1T6AA

Crystal structure of protein of unknown function from bacillus stearothermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
AMNTDLKLPAGKTMTIEDVKQLLERYQMALKKTGEQLGWAYEQAAFPYTVRIHESVLYLQGDGRLYKGMAISVRTAGEETFIDIALPPGATHGDKGKANEFSKWLAKTLGGELHLFSGRTMVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords RBSTP2229 gene product
publication title X-ray crystal structure of hypothetical protein (RBSTP2229 gene product) from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08968 DUF1885 Domain of unknown function (DUF1885)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.850 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Rbstp2229 protein 1t6aA01
3.30.310.120 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Rbstp2229 like protein 1t6aA02
1T6AA
chains in the Genus database with same CATH superfamily
4D6TJ 1ZW0A 2R5DA 1T6AA 2WMMA 3CCVP 1T2KC 2HL9A 1GW3A 5K5GB 3SWFA 3M9QA 2YO2A 3G9RA 1QN3A 3GF7A 2NOHA 1LTIC 2JP3A 2ZJSE 1UT7A 3CWAA 2QJKC 3L74J 5AW1B 1DEEG 1VTLE 2Q6QA 2NPSA 1LT9B 1T3UA 1FS0E 1L0NJ 3L71E 1LTGC 3CWBD 4H13C 1KYUA 2L5GB 2QJPB 1YQMA 2B88A 3CCRP 1OZHA 2WSCH 2IBZD 1M3HA 5AW2B 4IL8A 4PD4E 2WPVB 3U1CA 1NTMJ 3JC22 1H88A 2XHIA 3AE5C 4HKZH 3VMZA 1M56D 1PFIA 1B9KA 1AVYA 3CCLP 2HPCB 2EHBD 4O9BA 2JKVA 5KLVE 4MN4C 1KY6A 1BE3D 2RH0A 2V4HA 3DPUA 3TF5A 1L0LG 4A7PA 4GOFA 3H1KD 5H2FE 3V4WA 1VQ5P 1LWVA 5DJUB 2W27A 3BCCJ 1G2CA 3E1IA 3VN0A 1SQQG 2ZYGA 2A06E 4I2LC 3C8VA 5BVZA 4U3FJ 1OWAA 2WZ7A 4AQRD 5KLVK 3FWNA 5EPCA 4H44C 2P7JA 3TNUA 1HH0A 1YTZI 5CCHA 2LR2A 1S9KD 1AFOA 3FWLA 2G3AA 1EQ7A 2O3JA 4LLHA 1NKNA 2B9BA 3L75E 2R5BA 1ZP0C 2OYIA 3RPJA 3B5NA 2NPSB 1VKLA 3OSMA 3TSIA 1QL2A 4PV1C 4HYTB 4NPDA 1X9VA 1YJ9P 2Y9ZA 2H5AX 3L37A 2V9JA 1EDLA 2E43A 1KYOI 2OYOA 1QNAA 3KRMA 3HS9A 3H1LD 4W80A 1FZBA 1YTBA 2IZ1A 2DKCA 2V7QJ 2JWAA 1KYOH 5IYCP 4H0LD 2O3OA 5E79E 2YXQB 1BCCJ 5GTIH 3V6IA 1WMKA 1LWWA 2Y8LA 1HVVA 4W7YA 3CVSA 1VTOA 5APYA 3L72J 3AE1C 4EAGA 1SQBG 2WT7B 3W68A 3IN6A 1SFCA 1M1JC 2E76B 1T3JA 2FYUE 3CCJP 1RQVA 1G2CB 2XKMA 4UB6E 1GDTA 1NWQA 3D6YA 1QN8A 3WU2H 1VQLP 2PAJA 5L8RJ 2NOFA 1DD4A 1RF0C 5AVTB 2B89A 2PWWA 3NA5A 4ROCB 1NVOA 1UIXA 1JM0A 1M57D 3TNUB 2AXTE 3L73E 2LKMA 2POHA 1N39A 1J1EB 4HH2A 4OGQB 3CL3D 1S2EA 3NMDA 1SQPK 2D2CC 2FYUK 2WSCJ 3JCUH 3FXEA 1NJIQ 1S3JA 1OVRA 2ZXEB 4BWNA 2M0BA 1DD3A 1TBAB 1KILA 5DJTB 2HZSA 2QJKB 4WY4D 1PPJD 4DZOA 1NTKD 1EXJA 1YQLA 2W6BA 4L73A 3V2RA 5CCGA 1M7LA 2K1AA 1IC2A 3SWYA 1L0LD 3EQ2A 3B4SA 4I1LA 4EAJA 3H1IG 1YJWP 4H13B 3KZIH 5TISH 1ZRTD 1PGOA 1YI2P 1QEXA 3CXHD 1YTZT 1VQPP 2FKFA 3RBZA 1X79B 3H32A 2HLOA 1Q2NA 3NTNA 1J3MA 3CCEP 3GLMA 4Y99C 3CCQP 5AVZB 1ZV8A 5JMVD 3MP7B 5KLVJ 4EJYA 3B8EB 1UIIA 2QREA 1M90Q 1JB0J 1NO4A 5KL0A 1N7SD 4QMAA 1SQQE 4H13D 1NU1K 1JO5A 2QA4P 2KS1A 3HRNA 2K88A 1M1JA 2KXPB 1NTZD 3L74D 4KHXA 3CC7P 1XTGB 2YA3A 3MIWA 2JWDA 1LTTC 2G8YA 4B86A 1L0ND 1PCJX 1RF0A 2N1TC 1ZN5A 4H44B 3R2PA 1JCDA 3HE4A 2JR8A 1QTPA 2NOZA 2XV5A 1S5LH 5AN4A 1EZVD 3I56P 1NTMD 2AXCA 3L75J 3CD6P 2YKOA 3MHVA 1FJPA 1VL2A 3HTKA 4EAIA 3TGUD 2R32A 4DT0A 4PV1B 3L70D 2YMKA 5CBNA 1SQBD 3ULXA 3OH9A 1PCMX 3I5CA 2QE7H 3D71A 1J1DC 3CWBG 4H44D 2BASA 2WSFH 3H32B 1M8OB 3CVTA 3ZDMA 1ZXGA 2YNYA 2IBZG 1AQTA 1IFDA 4D7QA 3LIEA 2HZMA 1ZLLA 1MZ9A 1KQGB 4U3FD 2H8PD 2RKLA 2DKAA 1OW8A 1FJKA 2BCCE 3U1AA 4PV1D 4XE5B 1D7MA 1EDKA 2HKPA 5AW9B 1FC2C 1BE3G 2FYZA 2F7LA 3H1JD 2KS1B 2FXPA 3WUUA 2XDJA 1M1JB 1KILE 3H1KG 1SQPJ 4H0LC 2FYUJ 3RGUA 2FKMX 3EIKA 2JOIA 1LT1A 2QEXP 2V8QA 2ZFCA 2QRCA 3H1HD 3IH7A 4EJZA 2Q9IA 2GM4A 1JOCA 1SQXD 4WX8A 3VMYA 3USSA 3OC3C 3CMAP 3L73J 3H1ID 2E74C 1K9MQ 2V92A 3A0BH 2GUSA 1G1JA 3D70A 1KB9D 2Y8QA 2MJ7A 1KO9A 3G6EP 3RK2C 2IPPA 2D2CB 3PHLA 1KYDA 1TGHA 3AEAC 1P84I 3IR9A 2WPRA 1YITP 3CX5E 3FXDA 3HTKB 2JEEA 1GU4A 1KN7A 3HS8A 1P84H 5APVA 2KNCA 3F0ZA 3ASMA 2Q1KA 3L72D 3T4NA 3AE9C 2HPCA 2RMZA 2IZ0A 1BGYG 3UIAA 3CC4P 4JYBA 1T8ZA 1IFPA 1JY2N 3VP8A 2RN0A 2QG4A 2WPSA 1URQD 3D4VA 3H1LG 1V5SA 1LTBC 4WY4C 1HWTC 1HUCA 3C9IA 4IFFA 3N7NA 2P67A 1JY3O 4Y99B 2XU6A 5C39A 4I7ZC 3NFQA 1MUUA 1SQQJ 4RKUJ 4Z1MH 1KFNA 4YPCA 2FYNC 1IK9A 2ITAA 1A02F 1KFMA 3MTUE 2D0AA 1FAVA 1WRGA 1YBKA 2WPQA 1LNQA 2I5WA 1H0TB 2N1TB 3AEDC 1N7SC 4KJMA 4HJGH 3GHGC 2WSFJ 1AA0A 1L2PA 1CI6A 4W7ZA 4WWIA 2KNCB 3RL0g 4UB8E 1RHZB 4D7RA 4XFJA 2YKQA 3CWBE 2JHJA 4ROEB 1VQOP 1RF1C 1AVOA 3IF4A 2KOGA 2D0BA 1PPJG 1N8RQ 3C1LA 4WB4A 1NTKG 2IBZE 1CSBA 1LTAC 2H89C 1BDDA 3PDKA 5HSHA 2N1TD 4PD4I 1J1DB 2R44A 3QH9A 3PH0A 2WT7A 2OOYA 2IX7C 1NYHA 4PD4H 3MUDC 1JDYA 5KLIC 3EFGA 2CK3H 3SSUA 3KTUA 5APSA 1BE3E 2KSEA 2QR1A 4WY4A 2B87A 1E42A 3H1KE 4ZKPA 2LAEA 4HB1A 2BCCJ 1PP9G 5APTA 3ENOC 5JN5A 1S1CX 2NOIA 1IO4A 1IZNB 1YQ4C 1CDWA 1RE4C 1W2BO 5H2FH 5AVSB 1R5SA 4YXWH 4H0LB 1KYOD 1WQAA 4DCKA 2Z5IA 2NOLA 4WBAA 1NTZG 5APXA 1GMJA 2FGTA 3L74G 1QX8A 2A45I 4EOTA 1KC8Q 3R4YA 3Q2YA 2DW3A 1VQMP 1L0NG 2HODA 1BGYD 2E74B 2A45H 1N7SA 1W80A 3RK2B 2ZT9D 1CI6B 3Q5PA 4M3LA 1CW5A 1ZOYC 1EZVG 1NTMG 3BATA 1GTWA 1N3CA 1LJ2A 2OYHC 3V2NA 1EXIA 1IFNA 4JYCA 4RJTA 3TGUG 4PY5A 3LIDA 1JNMA 1Q7YQ 4YXDC 3TK1A 3L70G 1SQVD 1RF1A 5AVQB 3H1LE 3WMM0 2E74D 1HJ0A 1SQPD 2HG5D 2WSEJ 2Z0FA 1FZEA 3C04A 1VQNP 3RK2D 1HGZA 2QSIA 4WY4B 5E79H 3MUDA 2B87B 2I1JA 4U3FG 1H89A 2P1JA 3VN5A 2OOXA 3GW6A 4OVNF 5B66E 2GA1A 3S4RA 4I7ZB 2E5TA 3OA7A 1PIXA 3H1JG 3OH6A 4C7NA 2P10A 1URQC 4IL6E 1GW4A 3TE5A 3T97B 3KDPB 2FYNB 5GTHE 3AECC 1NAFA 4UB6H 1RE4A 3S1KA 1BSHA 3PRJA 2ZXXA 3VOPA 1KQSO 3EWKA 1IFMA 3IFMA 3CLQA 1FN7A 3WUVA 2DKDA 3H1HG 1VQ6P 4CFFA 1LGHB 3P8MC 1SQXG 3RK3D 2HODB 4NPFX 2O01N 2AXTH 1MP9A 3CCSP 3L71J 1N7SB 5B66H 2FFDC 1WT6A 2KZIA 1Y9BA 1YYCA 3V4QA 1KQFB 2NRGA 1N3AA 3N89A 1NU1D 3GHGB 5B5EE 1QLED 2KLVA 3A3YB 2N9YB 4ZMDA 1PPJE 1VDFA 3CPWO 1NTKE 3OSEA 1FDIA 1BCCG 1NVPA 1QTSA 2XZRA 1MKMA 2ZYDA 1L4AD 3CWUA 1L0LE 2OTJP 2OYHA 3CWBJ 3K5BA 1OMIA 1GL2D 2KK7A 1ZRTE 2ZYAA 1RF1B 1PP9D 3CXHE 3L72G 2NVMA 3ITKA 1DH3A 1HTLC 1J2JB 1PVSA 4D6TD 2ZVNB 1TBPA 3DPTA 3CWTA 3AEFC 3CWSA 5BU8B 2WVRA 1VPCA 4HJHA 5KTBA 2QRDA 2QRXA 3NXSA 4EAKA 5KLIB 2IDBA 1SP4A 1L0LK 1BE3J 3Q3DA 3P32A 3W67A 1YQRA 3H1KJ 4PJ0E 1UL7A 3HD7D 2OTLP 5KAIE 4JQ0D 2J59M 4C7NB 4TPSA 1SQQK 2I8DA 2NLVA 5AW7B 1NTZE 2UWJE 5KKZC 1R8EA 2R3SA 1FZCC 3L74E 2AEJA 1FU1A 2J5UA 2O1KA 4WVZA 5AVWB 3SNSA 2WQYC 1OX3A 1URQA 3RL0D 4IOIH 1L0NE 1DIPA 1KD1Q 1GD2E 1AJYA 3VTPC 4IL6X 2K37A 1IJDB 3A0HE 2OGUA 1KZUB 3AE2C 1QVFO 4N78D 1VOKA 5KAIH 1KORA 3P8CE 3ABVC 1EZVE 1NTME 2NOEA 2Y0CA 5AW4B 2Q3IA 3F89A 3KYQA 2FFDA 2AEMA 4GT1A 1NAYA 3BCCD 3TGUE 2C9LY 2JO1A 1YIJP 3L70E 3GF3A 2OYHB 1QNCA 3SWKA 2QM7A 1SQBE 1IK7A 1N73C 1NGMB 5AVYB 1QNBA 3F10A 5APWA 5KLVG 5KAFE 2R5XA 3HE5A 1Q82Q 3H1LJ 2ZT9C 1JY3P 1D3UA 5APUA 3H1ZA 2LXCB 5IYDP 1PV3A 1K35A 3M0DC 2PGDA 4BJUA 4U3FE 2K9JA 3CCUP 3EAYA 3BKQX 1K05A 1DIZA 5AVUB 3FX0A 1P84D 2OTKE 1SQBK 1OFCX 1E79H 2Y9YA 2W6JH 3Q1MA 1MPGA 3H1JE 1PCZA 2NOBA 1YJNP 1RY3A 1C9BB 1JCCA 5KAFH 1QVGO 4OWFA 4R4LA 1H0TA 2N1TA 4I6MC 1LP1A 3A7OA 5BU5A 2KIKA 2Q7CA 2XNXA 2ZAEB 3H1HE 1YQ3C 1URQB 1SQXE 4JBZA 4AYCA 1FZCA 4N3YB 3I0XA 1BCCD 3Q5RA 3GMAA 3VMXA 1VF5D 1XSZA 3H1IE 1PGQA 1W2EA 2Z5HA 3I55P 5AW0B 3TDKA 1K8AQ 3BASA 1XTCC 1KB9E 1U7MA 2K9YA 2G30A 1EUVA 1VQ8P 3G4SP 2FFDB 3CX5I 3E7KA 1LWYA 1PZDA 1Q86Q 1PGPA 2HYNA 3GG2A 4I8OA 2QIWA 3CX5H 3L72E 1NTKJ 1HGVA 3RK3C 1KQLA 4TT3H 3WUTA 1MFZA 1L0LJ 2M3EA 2FXOA 1IFJA 3OCIA 4C7RA 1KB9H 3HE5B 1H8AA 3G71P 3OW2O 4IFDK 1QNEA 3M0AA 3PLNA 1SQVG 2E75D 2CPBA 3ENCA 5AW5B 2NWVA 2WSEH 2K9JB 1AISA 2KZJA 2O01J 1SQPG 2FYUG 1NOHA 3L4FA 4GKGA 1L4AC 5CCHC 1OXZA 2XNDH 3AEBC 1GL2C 1QN5A 5CJ0A 3U59A 3L71D 2OYIC 1JMBA 3L73G 3M91A 3B5NC 3M9BA 1JTHB 1LP1B 3AE4C 1JY2P 3A2AA 3AE3C 5F9CA 2YMYA 1NTZJ 3AEGC 2QLVA 2E5YA 5KKZB 1FZCB 2FUVA 3D7QA 4PD4D 1NHLA 2MKVA 4YTPC 3V5BA 4XA4A 3O6QB 3BRTB 2IV9A 1Y8AA 1VQKP 3HD7C 2P2UA 5KLVD 3A5TA 1PGJA 1PZQA 5CBOA 3PP5A 3HUSC 1KY7A 4IFMA 3RL0C 2KB7P 5APQA 1K73Q 1NU1G 3II6A 3TGUJ 1RE3C 3SFEC 5KJ7D 3L70J 2IFNA 2A06D 4UB8H 1NH4A 1SFCC 2IBZI 4C46A 1SQBJ 4C7PA 1X0TA 1QGKB 1N73B 1VQ4P 4TLFA 5CHXA 5EFWB 4ZKUA 3I0WA 2P58A 2Z8UA 2Q3EA 4EI2A 2M5AA 1USEA 2ZT9B 4ASVA 1N7LA 1JFIC 4D6TG 3SFDC 1YQKA 1QN4A 3L75D 4JF7A 2WWWA 1KV4A 3T97A 1TUOA 3G3ZA 1OIPA 1JY2O 4GIFA 1L4AA 1GL2A 3MGNA 3H1JJ 2FXMA 1S9KE 4L75A 1BSNA 1KILC 2C9NY 1KYOE 1N86A 3CI9A 3CMEP 2IV8A 1R4XA 5GTIE 3H1HJ 4JPZB 4DOJA 3PMGA 2JHNA 5CCGC 1SQXJ 3MD0A 1JEKA 3GHGA 1X22A 2JPIA 1OVUA 5AW6B 4OH8B 2W90A 2WSSH 3LW5J 1FZAA 3H1IJ 1BGYE 3O8ZA 3V2PA 3RSMA 3P7KA 5TJHA 3HD7A 1KMIZ 1PL5A 3OAKA 3AEEC 3BVHA 1QN9A 3WU2E 2FYUD 2QM8A 2OQQA 3AE8C 3HUSA 2NPSD 3CC2P 1VF5C 1EBMA 1Q9UA 5CJ4A 3BCCG 2YXRB 2W6AA 2Y0DA 1RE3A 1SQVE 3RK3B 1TU3F 4Q11A 1KYFA 4EDFA 3MZWB 4GDOA 1JUNA 3L73D 4B0AA 1MV8A 1SQPE 3JCUE 3N4XA 2M5AB 2BCCG 1FOSE 2W83C 1C4GA 2C0XA 1EDIA 4MRQA 1S72P 4BXLA 2Z4EA 2C0WA 1Z56A 1QN7A 1U57A 1LTSC 2BEQD 3CW7A 2ZFDB 2KYVA 2E42A 3D6ZA 2SPZA 1ZMEC 3VYIA 1L4AB 1NKZB 1SQVK 1LTJC 4L74A 1LWUC 5TISE 3KZIE 1GL2B 1E5WA 4U7JA 4BRYA 5BMPA 3B71A 2D0CA 2OYIB 2E75C 3B5NB 1VQ9P 2E76D 2K3RA 2IYPA 4RO0A 2YIUC 4WXAA 2HFED 4IL6H 5GTHH 3JSVC 3RK3E 3FGAD 3TYYA 4EYYQ 1P5GX 2QJYC 3H25A 5CCHD 4CPGA 1M5Q1 3HD7B 2MZ8A 2L91A 4OGQD 2O1JA 1NU1E 1NGMA 1OVVA 2W8ZA 1T2KD 1SQQD 3B5ND 3HUSB 2GUVA 1AV1A 1CZQA 1GK4A 4N6JA 4NPEA 5B5EH 3RL0B 3VMAA 2H4LX 1NTKK 1GU5A 3AE7C 1RQUA 1PP9E 3CXHI 1SFCB 1U7JA 4D6TE 1NH2A 2KSJA 3QWOC 1Y47A 1VOLB 1S5LE 3CXHH 1KTMA 2JJLA 2H43A 4EIJA 4ASWA 1Q90D 2HL8A 3OSTA 4EALA 2J58A 4R4MA 2O01H 2PFXA 5AW3B 1VQ7P 5KJ7C 2FBWC 1LT9C 4DJGA 1KFIA 1FBMA 3CCMP 2QVAA 2PRRA 3RBXA 3L36A 4BRYB 2WTYA 1HBWA 1R5LA 2PP6A 1EC5A 2LXBA 2QJPC 1LTJA 1SFCD 5CMZA 1LWUA 4ZNCA 1AQ5A 2H88C 3H6PA 3P8CD 1BDCA 4PJ0H 3IAOA 3L71G 3OGDA 1JY3N 2WITA 1KILB 1NTZK 2R3CA 2M8RA 1QL1A 2IFMA 4LC1A 1MFTA 2NZ2A 1W5CE 4GOEA 1L0NK 3KQGA 1FDMA 4N78E 3A0HH 2MJZA 1BGYJ 1EZVI 2CPSA 2BCCD 1USDA 1Q81Q 1NTMK 3BCCE 1P5DX 3BRVB 3M06A 5AVXB 1KILD 2VJ0A 2YKPA 2HR3A 3PJSK 4RESB 1K04A 1VF5B 3EFFK 3PTZA 5CCGD 2Y0EA 1G1IA 3A0BE 2JDIH 1SQVJ 2A06G 3OJAB 3OLPA 1K2YX 1EDJA 1JMMA 1M3QA 2AEFA 1IFIA 1N2DC 2A45G 4QG5A 1JTHA 5AVRB 2NPSC 1S5LX 3UW2A 1P84E 2M3BA 1UT4A 3CX5D 3L75G 1ZR4A 2KUBA 5KJ7A 3HE4B 1RH5B 1LT9A 2YH5A 1LTJB 4K35A 1LWUB 1WJWA 1OW6A 4Y28J 1DEBA 2FKWB 1YHQP 2I1KA 2IYOA 1SLQA 3O6QA 1RM1A 3M9HA 1S4XA 2YO3A 4LGDE 2E75B 4GODA 2OARA 1X8YA 1GK6A 1FE6A 5IYBP 5AVVB 2YIUB 1BCCE 1HJBA 2BEZF 4K3AA 1A02J 1HF9A 2KI7B 3L35A 1SQXK 1SS1A 2N9BA 3S9OA 5BMNA 2H7HA 3KPEA 1KB9I 4AUWA 1LXTA 2KP8A 1GZLA 4RODB 2FY8A 2QJYB 3LW5H 1FZGA 5AW8B 2Q5UA 1FDOA 3E1RA 2E76C 1FOSF 4KT0J 1YTFA 2VRSA 1NU1J 1M1KQ 1N73A 1KFQA 1C47A 2D2CD 3KHUA 2V7QH 1FZFA 3I3WA 1OW7A 3KXDA 3VP9A 1ZR2A 1DX7A 3V2QA 1HU0A 4DULA 3AE6C 2KLUA 3TDHA 4WZSD 3M0DA 5M1BA 4L76A 1PP9J 1J1EC 3F5HA 4OGQC 3Q5SA 1SVFA 1QN6A 2ZVOB
chains in the Genus database with same CATH topology
1T6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6A A; 
#chains in the Genus database with same CATH topology
 4D6T J;  1ZW0 A;  2R5D A;  1T6A A;  2WMM A;  3CCV P;  1T2K C;  2HL9 A;  1GW3 A;  5K5G B;  3SWF A;  3M9Q A;  2YO2 A;  3G9R A;  1QN3 A;  3GF7 A;  2NOH A;  1LTI C;  2JP3 A;  2ZJS E;  1UT7 A;  3CWA A;  2QJK C;  3L74 J;  5AW1 B;  1DEE G;  1VTL E;  2Q6Q A;  2NPS A;  1LT9 B;  1T3U A;  1FS0 E;  1L0N J;  3L71 E;  1LTG C;  3CWB D;  4H13 C;  1KYU A;  2L5G B;  2QJP B;  1YQM A;  2B88 A;  3CCR P;  1OZH A;  2WSC H;  2IBZ D;  1M3H A;  5AW2 B;  4IL8 A;  4PD4 E;  2WPV B;  3U1C A;  1NTM J;  3JC2 2;  1H88 A;  2XHI A;  3AE5 C;  4HKZ H;  3VMZ A;  1M56 D;  1PFI A;  1B9K A;  1AVY A;  3CCL P;  2HPC B;  2EHB D;  4O9B A;  2JKV A;  5KLV E;  4MN4 C;  1KY6 A;  1BE3 D;  2RH0 A;  2V4H A;  3DPU A;  3TF5 A;  1L0L G;  4A7P A;  4GOF A;  3H1K D;  5H2F E;  3V4W A;  1VQ5 P;  1LWV A;  5DJU B;  2W27 A;  3BCC J;  1G2C A;  3E1I A;  3VN0 A;  1SQQ G;  2ZYG A;  2A06 E;  4I2L C;  3C8V A;  5BVZ A;  4U3F J;  1OWA A;  2WZ7 A;  4AQR D;  5KLV K;  3FWN A;  5EPC A;  4H44 C;  2P7J A;  3TNU A;  1HH0 A;  1YTZ I;  5CCH A;  2LR2 A;  1S9K D;  1AFO A;  3FWL A;  2G3A A;  1EQ7 A;  2O3J A;  4LLH A;  1NKN A;  2B9B A;  3L75 E;  2R5B A;  1ZP0 C;  2OYI A;  3RPJ A;  3B5N A;  2NPS B;  1VKL A;  3OSM A;  3TSI A;  1QL2 A;  4PV1 C;  4HYT B;  4NPD A;  1X9V A;  1YJ9 P;  2Y9Z A;  2H5A X;  3L37 A;  2V9J A;  1EDL A;  2E43 A;  1KYO I;  2OYO A;  1QNA A;  3KRM A;  3HS9 A;  3H1L D;  4W80 A;  1FZB A;  1YTB A;  2IZ1 A;  2DKC A;  2V7Q J;  2JWA A;  1KYO H;  5IYC P;  4H0L D;  2O3O A;  5E79 E;  2YXQ B;  1BCC J;  5GTI H;  3V6I A;  1WMK A;  1LWW A;  2Y8L A;  1HVV A;  4W7Y A;  3CVS A;  1VTO A;  5APY A;  3L72 J;  3AE1 C;  4EAG A;  1SQB G;  2WT7 B;  3W68 A;  3IN6 A;  1SFC A;  1M1J C;  2E76 B;  1T3J A;  2FYU E;  3CCJ P;  1RQV A;  1G2C B;  2XKM A;  4UB6 E;  1GDT A;  1NWQ A;  3D6Y A;  1QN8 A;  3WU2 H;  1VQL P;  2PAJ A;  5L8R J;  2NOF A;  1DD4 A;  1RF0 C;  5AVT B;  2B89 A;  2PWW A;  3NA5 A;  4ROC B;  1NVO A;  1UIX A;  1JM0 A;  1M57 D;  3TNU B;  2AXT E;  3L73 E;  2LKM A;  2POH A;  1N39 A;  1J1E B;  4HH2 A;  4OGQ B;  3CL3 D;  1S2E A;  3NMD A;  1SQP K;  2D2C C;  2FYU K;  2WSC J;  3JCU H;  3FXE A;  1NJI Q;  1S3J A;  1OVR A;  2ZXE B;  4BWN A;  2M0B A;  1DD3 A;  1TBA B;  1KIL A;  5DJT B;  2HZS A;  2QJK B;  4WY4 D;  1PPJ D;  4DZO A;  1NTK D;  1EXJ A;  1YQL A;  2W6B A;  4L73 A;  3V2R A;  5CCG A;  1M7L A;  2K1A A;  1IC2 A;  3SWY A;  1L0L D;  3EQ2 A;  3B4S A;  4I1L A;  4EAJ A;  3H1I G;  1YJW P;  4H13 B;  3KZI H;  5TIS H;  1ZRT D;  1PGO A;  1YI2 P;  1QEX A;  3CXH D;  1YTZ T;  1VQP P;  2FKF A;  3RBZ A;  1X79 B;  3H32 A;  2HLO A;  1Q2N A;  3NTN A;  1J3M A;  3CCE P;  3GLM A;  4Y99 C;  3CCQ P;  5AVZ B;  1ZV8 A;  5JMV D;  3MP7 B;  5KLV J;  4EJY A;  3B8E B;  1UII A;  2QRE A;  1M90 Q;  1JB0 J;  1NO4 A;  5KL0 A;  1N7S D;  4QMA A;  1SQQ E;  4H13 D;  1NU1 K;  1JO5 A;  2QA4 P;  2KS1 A;  3HRN A;  2K88 A;  1M1J A;  2KXP B;  1NTZ D;  3L74 D;  4KHX A;  3CC7 P;  1XTG B;  2YA3 A;  3MIW A;  2JWD A;  1LTT C;  2G8Y A;  4B86 A;  1L0N D;  1PCJ X;  1RF0 A;  2N1T C;  1ZN5 A;  4H44 B;  3R2P A;  1JCD A;  3HE4 A;  2JR8 A;  1QTP A;  2NOZ A;  2XV5 A;  1S5L H;  5AN4 A;  1EZV D;  3I56 P;  1NTM D;  2AXC A;  3L75 J;  3CD6 P;  2YKO A;  3MHV A;  1FJP A;  1VL2 A;  3HTK A;  4EAI A;  3TGU D;  2R32 A;  4DT0 A;  4PV1 B;  3L70 D;  2YMK A;  5CBN A;  1SQB D;  3ULX A;  3OH9 A;  1PCM X;  3I5C A;  2QE7 H;  3D71 A;  1J1D C;  3CWB G;  4H44 D;  2BAS A;  2WSF H;  3H32 B;  1M8O B;  3CVT A;  3ZDM A;  1ZXG A;  2YNY A;  2IBZ G;  1AQT A;  1IFD A;  4D7Q A;  3LIE A;  2HZM A;  1ZLL A;  1MZ9 A;  1KQG B;  4U3F D;  2H8P D;  2RKL A;  2DKA A;  1OW8 A;  1FJK A;  2BCC E;  3U1A A;  4PV1 D;  4XE5 B;  1D7M A;  1EDK A;  2HKP A;  5AW9 B;  1FC2 C;  1BE3 G;  2FYZ A;  2F7L A;  3H1J D;  2KS1 B;  2FXP A;  3WUU A;  2XDJ A;  1M1J B;  1KIL E;  3H1K G;  1SQP J;  4H0L C;  2FYU J;  3RGU A;  2FKM X;  3EIK A;  2JOI A;  1LT1 A;  2QEX P;  2V8Q A;  2ZFC A;  2QRC A;  3H1H D;  3IH7 A;  4EJZ A;  2Q9I A;  2GM4 A;  1JOC A;  1SQX D;  4WX8 A;  3VMY A;  3USS A;  3OC3 C;  3CMA P;  3L73 J;  3H1I D;  2E74 C;  1K9M Q;  2V92 A;  3A0B H;  2GUS A;  1G1J A;  3D70 A;  1KB9 D;  2Y8Q A;  2MJ7 A;  1KO9 A;  3G6E P;  3RK2 C;  2IPP A;  2D2C B;  3PHL A;  1KYD A;  1TGH A;  3AEA C;  1P84 I;  3IR9 A;  2WPR A;  1YIT P;  3CX5 E;  3FXD A;  3HTK B;  2JEE A;  1GU4 A;  1KN7 A;  3HS8 A;  1P84 H;  5APV A;  2KNC A;  3F0Z A;  3ASM A;  2Q1K A;  3L72 D;  3T4N A;  3AE9 C;  2HPC A;  2RMZ A;  2IZ0 A;  1BGY G;  3UIA A;  3CC4 P;  4JYB A;  1T8Z A;  1IFP A;  1JY2 N;  3VP8 A;  2RN0 A;  2QG4 A;  2WPS A;  1URQ D;  3D4V A;  3H1L G;  1V5S A;  1LTB C;  4WY4 C;  1HWT C;  1HUC A;  3C9I A;  4IFF A;  3N7N A;  2P67 A;  1JY3 O;  4Y99 B;  2XU6 A;  5C39 A;  4I7Z C;  3NFQ A;  1MUU A;  1SQQ J;  4RKU J;  4Z1M H;  1KFN A;  4YPC A;  2FYN C;  1IK9 A;  2ITA A;  1A02 F;  1KFM A;  3MTU E;  2D0A A;  1FAV A;  1WRG A;  1YBK A;  2WPQ A;  1LNQ A;  2I5W A;  1H0T B;  2N1T B;  3AED C;  1N7S C;  4KJM A;  4HJG H;  3GHG C;  2WSF J;  1AA0 A;  1L2P A;  1CI6 A;  4W7Z A;  4WWI A;  2KNC B;  3RL0 g;  4UB8 E;  1RHZ B;  4D7R A;  4XFJ A;  2YKQ A;  3CWB E;  2JHJ A;  4ROE B;  1VQO P;  1RF1 C;  1AVO A;  3IF4 A;  2KOG A;  2D0B A;  1PPJ G;  1N8R Q;  3C1L A;  4WB4 A;  1NTK G;  2IBZ E;  1CSB A;  1LTA C;  2H89 C;  1BDD A;  3PDK A;  5HSH A;  2N1T D;  4PD4 I;  1J1D B;  2R44 A;  3QH9 A;  3PH0 A;  2WT7 A;  2OOY A;  2IX7 C;  1NYH A;  4PD4 H;  3MUD C;  1JDY A;  5KLI C;  3EFG A;  2CK3 H;  3SSU A;  3KTU A;  5APS A;  1BE3 E;  2KSE A;  2QR1 A;  4WY4 A;  2B87 A;  1E42 A;  3H1K E;  4ZKP A;  2LAE A;  4HB1 A;  2BCC J;  1PP9 G;  5APT A;  3ENO C;  5JN5 A;  1S1C X;  2NOI A;  1IO4 A;  1IZN B;  1YQ4 C;  1CDW A;  1RE4 C;  1W2B O;  5H2F H;  5AVS B;  1R5S A;  4YXW H;  4H0L B;  1KYO D;  1WQA A;  4DCK A;  2Z5I A;  2NOL A;  4WBA A;  1NTZ G;  5APX A;  1GMJ A;  2FGT A;  3L74 G;  1QX8 A;  2A45 I;  4EOT A;  1KC8 Q;  3R4Y A;  3Q2Y A;  2DW3 A;  1VQM P;  1L0N G;  2HOD A;  1BGY D;  2E74 B;  2A45 H;  1N7S A;  1W80 A;  3RK2 B;  2ZT9 D;  1CI6 B;  3Q5P A;  4M3L A;  1CW5 A;  1ZOY C;  1EZV G;  1NTM G;  3BAT A;  1GTW A;  1N3C A;  1LJ2 A;  2OYH C;  3V2N A;  1EXI A;  1IFN A;  4JYC A;  4RJT A;  3TGU G;  4PY5 A;  3LID A;  1JNM A;  1Q7Y Q;  4YXD C;  3TK1 A;  3L70 G;  1SQV D;  1RF1 A;  5AVQ B;  3H1L E;  3WMM 0;  2E74 D;  1HJ0 A;  1SQP D;  2HG5 D;  2WSE J;  2Z0F A;  1FZE A;  3C04 A;  1VQN P;  3RK2 D;  1HGZ A;  2QSI A;  4WY4 B;  5E79 H;  3MUD A;  2B87 B;  2I1J A;  4U3F G;  1H89 A;  2P1J A;  3VN5 A;  2OOX A;  3GW6 A;  4OVN F;  5B66 E;  2GA1 A;  3S4R A;  4I7Z B;  2E5T A;  3OA7 A;  1PIX A;  3H1J G;  3OH6 A;  4C7N A;  2P10 A;  1URQ C;  4IL6 E;  1GW4 A;  3TE5 A;  3T97 B;  3KDP B;  2FYN B;  5GTH E;  3AEC C;  1NAF A;  4UB6 H;  1RE4 A;  3S1K A;  1BSH A;  3PRJ A;  2ZXX A;  3VOP A;  1KQS O;  3EWK A;  1IFM A;  3IFM A;  3CLQ A;  1FN7 A;  3WUV A;  2DKD A;  3H1H G;  1VQ6 P;  4CFF A;  1LGH B;  3P8M C;  1SQX G;  3RK3 D;  2HOD B;  4NPF X;  2O01 N;  2AXT H;  1MP9 A;  3CCS P;  3L71 J;  1N7S B;  5B66 H;  2FFD C;  1WT6 A;  2KZI A;  1Y9B A;  1YYC A;  3V4Q A;  1KQF B;  2NRG A;  1N3A A;  3N89 A;  1NU1 D;  3GHG B;  5B5E E;  1QLE D;  2KLV A;  3A3Y B;  2N9Y B;  4ZMD A;  1PPJ E;  1VDF A;  3CPW O;  1NTK E;  3OSE A;  1FDI A;  1BCC G;  1NVP A;  1QTS A;  2XZR A;  1MKM A;  2ZYD A;  1L4A D;  3CWU A;  1L0L E;  2OTJ P;  2OYH A;  3CWB J;  3K5B A;  1OMI A;  1GL2 D;  2KK7 A;  1ZRT E;  2ZYA A;  1RF1 B;  1PP9 D;  3CXH E;  3L72 G;  2NVM A;  3ITK A;  1DH3 A;  1HTL C;  1J2J B;  1PVS A;  4D6T D;  2ZVN B;  1TBP A;  3DPT A;  3CWT A;  3AEF C;  3CWS A;  5BU8 B;  2WVR A;  1VPC A;  4HJH A;  5KTB A;  2QRD A;  2QRX A;  3NXS A;  4EAK A;  5KLI B;  2IDB A;  1SP4 A;  1L0L K;  1BE3 J;  3Q3D A;  3P32 A;  3W67 A;  1YQR A;  3H1K J;  4PJ0 E;  1UL7 A;  3HD7 D;  2OTL P;  5KAI E;  4JQ0 D;  2J59 M;  4C7N B;  4TPS A;  1SQQ K;  2I8D A;  2NLV A;  5AW7 B;  1NTZ E;  2UWJ E;  5KKZ C;  1R8E A;  2R3S A;  1FZC C;  3L74 E;  2AEJ A;  1FU1 A;  2J5U A;  2O1K A;  4WVZ A;  5AVW B;  3SNS A;  2WQY C;  1OX3 A;  1URQ A;  3RL0 D;  4IOI H;  1L0N E;  1DIP A;  1KD1 Q;  1GD2 E;  1AJY A;  3VTP C;  4IL6 X;  2K37 A;  1IJD B;  3A0H E;  2OGU A;  1KZU B;  3AE2 C;  1QVF O;  4N78 D;  1VOK A;  5KAI H;  1KOR A;  3P8C E;  3ABV C;  1EZV E;  1NTM E;  2NOE A;  2Y0C A;  5AW4 B;  2Q3I A;  3F89 A;  3KYQ A;  2FFD A;  2AEM A;  4GT1 A;  1NAY A;  3BCC D;  3TGU E;  2C9L Y;  2JO1 A;  1YIJ P;  3L70 E;  3GF3 A;  2OYH B;  1QNC A;  3SWK A;  2QM7 A;  1SQB E;  1IK7 A;  1N73 C;  1NGM B;  5AVY B;  1QNB A;  3F10 A;  5APW A;  5KLV G;  5KAF E;  2R5X A;  3HE5 A;  1Q82 Q;  3H1L J;  2ZT9 C;  1JY3 P;  1D3U A;  5APU A;  3H1Z A;  2LXC B;  5IYD P;  1PV3 A;  1K35 A;  3M0D C;  2PGD A;  4BJU A;  4U3F E;  2K9J A;  3CCU P;  3EAY A;  3BKQ X;  1K05 A;  1DIZ A;  5AVU B;  3FX0 A;  1P84 D;  2OTK E;  1SQB K;  1OFC X;  1E79 H;  2Y9Y A;  2W6J H;  3Q1M A;  1MPG A;  3H1J E;  1PCZ A;  2NOB A;  1YJN P;  1RY3 A;  1C9B B;  1JCC A;  5KAF H;  1QVG O;  4OWF A;  4R4L A;  1H0T A;  2N1T A;  4I6M C;  1LP1 A;  3A7O A;  5BU5 A;  2KIK A;  2Q7C A;  2XNX A;  2ZAE B;  3H1H E;  1YQ3 C;  1URQ B;  1SQX E;  4JBZ A;  4AYC A;  1FZC A;  4N3Y B;  3I0X A;  1BCC D;  3Q5R A;  3GMA A;  3VMX A;  1VF5 D;  1XSZ A;  3H1I E;  1PGQ A;  1W2E A;  2Z5H A;  3I55 P;  5AW0 B;  3TDK A;  1K8A Q;  3BAS A;  1XTC C;  1KB9 E;  1U7M A;  2K9Y A;  2G30 A;  1EUV A;  1VQ8 P;  3G4S P;  2FFD B;  3CX5 I;  3E7K A;  1LWY A;  1PZD A;  1Q86 Q;  1PGP A;  2HYN A;  3GG2 A;  4I8O A;  2QIW A;  3CX5 H;  3L72 E;  1NTK J;  1HGV A;  3RK3 C;  1KQL A;  4TT3 H;  3WUT A;  1MFZ A;  1L0L J;  2M3E A;  2FXO A;  1IFJ A;  3OCI A;  4C7R A;  1KB9 H;  3HE5 B;  1H8A A;  3G71 P;  3OW2 O;  4IFD K;  1QNE A;  3M0A A;  3PLN A;  1SQV G;  2E75 D;  2CPB A;  3ENC A;  5AW5 B;  2NWV A;  2WSE H;  2K9J B;  1AIS A;  2KZJ A;  2O01 J;  1SQP G;  2FYU G;  1NOH A;  3L4F A;  4GKG A;  1L4A C;  5CCH C;  1OXZ A;  2XND H;  3AEB C;  1GL2 C;  1QN5 A;  5CJ0 A;  3U59 A;  3L71 D;  2OYI C;  1JMB A;  3L73 G;  3M91 A;  3B5N C;  3M9B A;  1JTH B;  1LP1 B;  3AE4 C;  1JY2 P;  3A2A A;  3AE3 C;  5F9C A;  2YMY A;  1NTZ J;  3AEG C;  2QLV A;  2E5Y A;  5KKZ B;  1FZC B;  2FUV A;  3D7Q A;  4PD4 D;  1NHL A;  2MKV A;  4YTP C;  3V5B A;  4XA4 A;  3O6Q B;  3BRT B;  2IV9 A;  1Y8A A;  1VQK P;  3HD7 C;  2P2U A;  5KLV D;  3A5T A;  1PGJ A;  1PZQ A;  5CBO A;  3PP5 A;  3HUS C;  1KY7 A;  4IFM A;  3RL0 C;  2KB7 P;  5APQ A;  1K73 Q;  1NU1 G;  3II6 A;  3TGU J;  1RE3 C;  3SFE C;  5KJ7 D;  3L70 J;  2IFN A;  2A06 D;  4UB8 H;  1NH4 A;  1SFC C;  2IBZ I;  4C46 A;  1SQB J;  4C7P A;  1X0T A;  1QGK B;  1N73 B;  1VQ4 P;  4TLF A;  5CHX A;  5EFW B;  4ZKU A;  3I0W A;  2P58 A;  2Z8U A;  2Q3E A;  4EI2 A;  2M5A A;  1USE A;  2ZT9 B;  4ASV A;  1N7L A;  1JFI C;  4D6T G;  3SFD C;  1YQK A;  1QN4 A;  3L75 D;  4JF7 A;  2WWW A;  1KV4 A;  3T97 A;  1TUO A;  3G3Z A;  1OIP A;  1JY2 O;  4GIF A;  1L4A A;  1GL2 A;  3MGN A;  3H1J J;  2FXM A;  1S9K E;  4L75 A;  1BSN A;  1KIL C;  2C9N Y;  1KYO E;  1N86 A;  3CI9 A;  3CME P;  2IV8 A;  1R4X A;  5GTI E;  3H1H J;  4JPZ B;  4DOJ A;  3PMG A;  2JHN A;  5CCG C;  1SQX J;  3MD0 A;  1JEK A;  3GHG A;  1X22 A;  2JPI A;  1OVU A;  5AW6 B;  4OH8 B;  2W90 A;  2WSS H;  3LW5 J;  1FZA A;  3H1I J;  1BGY E;  3O8Z A;  3V2P A;  3RSM A;  3P7K A;  5TJH A;  3HD7 A;  1KMI Z;  1PL5 A;  3OAK A;  3AEE C;  3BVH A;  1QN9 A;  3WU2 E;  2FYU D;  2QM8 A;  2OQQ A;  3AE8 C;  3HUS A;  2NPS D;  3CC2 P;  1VF5 C;  1EBM A;  1Q9U A;  5CJ4 A;  3BCC G;  2YXR B;  2W6A A;  2Y0D A;  1RE3 A;  1SQV E;  3RK3 B;  1TU3 F;  4Q11 A;  1KYF A;  4EDF A;  3MZW B;  4GDO A;  1JUN A;  3L73 D;  4B0A A;  1MV8 A;  1SQP E;  3JCU E;  3N4X A;  2M5A B;  2BCC G;  1FOS E;  2W83 C;  1C4G A;  2C0X A;  1EDI A;  4MRQ A;  1S72 P;  4BXL A;  2Z4E A;  2C0W A;  1Z56 A;  1QN7 A;  1U57 A;  1LTS C;  2BEQ D;  3CW7 A;  2ZFD B;  2KYV A;  2E42 A;  3D6Z A;  2SPZ A;  1ZME C;  3VYI A;  1L4A B;  1NKZ B;  1SQV K;  1LTJ C;  4L74 A;  1LWU C;  5TIS E;  3KZI E;  1GL2 B;  1E5W A;  4U7J A;  4BRY A;  5BMP A;  3B71 A;  2D0C A;  2OYI B;  2E75 C;  3B5N B;  1VQ9 P;  2E76 D;  2K3R A;  2IYP A;  4RO0 A;  2YIU C;  4WXA A;  2HFE D;  4IL6 H;  5GTH H;  3JSV C;  3RK3 E;  3FGA D;  3TYY A;  4EYY Q;  1P5G X;  2QJY C;  3H25 A;  5CCH D;  4CPG A;  1M5Q 1;  3HD7 B;  2MZ8 A;  2L91 A;  4OGQ D;  2O1J A;  1NU1 E;  1NGM A;  1OVV A;  2W8Z A;  1T2K D;  1SQQ D;  3B5N D;  3HUS B;  2GUV A;  1AV1 A;  1CZQ A;  1GK4 A;  4N6J A;  4NPE A;  5B5E H;  3RL0 B;  3VMA A;  2H4L X;  1NTK K;  1GU5 A;  3AE7 C;  1RQU A;  1PP9 E;  3CXH I;  1SFC B;  1U7J A;  4D6T E;  1NH2 A;  2KSJ A;  3QWO C;  1Y47 A;  1VOL B;  1S5L E;  3CXH H;  1KTM A;  2JJL A;  2H43 A;  4EIJ A;  4ASW A;  1Q90 D;  2HL8 A;  3OST A;  4EAL A;  2J58 A;  4R4M A;  2O01 H;  2PFX A;  5AW3 B;  1VQ7 P;  5KJ7 C;  2FBW C;  1LT9 C;  4DJG A;  1KFI A;  1FBM A;  3CCM P;  2QVA A;  2PRR A;  3RBX A;  3L36 A;  4BRY B;  2WTY A;  1HBW A;  1R5L A;  2PP6 A;  1EC5 A;  2LXB A;  2QJP C;  1LTJ A;  1SFC D;  5CMZ A;  1LWU A;  4ZNC A;  1AQ5 A;  2H88 C;  3H6P A;  3P8C D;  1BDC A;  4PJ0 H;  3IAO A;  3L71 G;  3OGD A;  1JY3 N;  2WIT A;  1KIL B;  1NTZ K;  2R3C A;  2M8R A;  1QL1 A;  2IFM A;  4LC1 A;  1MFT A;  2NZ2 A;  1W5C E;  4GOE A;  1L0N K;  3KQG A;  1FDM A;  4N78 E;  3A0H H;  2MJZ A;  1BGY J;  1EZV I;  2CPS A;  2BCC D;  1USD A;  1Q81 Q;  1NTM K;  3BCC E;  1P5D X;  3BRV B;  3M06 A;  5AVX B;  1KIL D;  2VJ0 A;  2YKP A;  2HR3 A;  3PJS K;  4RES B;  1K04 A;  1VF5 B;  3EFF K;  3PTZ A;  5CCG D;  2Y0E A;  1G1I A;  3A0B E;  2JDI H;  1SQV J;  2A06 G;  3OJA B;  3OLP A;  1K2Y X;  1EDJ A;  1JMM A;  1M3Q A;  2AEF A;  1IFI A;  1N2D C;  2A45 G;  4QG5 A;  1JTH A;  5AVR B;  2NPS C;  1S5L X;  3UW2 A;  1P84 E;  2M3B A;  1UT4 A;  3CX5 D;  3L75 G;  1ZR4 A;  2KUB A;  5KJ7 A;  3HE4 B;  1RH5 B;  1LT9 A;  2YH5 A;  1LTJ B;  4K35 A;  1LWU B;  1WJW A;  1OW6 A;  4Y28 J;  1DEB A;  2FKW B;  1YHQ P;  2I1K A;  2IYO A;  1SLQ A;  3O6Q A;  1RM1 A;  3M9H A;  1S4X A;  2YO3 A;  4LGD E;  2E75 B;  4GOD A;  2OAR A;  1X8Y A;  1GK6 A;  1FE6 A;  5IYB P;  5AVV B;  2YIU B;  1BCC E;  1HJB A;  2BEZ F;  4K3A A;  1A02 J;  1HF9 A;  2KI7 B;  3L35 A;  1SQX K;  1SS1 A;  2N9B A;  3S9O A;  5BMN A;  2H7H A;  3KPE A;  1KB9 I;  4AUW A;  1LXT A;  2KP8 A;  1GZL A;  4ROD B;  2FY8 A;  2QJY B;  3LW5 H;  1FZG A;  5AW8 B;  2Q5U A;  1FDO A;  3E1R A;  2E76 C;  1FOS F;  4KT0 J;  1YTF A;  2VRS A;  1NU1 J;  1M1K Q;  1N73 A;  1KFQ A;  1C47 A;  2D2C D;  3KHU A;  2V7Q H;  1FZF A;  3I3W A;  1OW7 A;  3KXD A;  3VP9 A;  1ZR2 A;  1DX7 A;  3V2Q A;  1HU0 A;  4DUL A;  3AE6 C;  2KLU A;  3TDH A;  4WZS D;  3M0D A;  5M1B A;  4L76 A;  1PP9 J;  1J1E C;  3F5H A;  4OGQ C;  3Q5S A;  1SVF A;  1QN6 A;  2ZVO B; 
#chains in the Genus database with same CATH homology
 1T6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...