4ROEB

Human tfiib-related factor 2 (brf2) and tbp bound to rpph1 promoter
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
177
structure length
177
Chain Sequence
PSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 45
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2014-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4roeB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4roeB02
1PZDA 2D0CA 1KYDA 1VTLE 1QN3A 5IYCP 1TBAB 2G30A 2IV9A 1QN7A 1TBPA 4RODB 3OCIA 1QN4A 3ASMA 4B0AA 1QTPA 5IYDP 1AISA 1W80A 4WZSD 1VOKA 1CDWA 1QN9A 1YTFA 1QNAA 1QN6A 2D0AA 1QNEA 1NH2A 1VTOA 1QN5A 2VJ0A 1YTBA 1KYFA 3OC3C 1QNBA 2Z8UA 3HS8A 1KY7A 1KY6A 1QTSA 1JFIC 4ROEB 1NGMA 2MJ7A 1KYUA 1PCZA 3H1ZA 3HS9A 3VN5A 1D3UA 1MP9A 1QN8A 2D0BA 1NVPA 4PY5A 1VOLB 1C9BB 2IV8A 5IYBP 4ROCB 1RM1A 1QNCA 1E42A 1B9KA 1TGHA 1R4XA 3EIKA
chains in the Genus database with same CATH superfamily
2D0CA 1KYDA 4EAGA 1UT4A 2QR1A 2QREA 1WQAA 2IV9A 1QN7A 2V92A 3TDHA 2V9JA 1YQMA 1QTPA 3C04A 5JMVD 3RSMA 1CDWA 2NOLA 3F0ZA 5AN4A 2D0AA 1QNEA 1N39A 2JHNA 3N89A 1P5GX 2VJ0A 4TPSA 1KYFA 3OC3C 4DULA 3CWAA 2FKMX 4I8OA 1KFIA 3H1ZA 3HS9A 3VN5A 1EUVA 1QN8A 2D0BA 1JDYA 1NVPA 3CW7A 1VOLB 2OOXA 3OH9A 3PMGA 1KFQA 2XHIA 1E42A 2DKDA 4ROCB 3SNSA 5EPCA 2QLVA 2HKPA 3PDKA 2ZFDB 1YQLA 1PVSA 2DKCA 4C7PA 3F10A 1WJWA 2H5AX 2HL9A 3OCIA 2PWWA 2LAEA 5IYDP 3KTUA 1AISA 4WZSD 1QN9A 4D7RA 1K2YX 4CFFA 1KO9A 2NOZA 3DPUA 2Y8QA 4MRQA 1P5DX 4D7QA 1QN5A 4EJYA 2NVMA 4WX8A 1LWWA 5BMNA 3OLPA 5JN5A 1KY7A 1N3CA 1KY6A 2JHJA 1QTSA 1C4GA 1T6AA 3OSMA 2MJ7A 4ROEB 2Y8LA 1M5Q1 1D3UA 3DPTA 1K35A 2JOIA 4IL8A 3D4VA 3OGDA 1QNCA 1TGHA 1LWYA 1PZDA 5BMPA 1QN3A 3ENOC 1TBAB 2JPIA 1YQKA 2G30A 2EHBD 1TBPA 4RODB 2QRDA 1QN4A 2FGTA 3ASMA 1MPGA 1LWVA 2Z0FA 3TE5A 3EAYA 2HZMA 1QN6A 2NWVA 2NLVA 1HU0A 5F9CA 1PCJX 1NH2A 1J3MA 1PCMX 3OSTA 3RPJA 5HSHA 1FN7A 2V8QA 2Z8UA 4BJUA 3CWUA 2NOFA 3HS8A 4EAJA 1QNAA 3ENCA 1KYUA 4EAKA 3I0WA 2MZ8A 1MP9A 1Q9UA 1C47A 4EAIA 2HL8A 1C9BB 1TUOA 1RM1A 3CWSA 2O3OA 1B9KA 1UT7A 1R4XA 1XSZA 3KRMA 4Q11A 3OSEA 4HJHA 1VTLE 3NA5A 3I3WA 2H4LX 3T4NA 5IYCP 1DIZA 2OOYA 1EBMA 4WXAA 1LXTA 4EALA 1M3QA 4B0AA 3OH6A 2NOEA 1W80A 1VOKA 2FKFA 3I0XA 1YTFA 1VKLA 3ULXA 1N3AA 2NOHA 4EJZA 1VTOA 2YA3A 1YTBA 4QG5A 1QNBA 2DKAA 1UL7A 2NOBA 3CVTA 2R5XA 1V5SA 3CWTA 2YH5A 3D7QA 1NGMA 1JFIC 2I5WA 1PCZA 3CVSA 1YQRA 1M3HA 4PY5A 2NOIA 2QRCA 3UW2A 2HZSA 3IH7A 2IV8A 5IYBP 3BKQX 5KL0A 2FUVA 2F7LA 3EIKA
chains in the Genus database with same CATH topology
2D0CA 1KYDA 1UT4A 2IV9A 1QN7A 1YQMA 1QTPA 1CDWA 2NOLA 3F0ZA 5AN4A 2D0AA 1QNEA 1N39A 3N89A 2VJ0A 4TPSA 1KYFA 3OC3C 4DULA 4I8OA 3HS9A 3H1ZA 3VN5A 1QN8A 2D0BA 1NVPA 1VOLB 2XHIA 1E42A 4ROCB 3SNSA 1YQLA 3F10A 3OCIA 5IYDP 2LAEA 3KTUA 1AISA 4WZSD 1QN9A 1KO9A 2NOZA 3DPUA 4EJYA 1QN5A 1LWWA 1KY7A 1N3CA 1KY6A 3OSMA 1QTSA 4ROEB 2MJ7A 1D3UA 3DPTA 2JOIA 1QNCA 1TGHA 1LWYA 1PZDA 1QN3A 1YQKA 1TBAB 2G30A 1TBPA 4RODB 1QN4A 2FGTA 3ASMA 1LWVA 2HZMA 1QN6A 1HU0A 1NH2A 3OSTA 3RPJA 1FN7A 2Z8UA 2NOFA 3HS8A 1QNAA 1KYUA 3I0WA 2MZ8A 1MP9A 1C9BB 1RM1A 2O3OA 1B9KA 1R4XA 1UT7A 3KRMA 4Q11A 1VTLE 5IYCP 1EBMA 1M3QA 4B0AA 2NOEA 1W80A 1VOKA 3I0XA 1YTFA 3ULXA 1N3AA 2NOHA 4EJZA 1VTOA 1YTBA 1QNBA 2NOBA 2YH5A 1JFIC 1NGMA 2I5WA 1PCZA 1YQRA 1M3HA 4PY5A 2NOIA 2HZSA 3IH7A 2IV8A 5IYBP 3EIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZD A;  2D0C A;  1KYD A;  1VTL E;  1QN3 A;  5IYC P;  1TBA B;  2G30 A;  2IV9 A;  1QN7 A;  1TBP A;  4ROD B;  3OCI A;  1QN4 A;  3ASM A;  4B0A A;  1QTP A;  5IYD P;  1AIS A;  1W80 A;  4WZS D;  1VOK A;  1CDW A;  1QN9 A;  1YTF A;  1QNA A;  1QN6 A;  2D0A A;  1QNE A;  1NH2 A;  1VTO A;  1QN5 A;  2VJ0 A;  1YTB A;  1KYF A;  3OC3 C;  1QNB A;  2Z8U A;  3HS8 A;  1KY7 A;  1KY6 A;  1QTS A;  1JFI C;  4ROE B;  1NGM A;  2MJ7 A;  1KYU A;  1PCZ A;  3H1Z A;  3HS9 A;  3VN5 A;  1D3U A;  1MP9 A;  1QN8 A;  2D0B A;  1NVP A;  4PY5 A;  1VOL B;  1C9B B;  2IV8 A;  5IYB P;  4ROC B;  1RM1 A;  1QNC A;  1E42 A;  1B9K A;  1TGH A;  1R4X A;  3EIK A; 
#chains in the Genus database with same CATH topology
 2D0C A;  1KYD A;  4EAG A;  1UT4 A;  2QR1 A;  2QRE A;  1WQA A;  2IV9 A;  1QN7 A;  2V92 A;  3TDH A;  2V9J A;  1YQM A;  1QTP A;  3C04 A;  5JMV D;  3RSM A;  1CDW A;  2NOL A;  3F0Z A;  5AN4 A;  2D0A A;  1QNE A;  1N39 A;  2JHN A;  3N89 A;  1P5G X;  2VJ0 A;  4TPS A;  1KYF A;  3OC3 C;  4DUL A;  3CWA A;  2FKM X;  4I8O A;  1KFI A;  3H1Z A;  3HS9 A;  3VN5 A;  1EUV A;  1QN8 A;  2D0B A;  1JDY A;  1NVP A;  3CW7 A;  1VOL B;  2OOX A;  3OH9 A;  3PMG A;  1KFQ A;  2XHI A;  1E42 A;  2DKD A;  4ROC B;  3SNS A;  5EPC A;  2QLV A;  2HKP A;  3PDK A;  2ZFD B;  1YQL A;  1PVS A;  2DKC A;  4C7P A;  3F10 A;  1WJW A;  2H5A X;  2HL9 A;  3OCI A;  2PWW A;  2LAE A;  5IYD P;  3KTU A;  1AIS A;  4WZS D;  1QN9 A;  4D7R A;  1K2Y X;  4CFF A;  1KO9 A;  2NOZ A;  3DPU A;  2Y8Q A;  4MRQ A;  1P5D X;  4D7Q A;  1QN5 A;  4EJY A;  2NVM A;  4WX8 A;  1LWW A;  5BMN A;  3OLP A;  5JN5 A;  1KY7 A;  1N3C A;  1KY6 A;  2JHJ A;  1QTS A;  1C4G A;  1T6A A;  3OSM A;  2MJ7 A;  4ROE B;  2Y8L A;  1M5Q 1;  1D3U A;  3DPT A;  1K35 A;  2JOI A;  4IL8 A;  3D4V A;  3OGD A;  1QNC A;  1TGH A;  1LWY A;  1PZD A;  5BMP A;  1QN3 A;  3ENO C;  1TBA B;  2JPI A;  1YQK A;  2G30 A;  2EHB D;  1TBP A;  4ROD B;  2QRD A;  1QN4 A;  2FGT A;  3ASM A;  1MPG A;  1LWV A;  2Z0F A;  3TE5 A;  3EAY A;  2HZM A;  1QN6 A;  2NWV A;  2NLV A;  1HU0 A;  5F9C A;  1PCJ X;  1NH2 A;  1J3M A;  1PCM X;  3OST A;  3RPJ A;  5HSH A;  1FN7 A;  2V8Q A;  2Z8U A;  4BJU A;  3CWU A;  2NOF A;  3HS8 A;  4EAJ A;  1QNA A;  3ENC A;  1KYU A;  4EAK A;  3I0W A;  2MZ8 A;  1MP9 A;  1Q9U A;  1C47 A;  4EAI A;  2HL8 A;  1C9B B;  1TUO A;  1RM1 A;  3CWS A;  2O3O A;  1B9K A;  1UT7 A;  1R4X A;  1XSZ A;  3KRM A;  4Q11 A;  3OSE A;  4HJH A;  1VTL E;  3NA5 A;  3I3W A;  2H4L X;  3T4N A;  5IYC P;  1DIZ A;  2OOY A;  1EBM A;  4WXA A;  1LXT A;  4EAL A;  1M3Q A;  4B0A A;  3OH6 A;  2NOE A;  1W80 A;  1VOK A;  2FKF A;  3I0X A;  1YTF A;  1VKL A;  3ULX A;  1N3A A;  2NOH A;  4EJZ A;  1VTO A;  2YA3 A;  1YTB A;  4QG5 A;  1QNB A;  2DKA A;  1UL7 A;  2NOB A;  3CVT A;  2R5X A;  1V5S A;  3CWT A;  2YH5 A;  3D7Q A;  1NGM A;  1JFI C;  2I5W A;  1PCZ A;  3CVS A;  1YQR A;  1M3H A;  4PY5 A;  2NOI A;  2QRC A;  3UW2 A;  2HZS A;  3IH7 A;  2IV8 A;  5IYB P;  3BKQ X;  5KL0 A;  2FUV A;  2F7L A;  3EIK A; 
#chains in the Genus database with same CATH homology
 2D0C A;  1KYD A;  1UT4 A;  2IV9 A;  1QN7 A;  1YQM A;  1QTP A;  1CDW A;  2NOL A;  3F0Z A;  5AN4 A;  2D0A A;  1QNE A;  1N39 A;  3N89 A;  2VJ0 A;  4TPS A;  1KYF A;  3OC3 C;  4DUL A;  4I8O A;  3HS9 A;  3H1Z A;  3VN5 A;  1QN8 A;  2D0B A;  1NVP A;  1VOL B;  2XHI A;  1E42 A;  4ROC B;  3SNS A;  1YQL A;  3F10 A;  3OCI A;  5IYD P;  2LAE A;  3KTU A;  1AIS A;  4WZS D;  1QN9 A;  1KO9 A;  2NOZ A;  3DPU A;  4EJY A;  1QN5 A;  1LWW A;  1KY7 A;  1N3C A;  1KY6 A;  3OSM A;  1QTS A;  4ROE B;  2MJ7 A;  1D3U A;  3DPT A;  2JOI A;  1QNC A;  1TGH A;  1LWY A;  1PZD A;  1QN3 A;  1YQK A;  1TBA B;  2G30 A;  1TBP A;  4ROD B;  1QN4 A;  2FGT A;  3ASM A;  1LWV A;  2HZM A;  1QN6 A;  1HU0 A;  1NH2 A;  3OST A;  3RPJ A;  1FN7 A;  2Z8U A;  2NOF A;  3HS8 A;  1QNA A;  1KYU A;  3I0W A;  2MZ8 A;  1MP9 A;  1C9B B;  1RM1 A;  2O3O A;  1B9K A;  1R4X A;  1UT7 A;  3KRM A;  4Q11 A;  1VTL E;  5IYC P;  1EBM A;  1M3Q A;  4B0A A;  2NOE A;  1W80 A;  1VOK A;  3I0X A;  1YTF A;  3ULX A;  1N3A A;  2NOH A;  4EJZ A;  1VTO A;  1YTB A;  1QNB A;  2NOB A;  2YH5 A;  1JFI C;  1NGM A;  2I5W A;  1PCZ A;  1YQR A;  1M3H A;  4PY5 A;  2NOI A;  2HZS A;  3IH7 A;  2IV8 A;  5IYB P;  3EIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...