 2MZ8A 4D7QA 1PVSA 5BMNA 4RODB 2FGTA 3VN5A 1N39A 5EPCA 1EBMA 1UT4A 2QREA 1TBAB 1NVPA 1J3MA 2QRCA 2YH5A 2NVMA 4EAJA 1C47A 2HL9A 2D0CA 1CDWA 2JOIA 3KRMA 1QNEA 1T6AA 1NGMA 2Y8QA 1JDYA 1TBPA 5F9CA 3F0ZA 4EAIA 4ROEB 3ENCA 1QN5A 2DKDA 3CWAA 3CWSA 3RSMA 4DULA 2FUVA 2MJ7A 2OOXA 4WX8A 1N3AA 4B0AA 5HSHA 2NOBA 1LWVA 4C7PA 3ENOC 2V92A 4D7RA 2H5AX 2FKFA 1K2YX 1KY7A 1VTOA 1QNCA 3RPJA 3CWUA 1TUOA 1UT7A 2D0BA 2IV8A 2JHJA 3HS9A 4WZSD 3OCIA 1QN8A 3NA5A 1QN7A 5JMVD 4I8OA 2FKMX 3I0WA 4EAKA 1QN4A 3N89A 1YTBA 1JFIC 1V5SA 3BKQX 1QNAA 1WQAA 4WXAA 4EALA 1PCMX 4TPSA 2NOFA 3DPTA 3OH9A 2EHBD 2JHNA 5IYBP 1NH2A 4HJHA 1LXTA 2NOZA 1YQRA 1VOKA 1B9KA 2G30A 4Q11A 1M5Q1 1VTLE 1EUVA 4EAGA 5AN4A 5IYDP 2Y8LA 1QN9A 2V8QA 1PCJX 3D4VA
chains in the Genus database with same CATH topology
1PCZA 3IH7A 1W80A 3OSTA 2NOIA 4EJZA 3KTUA 3I0XA 1RM1A 1C9BB 3H1ZA 3ASMA 1KYDA 1LWWA 1N3CA 2NOLA 1KO9A 1QNBA 1MP9A 1YTFA 1QTSA 5IYCP 2D0AA 1QTPA 1HU0A 1PZDA 1FN7A 3OSMA 1M3QA 1KYFA 1YQMA 3ULXA 1YQKA 1E42A 3HS8A 2VJ0A 1KYUA 1YQLA 1M3HA 2NOEA 3F10A 1R4XA 2IV9A 4EJYA 2XHIA 4PY5A 1D3UA 2O3OA 4ROCB 2NOHA 2HZMA 3OC3C 2I5WA 1QN3A 1QN6A 3EIKA 2LAEA 1VOLB 1TGHA 3SNSA 2Z8UA 3DPUA 2HZSA 1LWYA 1AISA 1KY6A 2MZ8A 4RODB 2FGTA 3VN5A 1N39A 1EBMA 1UT4A 1TBAB 1NVPA 2YH5A 2D0CA 1CDWA 2JOIA 3KRMA 1QNEA 1NGMA 1TBPA 3F0ZA 4ROEB 1QN5A 4DULA 2MJ7A 1N3AA 4B0AA 2NOBA 1LWVA 1KY7A 1VTOA 1QNCA 3RPJA 2D0BA 1UT7A 3HS9A 2IV8A 4WZSD 3OCIA 1QN8A 1QN7A 4I8OA 3I0WA 1QN4A 1YTBA 3N89A 1JFIC 1QNAA 4TPSA 2NOFA 3DPTA 5IYBP 1NH2A 2NOZA 1YQRA 1VOKA 1B9KA 2G30A 4Q11A 1VTLE 5AN4A 5IYDP 1QN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KY6 A;  1PCZ A;  1E42 A;  1W80 A;  3HS8 A;  2VJ0 A;  3VN5 A;  1KY7 A;  4ROD B;  1VTO A;  1KYU A;  1QNC A;  2D0B A;  3HS9 A;  4WZS D;  2IV8 A;  1TBA B;  3OCI A;  1QN8 A;  1QN7 A;  1RM1 A;  1R4X A;  2IV9 A;  1NVP A;  1QN4 A;  1C9B B;  1YTB A;  3H1Z A;  4PY5 A;  3ASM A;  1KYD A;  1JFI C;  1D3U A;  2D0C A;  4ROC B;  1CDW A;  1QNA A;  1QNE A;  1QNB A;  1MP9 A;  3OC3 C;  1YTF A;  1NGM A;  1QTS A;  5IYB P;  1NH2 A;  1TBP A;  5IYC P;  2D0A A;  1QTP A;  1QN3 A;  1PZD A;  1QN6 A;  3EIK A;  4ROE B;  1QN5 A;  1VOK A;  1KYF A;  1VOL B;  1B9K A;  2G30 A;  1TGH A;  2Z8U A;  1VTL E;  2MJ7 A;  5IYD P;  1QN9 A;  1AIS A;  4B0A A; 
#chains in the Genus database with same CATH topology
 1PCZ A;  3IH7 A;  1W80 A;  3OST A;  2NLV A;  2NOI A;  4EJZ A;  1KFQ A;  2R5X A;  3CWT A;  4IL8 A;  3CW7 A;  3T4N A;  2HL8 A;  3KTU A;  2DKC A;  3TE5 A;  3I0X A;  1RM1 A;  1KFI A;  3C04 A;  4QG5 A;  2QR1 A;  1C9B B;  3H1Z A;  3ASM A;  1KYD A;  1MPG A;  1VKL A;  1LWW A;  1N3C A;  2QLV A;  1XSZ A;  2NOL A;  1KO9 A;  1QNB A;  1MP9 A;  1YTF A;  2F7L A;  1QTS A;  3EAY A;  5IYC P;  2D0A A;  1QTP A;  1HU0 A;  1PZD A;  1FN7 A;  2OOY A;  3OSM A;  1KYF A;  1YQM A;  2PWW A;  3TDH A;  1M3Q A;  1P5G X;  3ULX A;  3UW2 A;  1YQK A;  1E42 A;  3HS8 A;  2H4L X;  2YA3 A;  5KL0 A;  2VJ0 A;  5JN5 A;  1KYU A;  1YQL A;  1M3H A;  3OH6 A;  2NOE A;  2ZFD B;  1K35 A;  3F10 A;  1R4X A;  2IV9 A;  4EJY A;  3PDK A;  2V9J A;  2XHI A;  1C4G A;  2JPI A;  4PY5 A;  3D7Q A;  1D3U A;  2O3O A;  4ROC B;  2Z0F A;  2NOH A;  2HZM A;  3OC3 C;  2I5W A;  2HKP A;  3I3W A;  2NWV A;  1P5D X;  1QN3 A;  2DKA A;  3OGD A;  1QN6 A;  2QRD A;  3EIK A;  5BMP A;  2LAE A;  1DIZ A;  1VOL B;  1TGH A;  3SNS A;  4BJU A;  2Z8U A;  3PMG A;  3OLP A;  3DPU A;  1WJW A;  2HZS A;  1LWY A;  3CVT A;  3OSE A;  1AIS A;  4MRQ A;  3CVS A;  1UL7 A;  4CFF A;  1KY6 A;  1Q9U A;  2MZ8 A;  4D7Q A;  1PVS A;  5BMN A;  4ROD B;  2FGT A;  3VN5 A;  1N39 A;  5EPC A;  1EBM A;  1UT4 A;  2QRE A;  1TBA B;  1NVP A;  1J3M A;  2QRC A;  2YH5 A;  2NVM A;  4EAJ A;  1C47 A;  2HL9 A;  2D0C A;  1CDW A;  2JOI A;  3KRM A;  1QNE A;  1T6A A;  1NGM A;  2Y8Q A;  1JDY A;  1TBP A;  5F9C A;  3F0Z A;  4EAI A;  4ROE B;  3ENC A;  1QN5 A;  2DKD A;  3CWA A;  3CWS A;  3RSM A;  4DUL A;  2FUV A;  2MJ7 A;  2OOX A;  4WX8 A;  1N3A A;  4B0A A;  5HSH A;  2NOB A;  1LWV A;  4C7P A;  3ENO C;  2V92 A;  4D7R A;  2H5A X;  2FKF A;  1K2Y X;  1KY7 A;  1VTO A;  1QNC A;  3RPJ A;  3CWU A;  1TUO A;  1UT7 A;  2D0B A;  2IV8 A;  2JHJ A;  3HS9 A;  4WZS D;  3OCI A;  1QN8 A;  3NA5 A;  1QN7 A;  5JMV D;  4I8O A;  2FKM X;  3I0W A;  4EAK A;  1QN4 A;  3N89 A;  1YTB A;  1JFI C;  1V5S A;  3BKQ X;  1QNA A;  1WQA A;  4WXA A;  4EAL A;  1PCM X;  4TPS A;  2NOF A;  3DPT A;  3OH9 A;  2EHB D;  2JHN A;  5IYB P;  1NH2 A;  4HJH A;  1LXT A;  2NOZ A;  1YQR A;  1VOK A;  1B9K A;  2G30 A;  4Q11 A;  1M5Q 1;  1VTL E;  1EUV A;  4EAG A;  5AN4 A;  5IYD P;  2Y8L A;  1QN9 A;  2V8Q A;  1PCJ X;  3D4V A; 
#chains in the Genus database with same CATH homology
 1PCZ A;  3IH7 A;  1W80 A;  3OST A;  2NOI A;  4EJZ A;  3KTU A;  3I0X A;  1RM1 A;  1C9B B;  3H1Z A;  3ASM A;  1KYD A;  1LWW A;  1N3C A;  2NOL A;  1KO9 A;  1QNB A;  1MP9 A;  1YTF A;  1QTS A;  5IYC P;  2D0A A;  1QTP A;  1HU0 A;  1PZD A;  1FN7 A;  3OSM A;  1M3Q A;  1KYF A;  1YQM A;  3ULX A;  1YQK A;  1E42 A;  3HS8 A;  2VJ0 A;  1KYU A;  1YQL A;  1M3H A;  2NOE A;  3F10 A;  1R4X A;  2IV9 A;  4EJY A;  2XHI A;  4PY5 A;  1D3U A;  2O3O A;  4ROC B;  2NOH A;  2HZM A;  3OC3 C;  2I5W A;  1QN3 A;  1QN6 A;  3EIK A;  2LAE A;  1VOL B;  1TGH A;  3SNS A;  2Z8U A;  3DPU A;  2HZS A;  1LWY A;  1AIS A;  1KY6 A;  2MZ8 A;  4ROD B;  2FGT A;  3VN5 A;  1N39 A;  1EBM A;  1UT4 A;  1TBA B;  1NVP A;  2YH5 A;  2D0C A;  1CDW A;  2JOI A;  3KRM A;  1QNE A;  1NGM A;  1TBP A;  3F0Z A;  4ROE B;  1QN5 A;  4DUL A;  2MJ7 A;  1N3A A;  4B0A A;  2NOB A;  1LWV A;  1KY7 A;  1VTO A;  1QNC A;  3RPJ A;  2D0B A;  1UT7 A;  3HS9 A;  2IV8 A;  4WZS D;  3OCI A;  1QN8 A;  1QN7 A;  4I8O A;  3I0W A;  1QN4 A;  1YTB A;  3N89 A;  1JFI C;  1QNA A;  4TPS A;  2NOF A;  3DPT A;  5IYB P;  1NH2 A;  2NOZ A;  1YQR A;  1VOK A;  1B9K A;  2G30 A;  4Q11 A;  1VTL E;  5AN4 A;  5IYD P;  1QN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...