2LAEA

Nmr solution structure of the c-terminal domain of the e. coli lipoprotein bamc
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
DVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAFSKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Lipoprotein 34
publication title Structure of the BamC Two-Domain Protein Obtained by Rosetta with a Limited NMR Data Set.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2011-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.170 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2laeA00
3SNSA 2LAEA 2YH5A
chains in the Genus database with same CATH superfamily
1PVSA 1QN3A 5IYDP 1YQRA 2NOLA 1DIZA 4ROCB 2MJ7A 1KFQA 2XHIA 2FKFA 1VKLA 1QNCA 1TBPA 1QTPA 3D7QA 1VTOA 3OSMA 1RM1A 2H4LX 1AISA 4QG5A 3D4VA 2Y8QA 1J3MA 5HSHA 1EUVA 1YQMA 1QN6A 4DULA 4EAGA 1UT7A 1M3QA 3DPUA 1KYDA 4Q11A 2IV9A 4CFFA 1TUOA 4HJHA 3CVSA 3F10A 1V5SA 3EAYA 2HZSA 5AN4A 3PDKA 4RODB 1M5Q1 1MPGA 1TBAB 5JN5A 2O3OA 3OSTA 3OCIA 2MZ8A 1JDYA 4EAKA 1C4GA 2FKMX 2V8QA 4B0AA 1B9KA 3OH9A 2R5XA 2D0BA 1N3CA 4EJZA 4PY5A 3RSMA 3BKQX 1VTLE 1YQLA 2NOEA 2QRCA 1KO9A 3EIKA 2V9JA 1MP9A 5BMNA 2NOBA 1QTSA 3SNSA 2JHNA 4EAIA 4IL8A 3OSEA 1YTFA 2NOIA 1LXTA 2YA3A 3TDHA 2QRDA 1NVPA 1YTBA 2NOFA 3ENCA 2FUVA 4EALA 2F7LA 1LWYA 1QN9A 1CDWA 2EHBD 3I0WA 2QREA 1UL7A 1KYFA 1QNAA 2D0AA 3OH6A 1P5DX 3HS9A 1N39A 4MRQA 1PZDA 1KY7A 1LWWA 1C9BB 2ZFDB 4WZSD 1TGHA 3CWSA 2D0CA 3KTUA 3H1ZA 2OOXA 1HU0A 4EAJA 2G30A 1QN8A 2V92A 3TE5A 5F9CA 1YQKA 4I8OA 1WJWA 3OLPA 3CWUA 2DKAA 2Z8UA 3F0ZA 3KRMA 1QN5A 3OC3C 1VOLB 1QN7A 3I0XA 2H5AX 2Y8LA 2JHJA 2NOZA 2HL8A 4WXAA 3ULXA 1T6AA 3C04A 3OGDA 3IH7A 1N3AA 3CWTA 1PCJX 3HS8A 1KYUA 1Q9UA 4D7QA 3VN5A 1R4XA 4TPSA 2NVMA 1QNBA 2DKCA 1JFIC 2JPIA 2PWWA 5JMVD 1C47A 1QN4A 3NA5A 1P5GX 3DPTA 4C7PA 5IYCP 2NOHA 2NWVA 3N89A 2HL9A 2Z0FA 3PMGA 2HKPA 2JOIA 1D3UA 1NGMA 4D7RA 1PCZA 5EPCA 1K35A 3CWAA 1M3HA 4EJYA 3ASMA 1KFIA 1PCMX 1UT4A 2QR1A 4WX8A 2OOYA 2I5WA 1LWVA 1EBMA 5KL0A 5BMPA 1QNEA 3UW2A 2IV8A 5IYBP 1VOKA 1W80A 2FGTA 2LAEA 1KY6A 3RPJA 4ROEB 1WQAA 1FN7A 3I3WA 1NH2A 1K2YX 3CVTA 3CW7A 2NLVA 4BJUA 2DKDA 2VJ0A 3T4NA 2QLVA 1XSZA 1E42A 3ENOC 2HZMA 2YH5A
chains in the Genus database with same CATH topology
1QN3A 5IYDP 1YQRA 2NOLA 4ROCB 2MJ7A 2NOEA 2XHIA 1QNCA 1TBPA 1QTPA 1VTOA 3OSMA 1RM1A 1AISA 1YQMA 1QN6A 4DULA 1UT7A 1M3QA 3DPUA 1KYDA 4Q11A 2IV9A 2YH5A 3F10A 2HZSA 5AN4A 4RODB 1TBAB 2O3OA 3OSTA 3OCIA 2MZ8A 4B0AA 1B9KA 4EJZA 2D0BA 1N3CA 4PY5A 1VTLE 1YQLA 1KO9A 3EIKA 1MP9A 2NOBA 1QTSA 3SNSA 1YTFA 2NOIA 1YTBA 1NVPA 2NOFA 1LWYA 1QN9A 1CDWA 3I0WA 1QNAA 1KYFA 2D0AA 3HS9A 1N39A 1PZDA 1KY7A 1LWWA 1C9BB 1TGHA 4WZSD 2D0CA 3KTUA 3H1ZA 1HU0A 2G30A 1QN8A 1YQKA 4I8OA 2Z8UA 3F0ZA 3KRMA 1QN5A 3OC3C 1VOLB 1QN7A 3I0XA 2NOZA 3ULXA 1N3AA 3IH7A 3HS8A 1KYUA 3VN5A 1R4XA 4TPSA 1QNBA 1JFIC 1QN4A 5IYCP 3N89A 2JOIA 1D3UA 1NGMA 1PCZA 1M3HA 4EJYA 3ASMA 1UT4A 2I5WA 1LWVA 1EBMA 1QNEA 5IYBP 2IV8A 1VOKA 1W80A 2FGTA 2LAEA 1KY6A 3RPJA 4ROEB 1FN7A 2NOHA 1NH2A 2VJ0A 1E42A 2HZMA 3DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SNS A;  2LAE A;  2YH5 A; 
#chains in the Genus database with same CATH topology
 1PVS A;  1QN3 A;  5IYD P;  1YQR A;  2NOL A;  1DIZ A;  4ROC B;  2MJ7 A;  1KFQ A;  2XHI A;  2FKF A;  1VKL A;  1QNC A;  1TBP A;  1QTP A;  3D7Q A;  1VTO A;  3OSM A;  1RM1 A;  2H4L X;  1AIS A;  4QG5 A;  3D4V A;  2Y8Q A;  1J3M A;  5HSH A;  1EUV A;  1YQM A;  1QN6 A;  4DUL A;  4EAG A;  1UT7 A;  1M3Q A;  3DPU A;  1KYD A;  4Q11 A;  2IV9 A;  4CFF A;  1TUO A;  4HJH A;  3CVS A;  3F10 A;  1V5S A;  3EAY A;  2HZS A;  5AN4 A;  3PDK A;  4ROD B;  1M5Q 1;  1MPG A;  1TBA B;  5JN5 A;  2O3O A;  3OST A;  3OCI A;  2MZ8 A;  1JDY A;  4EAK A;  1C4G A;  2FKM X;  2V8Q A;  4B0A A;  1B9K A;  3OH9 A;  2R5X A;  2D0B A;  1N3C A;  4EJZ A;  4PY5 A;  3RSM A;  3BKQ X;  1VTL E;  1YQL A;  2NOE A;  2QRC A;  1KO9 A;  3EIK A;  2V9J A;  1MP9 A;  5BMN A;  2NOB A;  1QTS A;  3SNS A;  2JHN A;  4EAI A;  4IL8 A;  3OSE A;  1YTF A;  2NOI A;  1LXT A;  2YA3 A;  3TDH A;  2QRD A;  1NVP A;  1YTB A;  2NOF A;  3ENC A;  2FUV A;  4EAL A;  2F7L A;  1LWY A;  1QN9 A;  1CDW A;  2EHB D;  3I0W A;  2QRE A;  1UL7 A;  1KYF A;  1QNA A;  2D0A A;  3OH6 A;  1P5D X;  3HS9 A;  1N39 A;  4MRQ A;  1PZD A;  1KY7 A;  1LWW A;  1C9B B;  2ZFD B;  4WZS D;  1TGH A;  3CWS A;  2D0C A;  3KTU A;  3H1Z A;  2OOX A;  1HU0 A;  4EAJ A;  2G30 A;  1QN8 A;  2V92 A;  3TE5 A;  5F9C A;  1YQK A;  4I8O A;  1WJW A;  3OLP A;  3CWU A;  2DKA A;  2Z8U A;  3F0Z A;  3KRM A;  1QN5 A;  3OC3 C;  1VOL B;  1QN7 A;  3I0X A;  2H5A X;  2Y8L A;  2JHJ A;  2NOZ A;  2HL8 A;  4WXA A;  3ULX A;  1T6A A;  3C04 A;  3OGD A;  3IH7 A;  1N3A A;  3CWT A;  1PCJ X;  3HS8 A;  1KYU A;  1Q9U A;  4D7Q A;  3VN5 A;  1R4X A;  4TPS A;  2NVM A;  1QNB A;  2DKC A;  1JFI C;  2JPI A;  2PWW A;  5JMV D;  1C47 A;  1QN4 A;  3NA5 A;  1P5G X;  3DPT A;  4C7P A;  5IYC P;  2NOH A;  2NWV A;  3N89 A;  2HL9 A;  2Z0F A;  3PMG A;  2HKP A;  2JOI A;  1D3U A;  1NGM A;  4D7R A;  1PCZ A;  5EPC A;  1K35 A;  3CWA A;  1M3H A;  4EJY A;  3ASM A;  1KFI A;  1PCM X;  1UT4 A;  2QR1 A;  4WX8 A;  2OOY A;  2I5W A;  1LWV A;  1EBM A;  5KL0 A;  5BMP A;  1QNE A;  3UW2 A;  2IV8 A;  5IYB P;  1VOK A;  1W80 A;  2FGT A;  2LAE A;  1KY6 A;  3RPJ A;  4ROE B;  1WQA A;  1FN7 A;  3I3W A;  1NH2 A;  1K2Y X;  3CVT A;  3CW7 A;  2NLV A;  4BJU A;  2DKD A;  2VJ0 A;  3T4N A;  2QLV A;  1XSZ A;  1E42 A;  3ENO C;  2HZM A;  2YH5 A; 
#chains in the Genus database with same CATH homology
 1QN3 A;  5IYD P;  1YQR A;  2NOL A;  4ROC B;  2MJ7 A;  2NOE A;  2XHI A;  1QNC A;  1TBP A;  1QTP A;  1VTO A;  3OSM A;  1RM1 A;  1AIS A;  1YQM A;  1QN6 A;  4DUL A;  1UT7 A;  1M3Q A;  3DPU A;  1KYD A;  4Q11 A;  2IV9 A;  2YH5 A;  3F10 A;  2HZS A;  5AN4 A;  4ROD B;  1TBA B;  2O3O A;  3OST A;  3OCI A;  2MZ8 A;  4B0A A;  1B9K A;  4EJZ A;  2D0B A;  1N3C A;  4PY5 A;  1VTL E;  1YQL A;  1KO9 A;  3EIK A;  1MP9 A;  2NOB A;  1QTS A;  3SNS A;  1YTF A;  2NOI A;  1YTB A;  1NVP A;  2NOF A;  1LWY A;  1QN9 A;  1CDW A;  3I0W A;  1QNA A;  1KYF A;  2D0A A;  3HS9 A;  1N39 A;  1PZD A;  1KY7 A;  1LWW A;  1C9B B;  1TGH A;  4WZS D;  2D0C A;  3KTU A;  3H1Z A;  1HU0 A;  2G30 A;  1QN8 A;  1YQK A;  4I8O A;  2Z8U A;  3F0Z A;  3KRM A;  1QN5 A;  3OC3 C;  1VOL B;  1QN7 A;  3I0X A;  2NOZ A;  3ULX A;  1N3A A;  3IH7 A;  3HS8 A;  1KYU A;  3VN5 A;  1R4X A;  4TPS A;  1QNB A;  1JFI C;  1QN4 A;  5IYC P;  3N89 A;  2JOI A;  1D3U A;  1NGM A;  1PCZ A;  1M3H A;  4EJY A;  3ASM A;  1UT4 A;  2I5W A;  1LWV A;  1EBM A;  1QNE A;  5IYB P;  2IV8 A;  1VOK A;  1W80 A;  2FGT A;  2LAE A;  1KY6 A;  3RPJ A;  4ROE B;  1FN7 A;  2NOH A;  1NH2 A;  2VJ0 A;  1E42 A;  2HZM A;  3DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...