1T6AA

Crystal structure of protein of unknown function from bacillus stearothermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
AMNTDLKLPAGKTMTIEDVKQLLERYQMALKKTGEQLGWAYEQAAFPYTVRIHESVLYLQGDGRLYKGMAISVRTAGEETFIDIALPPGATHGDKGKANEFSKWLAKTLGGELHLFSGRTMVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of hypothetical protein (RBSTP2229 gene product) from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
molecule keywords RBSTP2229 gene product
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08968 DUF1885 Domain of unknown function (DUF1885)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.850 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Rbstp2229 protein 1t6aA01
3.30.310.120 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Rbstp2229 like protein 1t6aA02
1T6AA
chains in the Genus database with same CATH superfamily
4RO0A 3KYQA 2B9BA 3CD6P 1KB9D 5B66H 3V6IA 3F89A 1PFIA 1CZQA 2IYOA 1N73C 1CSBA 1GL2A 2IX7C 3DPTA 2ZYAA 2Y0EA 3E1IA 4DULA 1L0LD 3CWBG 1QN7A 2FY8A 4EDFA 2JWDA 3RPJA 3N4XA 2BEQD 1OZHA 4L76A 3EQ2A 3A0HH 4DOJA 2HPCB 1FZCA 2PFXA 2WZ7A 3M06A 3L74E 3KQGA 2HKPA 4BJUA 5BU5A 3L36A 3NA5A 1LTJA 4IL6E 2FYZA 1SQPG 4H0LB 3B5NB 2M3BA 1E5WA 4I8OA 2GUSA 2KLVA 3CPWO 2KP8A 2H43A 1JDYA 4U3FG 4PD4D 3RGUA 3B4SA 2WQYC 2B89A 1D3UA 2OOYA 4WB4A 3FWLA 3O8ZA 2V7QJ 1LWUC 2E74C 3KDPB 1PIXA 1TUOA 1IK9A 3B5ND 2AEJA 4EJYA 3H1JE 2FYUE 2M0BA 2O1KA 4ZNCA 2Q1KA 4YXDC 3MUDC 5JN5A 2FXMA 4AYCA 1SP4A 2E5YA 1L4AA 3D4VA 2Q5UA 4HJHA 1GU5A 3PTZA 2QJPC 1VDFA 1Q90D 2QJYC 5KKZB 3PMGA 3P7KA 2HODB 4H13D 1X8YA 1FZCB 3CCUP 2OYHC 3L72E 1L0ND 3AE7C 1JY3O 1YTZI 2D2CC 1KYUA 1KORA 4PV1C 3EFGA 1KO9A 1GK4A 3AE8C 1SQBG 2HL9A 4BRYB 1IJDB 5C39A 3CX5I 3D7QA 4OVNF 1BE3J 2YO2A 1BSHA 3I3WA 1BDCA 1T6AA 2FUVA 3CXHD 2IFNA 4JYCA 5KLVK 1FOSE 4PV1D 1P5GX 3M0DA 2YNYA 4A7PA 1HJBA 1IFIA 4Z1MH 1SQQD 2MJZA 1DH3A 3A0BE 3D6YA 3F0ZA 4LGDE 4W7YA 5KLIB 1KB9E 2GA1A 5AN4A 1JTHB 2IPPA 4ASWA 1YIJP 1J1EB 4NPFX 2V8QA 4IOIH 2OYIA 1UT7A 2MKVA 2B87A 3H6PA 1L4AD 1UIXA 2KIKA 2IZ1A 2BCCG 1FJPA 4W80A 3PLNA 1SFCB 1EQ7A 4L75A 5APVA 5GTIH 4PD4I 2E75B 3EFFK 3CW7A 1FJKA 3AEBC 3CWAA 1S2EA 5AW4B 4EYYQ 3L75D 3HE4A 1OX3A 1NH4A 1NU1K 4JBZA 3TNUA 1DX7A 1OFCX 1Q81Q 5E79E 4OH8B 2Z5HA 3GHGC 3G4SP 2R3SA 1ZLLA 3G3ZA 5APUA 2R32A 1FN7A 3BCCG 3S4RA 3HS9A 1EBMA 5APTA 1KC8Q 1L0NJ 1QN6A 1NTMJ 2CPSA 3FXDA 2A45H 4Y28J 3H1HJ 3H1KJ 2VRSA 2E76D 1OVVA 2ZAEB 3JSVC 1LT9A 1T2KC 3AEDC 5CCGA 2QVAA 3JCUH 2R5XA 1IK7A 1WRGA 2LXCB 3L73D 4UB6H 1OW8A 5DJUB 1L0NK 1LNQA 1YQLA 1HGZA 5CBNA 1GD2E 2Y8QA 1ZRTE 2W90A 2YIUB 3HD7B 3MZWB 2B87B 1H8AA 2QREA 2E74D 2O3JA 2GM4A 2W6BA 3F10A 2ZFDB 1EDJA 5KJ7C 4PJ0E 4D7QA 4GOFA 3H1IG 1GZLA 3MD0A 3IAOA 1PPJG 1VTLE 2W6JH 2ZXXA 5TJHA 3CCEP 2KOGA 4D6TJ 1W5CE 4D6TD 2M8RA 4WBAA 3A5TA 3CX5D 1Z56A 4N6JA 2NPSD 2ZFCA 5IYCP 3H1JG 1GK6A 2W8ZA 5APWA 3L70J 5BMPA 5CCGD 1IC2A 2JHJA 2PGDA 2OYHA 1M1JB 1BE3G 2ZVNB 3V4WA 4I7ZC 4QG5A 1BGYJ 1SQBE 2FFDB 3VOPA 4WVZA 4OGQC 3HE5A 3CWBJ 2KB7P 1AJYA 4XFJA 3L73J 1JM0A 3KTUA 3OAKA 2E5TA 1NAYA 3QWOC 3HTKB 3OLPA 2Z4EA 1OW6A 4EAIA 3VMZA 1LWUA 2HZSA 1K9MQ 2YMYA 2RH0A 5AW6B 5L8RJ 3V2QA 2HZMA 3Q3DA 2ZJSE 1HH0A 2YMKA 1NYHA 3BRTB 2HG5D 1LWWA 2FFDC 1QGKB 3CWBD 4OWFA 5H2FE 5H2FH 3CL3D 1FZGA 1M8OB 1URQB 3H1LJ 2V92A 3OW2O 2KS1A 4RJTA 1GDTA 1Y47A 3VN5A 5AVQB 5M1BA 2K9YA 1G2CB 1OIPA 2NPSA 1P5DX 1HU0A 3C8VA 1VF5D 3PHLA 1KFMA 3ITKA 2K88A 2J59M 1IFPA 3TSIA 1NKNA 3CXHH 4GIFA 4D6TG 2RMZA 1Q86Q 1PVSA 3ENCA 1V5SA 3TGUE 1K73Q 1QVFO 2LXBA 3HE5B 3HD7C 1KQFB 1W2EA 1SQXK 1J2JB 3HTKA 1JTHA 1NTKG 1NU1E 1RF1C 2Y0DA 1AISA 3KHUA 2C9LY 2A06G 3A0HE 3O6QA 1KYOH 2K9JB 1KYOE 1LP1A 3AE3C 3L75E 2KXPB 2J5UA 2RKLA 1CDWA 4QMAA 2H88C 2BCCD 2C0WA 3W68A 4ROCB 1JNMA 1S1CX 4I1LA 2HPCA 3OH9A 3MUDA 2OYOA 3V2NA 3IF4A 3SFDC 3I56P 2WPRA 3BATA 5KJ7D 1M3QA 1NGMA 3RK2C 1QLED 4H0LD 3GHGB 2WTYA 3VTPC 3BASA 3Q1MA 2NOHA 4OGQD 3GG2A 3TGUG 5AVUB 1A02J 5CBOA 1NH2A 1JCCA 5KL0A 1SFCC 1S9KE 2XZRA 1ZRTD 2XDJA 4WXAA 1KYOI 4H44C 1OVRA 2ZYDA 1IO4A 1J1EC 3L73G 3GMAA 1HBWA 5AW9B 5BMNA 1LP1B 2OQQA 3ZDMA 3U1CA 3I0WA 4EAKA 2PP6A 3IFMA 3D70A 2KK7A 3VYIA 2Q3EA 2HR3A 2BEZF 2GUVA 1QNAA 2K3RA 3BRVB 4JYBA 4HB1A 4PD4E 1SQVD 3TK1A 1PPJD 4PD4H 1L2PA 2HL8A 3A2AA 3BVHA 4YPCA 1S5LX 3GLMA 4AQRD 3KPEA 2QIWA 4XA4A 1PP9J 1RF1A 1KQLA 2NOLA 4PV1B 1N3CA 2OYHB 1FZCC 2QLVA 2WMMA 5KKZC 1ZXGA 1S5LE 1XTCC 2QJPB 5APSA 3KZIH 1CI6B 1QX8A 4MRQA 2QSIA 4NPEA 1N39A 3MGNA 1S72P 1P84E 2QG4A 2IFMA 3B8EB 1VTOA 1CW5A 4H13B 1EDIA 4GODA 1SQQE 4B0AA 2NZ2A 1LWUB 2POHA 3OGDA 2OYIB 3HRNA 2XKMA 3BCCJ 2L5GB 1LJ2A 5CMZA 1NTMG 3VP9A 1RH5B 1N8RQ 3CVTA 1KYDA 2M5AA 4N78D 5GTHE 2QM7A 2IBZI 3OJAB 2A06E 1EZVG 2KS1B 2WWWA 1YQMA 4IL6X 4LC1A 2R5BA 4H0LC 2DW3A 3HS8A 1PPJE 1D7MA 5BU8B 3U59A 2AXCA 1RE3C 1NU1J 5KLVG 1EDKA 1JEKA 1ZR4A 3SWFA 5AW3B 4ZKUA 3MHVA 3SSUA 1AQTA 2O01H 2ZT9B 4GT1A 1DIZA 4IFMA 2VJ0A 3HUSA 1C9BB 1SQVG 1SQQJ 2BCCE 2FXOA 2AEMA 1N73B 2QR1A 2E75D 2D0CA 3Q2YA 4DZOA 1VQKP 2JOIA 2MZ8A 3D71A 4D7RA 2W83C 1PCZA 1FDMA 2KSJA 1QNEA 1NTKK 2Q6QA 1PCJX 5AVYB 4GKGA 2OTJP 4I2LC 2WVRA 1JO5A 3TDKA 2KNCB 3EWKA 4IL6H 3TGUJ 3P32A 3RL0g 1AV1A 2E76B 1FOSF 1BE3D 3CVSA 3H1HD 3H1KD 3AE5C 3M0DC 1NKZB 1H0TB 2WSEH 3CXHI 1GW4A 2WT7B 1IFDA 1S5LH 2J58A 2E43A 4PY5A 2FYUD 2B88A 1VQ7P 1PGJA 4HH2A 1N7SC 3VP8A 1SS1A 1P84H 3L75G 4IFFA 1EXJA 3AE2C 1WQAA 3CWTA 3W67A 1LTIC 3PDKA 5KAIH 1QN8A 4UB8H 4RODB 1RF0A 1YYCA 3WU2E 4DT0A 3WU2H 1LTJC 1RQVA 3RK3C 3CMAP 5EPCA 2N1TB 2Y9ZA 2DKAA 2FYNB 3AEAC 3AE9C 2N9BA 1GL2B 1L0LG 2F7LA 4KT0J 4KHXA 2ZXEB 1LTAC 3CCJP 4WX8A 2IZ0A 4C7NA 3RK3E 3L35A 2WSFJ 3V5BA 2LR2A 2H7HA 3KXDA 1Q7YQ 5CJ0A 4KJMA 2WSCH 1J3MA 2NOBA 1YTZT 2XV5A 3CCVP 1NTZK 2G3AA 4EJZA 3M9HA 2Z8UA 1PP9D 1YTBA 4XE5B 4LLHA 1CI6A 5F9CA 3KRMA 1SQPE 1KILE 1H89A 1SQVJ 3IH7A 5APQA 2QM8A 1ZOYC 4L73A 1BGYE 1SQBJ 2WPVB 3II6A 1QN4A 1FZBA 2YKPA 1C47A 5CCGC 1M57D 4WY4B 2FKMX 1C4GA 4DCKA 3H1ID 3R2PA 4B86A 3CX5E 1GL2C 3GW6A 1W2BO 1RQUA 1VKLA 1OW7A 1DD4A 3RK3B 3CWBE 5E79H 1LTJB 1T8ZA 1QN5A 1LTGC 1M3HA 2JHNA 3CLQA 2P2UA 2R5DA 3NTNA 2D0BA 1FBMA 3B5NA 1FS0E 1JMBA 2AEFA 1BCCE 1N7SB 3H25A 2P1JA 5CCHA 2Y9YA 2H8PD 3BCCD 1BE3E 1FDIA 2IBZG 3NFQA 5GTIE 1KV4A 2R44A 2MJ7A 1DIPA 5KAFE 2NOFA 1IFNA 3GF3A 1N73A 1VQLP 5APXA 2FFDA 3IR9A 3S9OA 1HTLC 5AW7B 3TGUD 2E76C 2PAJA 4RESB 2ZYGA 2LKMA 3FXEA 1HJ0A 1X22A 2UWJE 1B9KA 1YJ9P 1NTKJ 4TPSA 3WUTA 3H1JJ 1VQMP 2JJLA 1KZUB 1L0NG 3UIAA 3OC3C 4IFDK 4Y99C 1BCCG 5HSHA 3N7NA 3R4YA 5KLVE 1OXZA 1Y9BA 1IFMA 4BRYA 1SQXE 1NWQA 3TDHA 3H1HE 3H1KE 1UIIA 1M5Q1 1RHZB 3GF7A 2O3OA 1LT1A 2JO1A 1KMIZ 5BVZA 2K37A 3FWNA 1N3AA 1YTFA 2ZT9C 1UL7A 1IZNB 1N7LA 1SQVE 1U57A 1QTSA 2C9NY 2OTKE 1MP9A 3CMEP 1JB0J 2NRGA 2KSEA 4L74A 2WPSA 1SVFA 1OVUA 3OSTA 1L0LJ 1JOCA 1T3JA 2FYUK 3CCRP 2Q9IA 3G71P 2WSCJ 3ENOC 2N1TA 3VN0A 1JY2N 3H1IE 2JDIH 1GW3A 1AVOA 1A02F 2JWAA 1NTMD 1ZP0C 1BGYG 1AA0A 3EAYA 1VQ4P 3CWSA 1SQQG 1KFQA 1N2DC 1P84D 1W80A 1LWYA 3ASMA 1SQXG 2V9JA 2OYIC 3T97A 1R4XA 3WMM0 4H13C 1YJNP 1YJWP 1NJIQ 1KILD 1EZVI 3RL0C 5B66E 3CI9A 3GHGA 1T3UA 2Q7CA 1SQBK 3OH6A 3PH0A 2ZT9D 1GU4A 5AW1B 5B5EE 2NWVA 1FE6A 1QN3A 1VQPP 3HUSB 2EHBD 2KI7B 3RBXA 5IYDP 3L74J 1KQGB 3Q5SA 1P84I 3LW5H 3AE6C 3JC22 4N3YB 2WSEJ 1KILB 2OARA 2PWWA 1YBKA 3HD7A 2G8YA 1L4AB 2H5AX 1BSNA 4I6MC 1FDOA 2QJKC 3TE5A 1R5LA 1YHQP 1Y8AA 3MP7B 2IBZE 3OSMA 4H44D 2D2CD 2IV8A 3CCMP 2KNCA 4CPGA 4C7RA 1U7MA 2BASA 3AE1C 1EZVE 1SLQA 2WSSH 3SWYA 1USDA 3PP5A 1KYFA 3QH9A 3BCCE 3M9BA 1SQXD 5AW5B 1NOHA 3L37A 1PV3A 4IL8A 4GDOA 3T97B 4U3FJ 2A06D 2JPIA 3Q5PA 1M1JA 5CCHD 1MUUA 2Z0FA 3ABVC 2WT7A 4D6TE 4H44B 1LTTC 2NPSB 3LIEA 3M0AA 3WUVA 1VOKA 1GMJA 5KAIE 1PZQA 4NPDA 5APYA 3L72J 2O01J 3A3YB 5GTHH 5AVSB 2KZJA 3MTUE 3LW5J 1LT9B 3RK2B 1Q9UA 1NTME 2FXPA 2WPQA 2QRCA 1NTZG 1NVOA 2I8DA 3AECC 1EC5A 1J1DC 2O01N 3AEEC 5AVTB 3V2RA 3G9RA 1KB9I 1EXIA 3BKQX 1VQ5P 2YA3A 3E7KA 2M5AB 4HYTB 2HODA 1URQD 1PCMX 1YITP 1G1IA 1K8AQ 1RF1B 3SWKA 4HKZH 4TLFA 3TYYA 3V4QA 5AW0B 2KZIA 1ZR2A 1JY3N 5AVXB 2I1KA 3H1LE 2V4HA 3K5BA 1GTWA 4JPZB 2P67A 2ZVOB 1J1DB 2YO3A 1WJWA 3M91A 4Q11A 1VOLB 4C46A 1JMMA 1L0LE 1NTZE 4O9BA 3O6QB 1PGOA 2FKWB 2K9JA 1VQ6P 1LTBC 2NLVA 1FU1A 3NMDA 1LT9C 5JMVD 1KB9H 1NTKD 3L71G 2IBZD 1S3JA 1URQC 3CCQP 2HYNA 1NU1G 2YXQB 4GOEA 1NGMB 2LAEA 1LWVA 5AVRB 2NPSC 1R8EA 1DEEG 3CCLP 1KN7A 1RF0C 3L71J 1NO4A 3L74D 1FAVA 2YXRB 3CC7P 3HE4B 1X0TA 5K5GB 1E79H 3G6EP 1WT6A 1SQQK 1G2CA 2XNXA 1M1KQ 4DJGA 4OGQB 4TT3H 2YKQA 4RKUJ 2HLOA 1DD3A 2O1JA 2W27A 4WY4D 1AFOA 4K3AA 4I7ZB 1BCCJ 1BCCD 2QE7H 1QNCA 3LIDA 1HF9A 5TISE 2H89C 2FYUJ 3C1LA 1M1JC 5TISH 2YKOA 3H1LD 2QEXP 2KUBA 2QJKB 5AW8B 1L4AC 1RY3A 2JKVA 2H4LX 4ROEB 1X79B 5CCHC 1KILC 4JQ0D 1T2KD 3EIKA 2CK3H 4YTPC 1QTPA 1KFNA 1EUVA 3FX0A 4M3LA 1SFCA 3U1AA 3AEFC 1K05A 3HUSC 2JP3A 2NOZA 2W6AA 5CHXA 3ULXA 2N9YB 3L73E 1YQ3C 2FKFA 1M90Q 2A45G 1VL2A 3TNUB 4EI2A 1VQ8P 1M56D 2YIUC 3RL0B 1S4XA 1LGHB 3A0BH 2Z5IA 3L72D 3L4FA 4MN4C 1RE3A 1QVGO 4CFFA 1NHLA 4U3FE 4C7PA 2DKDA 3CWUA 1JUNA 2P7JA 1JCDA 3H32A 1MV8A 2P58A 3KZIE 2HFED 1S9KD 3C04A 1SQPK 4EAJA 1YQKA 3RL0D 2IYPA 1SQXJ 3L70E 1AVYA 1PZDA 4U7JA 2RN0A 2SPZA 1L0NE 2P10A 2BCCJ 5AVVB 5AW2B 3B71A 5DJTB 1SQBD 4YXWH 4ASVA 2IDBA 1QEXA 3P8MC 1G1JA 1IFJA 2E75C 1E42A 3VMYA 3Q5RA 1TBAB 1K35A 1QN9A 3PJSK 3OCIA 1KD1Q 3CXHE 5KJ7A 2IV9A 3CC4P 3L71E 4N78E 3SFEC 2E42A 2WSFH 3OSEA 1ZN5A 5KTBA 2NOEA 1MFTA 1SQPD 4ZMDA 4UB6E 4HJGH 5KLIC 1EDLA 1LTSC 1VQNP 1SFCD 1MPGA 1NTZD 4Y99B 1BGYD 2Y0CA 3VMXA 1WMKA 1OMIA 2KLUA 1MFZA 2YH5A 3I0XA 3PRJA 3L70G 3AEGC 1RE4C 2FYUG 1KY6A 2CPBA 1KILA 1FZEA 2AXTH 2K1AA 3N89A 4EAGA 4WY4A 4EALA 4W7ZA 1NVPA 3P8CE 2D2CB 3UW2A 1VQ9P 2M3EA 1VQOP 1URQA 4EOTA 1H88A 2OTLP 2QJYB 1UT4A 1K04A 3CCSP 3D6ZA 2QRDA 3I55P 1RM1A 1Q82Q 3H1ZA 3S1KA 4BXLA 4R4LA 1LXTA 3H1LG 3FGAD 2E74B 1H0TA 2DKCA 3L71D 4WWIA 1DEBA 3CX5H 5CJ4A 1BDDA 3A7OA 1YQRA 1N86A 4WZSD 5EFWB 3OA7A 5KAFH 1K2YX 2QA4P 3WUUA 1Q2NA 1PGPA 2G30A 2WITA 2XHIA 3B5NC 1TGHA 3L74G 4WY4C 1KFIA 1FZFA 3C9IA 2OGUA 1JY2P 2I5WA 5AVWB 3RSMA 3V2PA 2Q3IA 2Y8LA 1NU1D 1ZW0A 5KLVD 4EIJA 1ZV8A 3H1JD 2KYVA 3I5CA 1L0LK 4JF7A 2XNDH 1OWAA 3JCUE 2FBWC 3VMAA 2NOIA 4U3FD 1U7JA 1R5SA 3HD7D 1EZVD 4C7NB 1GL2D 1QL1A 1XTGB 1PL5A 1MKMA 3NXSA 1XSZA 4PJ0H 1FC2C 3AE4C 3H32B 1JFIC 1SQPJ 4K35A 3TF5A 4BWNA 2L91A 2C0XA 1TBPA 2OOXA 3RK2D 3USSA 1N7SA 2I1JA 2A45I 1MZ9A 1M7LA 4R4MA 3L75J 1PP9E 2JR8A 3L70D 3DPUA 4AUWA 2FYNC 1YQ4C 2N1TC 1KTMA 2AXTE 2R3CA 3L72G 1VF5B 2QRXA 1NTMK 1QL2A 2XU6A 1YI2P 3F5HA 1HWTC 3IN6A 1KQSO 3H1HG 3H1KG 2N1TD 1TU3F 5KLVJ 1USEA 3SNSA 3CC2P 1NAFA 1KYOD 2D0AA 2FGTA 4UB8E 4ZKPA 1RE4A 2NVMA 1NTKE 1PGQA 3M9QA 1JY2O 1NTZJ 1VPCA 1SQVK 1JY3P 1AQ5A 3E1RA 3RK3D 1HVVA 1QNBA 3RBZA 1ZMEC 1HGVA 1X9VA 5B5EH 3MIWA 1VF5C 5AVZB 3H1IJ 3T4NA 2V7QH 5IYBP 1KY7A 2PRRA 1N7SD 1FZAA 1PP9G 1HUCA 3P8CD 2ITAA 2JEEA
chains in the Genus database with same CATH topology
1T6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6A A; 
#chains in the Genus database with same CATH topology
 4RO0 A;  3KYQ A;  2B9B A;  3CD6 P;  1KB9 D;  5B66 H;  3V6I A;  3F89 A;  1PFI A;  1CZQ A;  2IYO A;  1N73 C;  1CSB A;  1GL2 A;  2IX7 C;  3DPT A;  2ZYA A;  2Y0E A;  3E1I A;  4DUL A;  1L0L D;  3CWB G;  1QN7 A;  2FY8 A;  4EDF A;  2JWD A;  3RPJ A;  3N4X A;  2BEQ D;  1OZH A;  4L76 A;  3EQ2 A;  3A0H H;  4DOJ A;  2HPC B;  1FZC A;  2PFX A;  2WZ7 A;  3M06 A;  3L74 E;  3KQG A;  2HKP A;  4BJU A;  5BU5 A;  3L36 A;  3NA5 A;  1LTJ A;  4IL6 E;  2FYZ A;  1SQP G;  4H0L B;  3B5N B;  2M3B A;  1E5W A;  4I8O A;  2GUS A;  2KLV A;  3CPW O;  2KP8 A;  2H43 A;  1JDY A;  4U3F G;  4PD4 D;  3RGU A;  3B4S A;  2WQY C;  2B89 A;  1D3U A;  2OOY A;  4WB4 A;  3FWL A;  3O8Z A;  2V7Q J;  1LWU C;  2E74 C;  3KDP B;  1PIX A;  1TUO A;  1IK9 A;  3B5N D;  2AEJ A;  4EJY A;  3H1J E;  2FYU E;  2M0B A;  2O1K A;  4ZNC A;  2Q1K A;  4YXD C;  3MUD C;  5JN5 A;  2FXM A;  4AYC A;  1SP4 A;  2E5Y A;  1L4A A;  3D4V A;  2Q5U A;  4HJH A;  1GU5 A;  3PTZ A;  2QJP C;  1VDF A;  1Q90 D;  2QJY C;  5KKZ B;  3PMG A;  3P7K A;  2HOD B;  4H13 D;  1X8Y A;  1FZC B;  3CCU P;  2OYH C;  3L72 E;  1L0N D;  3AE7 C;  1JY3 O;  1YTZ I;  2D2C C;  1KYU A;  1KOR A;  4PV1 C;  3EFG A;  1KO9 A;  1GK4 A;  3AE8 C;  1SQB G;  2HL9 A;  4BRY B;  1IJD B;  5C39 A;  3CX5 I;  3D7Q A;  4OVN F;  1BE3 J;  2YO2 A;  1BSH A;  3I3W A;  1BDC A;  1T6A A;  2FUV A;  3CXH D;  2IFN A;  4JYC A;  5KLV K;  1FOS E;  4PV1 D;  1P5G X;  3M0D A;  2YNY A;  4A7P A;  1HJB A;  1IFI A;  4Z1M H;  1SQQ D;  2MJZ A;  1DH3 A;  3A0B E;  3D6Y A;  3F0Z A;  4LGD E;  4W7Y A;  5KLI B;  1KB9 E;  2GA1 A;  5AN4 A;  1JTH B;  2IPP A;  4ASW A;  1YIJ P;  1J1E B;  4NPF X;  2V8Q A;  4IOI H;  2OYI A;  1UT7 A;  2MKV A;  2B87 A;  3H6P A;  1L4A D;  1UIX A;  2KIK A;  2IZ1 A;  2BCC G;  1FJP A;  4W80 A;  3PLN A;  1SFC B;  1EQ7 A;  4L75 A;  5APV A;  5GTI H;  4PD4 I;  2E75 B;  3EFF K;  3CW7 A;  1FJK A;  3AEB C;  3CWA A;  1S2E A;  5AW4 B;  4EYY Q;  3L75 D;  3HE4 A;  1OX3 A;  1NH4 A;  1NU1 K;  4JBZ A;  3TNU A;  1DX7 A;  1OFC X;  1Q81 Q;  5E79 E;  4OH8 B;  2Z5H A;  3GHG C;  3G4S P;  2R3S A;  1ZLL A;  3G3Z A;  5APU A;  2R32 A;  1FN7 A;  3BCC G;  3S4R A;  3HS9 A;  1EBM A;  5APT A;  1KC8 Q;  1L0N J;  1QN6 A;  1NTM J;  2CPS A;  3FXD A;  2A45 H;  4Y28 J;  3H1H J;  3H1K J;  2VRS A;  2E76 D;  1OVV A;  2ZAE B;  3JSV C;  1LT9 A;  1T2K C;  3AED C;  5CCG A;  2QVA A;  3JCU H;  2R5X A;  1IK7 A;  1WRG A;  2LXC B;  3L73 D;  4UB6 H;  1OW8 A;  5DJU B;  1L0N K;  1LNQ A;  1YQL A;  1HGZ A;  5CBN A;  1GD2 E;  2Y8Q A;  1ZRT E;  2W90 A;  2YIU B;  3HD7 B;  3MZW B;  2B87 B;  1H8A A;  2QRE A;  2E74 D;  2O3J A;  2GM4 A;  2W6B A;  3F10 A;  2ZFD B;  1EDJ A;  5KJ7 C;  4PJ0 E;  4D7Q A;  4GOF A;  3H1I G;  1GZL A;  3MD0 A;  3IAO A;  1PPJ G;  1VTL E;  2W6J H;  2ZXX A;  5TJH A;  3CCE P;  2KOG A;  4D6T J;  1W5C E;  4D6T D;  2M8R A;  4WBA A;  3A5T A;  3CX5 D;  1Z56 A;  4N6J A;  2NPS D;  2ZFC A;  5IYC P;  3H1J G;  1GK6 A;  2W8Z A;  5APW A;  3L70 J;  5BMP A;  5CCG D;  1IC2 A;  2JHJ A;  2PGD A;  2OYH A;  1M1J B;  1BE3 G;  2ZVN B;  3V4W A;  4I7Z C;  4QG5 A;  1BGY J;  1SQB E;  2FFD B;  3VOP A;  4WVZ A;  4OGQ C;  3HE5 A;  3CWB J;  2KB7 P;  1AJY A;  4XFJ A;  3L73 J;  1JM0 A;  3KTU A;  3OAK A;  2E5T A;  1NAY A;  3QWO C;  3HTK B;  3OLP A;  2Z4E A;  1OW6 A;  4EAI A;  3VMZ A;  1LWU A;  2HZS A;  1K9M Q;  2YMY A;  2RH0 A;  5AW6 B;  5L8R J;  3V2Q A;  2HZM A;  3Q3D A;  2ZJS E;  1HH0 A;  2YMK A;  1NYH A;  3BRT B;  2HG5 D;  1LWW A;  2FFD C;  1QGK B;  3CWB D;  4OWF A;  5H2F E;  5H2F H;  3CL3 D;  1FZG A;  1M8O B;  1URQ B;  3H1L J;  2V92 A;  3OW2 O;  2KS1 A;  4RJT A;  1GDT A;  1Y47 A;  3VN5 A;  5AVQ B;  5M1B A;  2K9Y A;  1G2C B;  1OIP A;  2NPS A;  1P5D X;  1HU0 A;  3C8V A;  1VF5 D;  3PHL A;  1KFM A;  3ITK A;  2K88 A;  2J59 M;  1IFP A;  3TSI A;  1NKN A;  3CXH H;  4GIF A;  4D6T G;  2RMZ A;  1Q86 Q;  1PVS A;  3ENC A;  1V5S A;  3TGU E;  1K73 Q;  1QVF O;  2LXB A;  3HE5 B;  3HD7 C;  1KQF B;  1W2E A;  1SQX K;  1J2J B;  3HTK A;  1JTH A;  1NTK G;  1NU1 E;  1RF1 C;  2Y0D A;  1AIS A;  3KHU A;  2C9L Y;  2A06 G;  3A0H E;  3O6Q A;  1KYO H;  2K9J B;  1KYO E;  1LP1 A;  3AE3 C;  3L75 E;  2KXP B;  2J5U A;  2RKL A;  1CDW A;  4QMA A;  2H88 C;  2BCC D;  2C0W A;  3W68 A;  4ROC B;  1JNM A;  1S1C X;  4I1L A;  2HPC A;  3OH9 A;  3MUD A;  2OYO A;  3V2N A;  3IF4 A;  3SFD C;  3I56 P;  2WPR A;  3BAT A;  5KJ7 D;  1M3Q A;  1NGM A;  3RK2 C;  1QLE D;  4H0L D;  3GHG B;  2WTY A;  3VTP C;  3BAS A;  3Q1M A;  2NOH A;  4OGQ D;  3GG2 A;  3TGU G;  5AVU B;  1A02 J;  5CBO A;  1NH2 A;  1JCC A;  5KL0 A;  1SFC C;  1S9K E;  2XZR A;  1ZRT D;  2XDJ A;  4WXA A;  1KYO I;  4H44 C;  1OVR A;  2ZYD A;  1IO4 A;  1J1E C;  3L73 G;  3GMA A;  1HBW A;  5AW9 B;  5BMN A;  1LP1 B;  2OQQ A;  3ZDM A;  3U1C A;  3I0W A;  4EAK A;  2PP6 A;  3IFM A;  3D70 A;  2KK7 A;  3VYI A;  2Q3E A;  2HR3 A;  2BEZ F;  2GUV A;  1QNA A;  2K3R A;  3BRV B;  4JYB A;  4HB1 A;  4PD4 E;  1SQV D;  3TK1 A;  1PPJ D;  4PD4 H;  1L2P A;  2HL8 A;  3A2A A;  3BVH A;  4YPC A;  1S5L X;  3GLM A;  4AQR D;  3KPE A;  2QIW A;  4XA4 A;  1PP9 J;  1RF1 A;  1KQL A;  2NOL A;  4PV1 B;  1N3C A;  2OYH B;  1FZC C;  2QLV A;  2WMM A;  5KKZ C;  1ZXG A;  1S5L E;  1XTC C;  2QJP B;  5APS A;  3KZI H;  1CI6 B;  1QX8 A;  4MRQ A;  2QSI A;  4NPE A;  1N39 A;  3MGN A;  1S72 P;  1P84 E;  2QG4 A;  2IFM A;  3B8E B;  1VTO A;  1CW5 A;  4H13 B;  1EDI A;  4GOD A;  1SQQ E;  4B0A A;  2NZ2 A;  1LWU B;  2POH A;  3OGD A;  2OYI B;  3HRN A;  2XKM A;  3BCC J;  2L5G B;  1LJ2 A;  5CMZ A;  1NTM G;  3VP9 A;  1RH5 B;  1N8R Q;  3CVT A;  1KYD A;  2M5A A;  4N78 D;  5GTH E;  2QM7 A;  2IBZ I;  3OJA B;  2A06 E;  1EZV G;  2KS1 B;  2WWW A;  1YQM A;  4IL6 X;  4LC1 A;  2R5B A;  4H0L C;  2DW3 A;  3HS8 A;  1PPJ E;  1D7M A;  5BU8 B;  3U59 A;  2AXC A;  1RE3 C;  1NU1 J;  5KLV G;  1EDK A;  1JEK A;  1ZR4 A;  3SWF A;  5AW3 B;  4ZKU A;  3MHV A;  3SSU A;  1AQT A;  2O01 H;  2ZT9 B;  4GT1 A;  1DIZ A;  4IFM A;  2VJ0 A;  3HUS A;  1C9B B;  1SQV G;  1SQQ J;  2BCC E;  2FXO A;  2AEM A;  1N73 B;  2QR1 A;  2E75 D;  2D0C A;  3Q2Y A;  4DZO A;  1VQK P;  2JOI A;  2MZ8 A;  3D71 A;  4D7R A;  2W83 C;  1PCZ A;  1FDM A;  2KSJ A;  1QNE A;  1NTK K;  2Q6Q A;  1PCJ X;  5AVY B;  4GKG A;  2OTJ P;  4I2L C;  2WVR A;  1JO5 A;  3TDK A;  2KNC B;  3EWK A;  4IL6 H;  3TGU J;  3P32 A;  3RL0 g;  1AV1 A;  2E76 B;  1FOS F;  1BE3 D;  3CVS A;  3H1H D;  3H1K D;  3AE5 C;  3M0D C;  1NKZ B;  1H0T B;  2WSE H;  3CXH I;  1GW4 A;  2WT7 B;  1IFD A;  1S5L H;  2J58 A;  2E43 A;  4PY5 A;  2FYU D;  2B88 A;  1VQ7 P;  1PGJ A;  4HH2 A;  1N7S C;  3VP8 A;  1SS1 A;  1P84 H;  3L75 G;  4IFF A;  1EXJ A;  3AE2 C;  1WQA A;  3CWT A;  3W67 A;  1LTI C;  3PDK A;  5KAI H;  1QN8 A;  4UB8 H;  4ROD B;  1RF0 A;  1YYC A;  3WU2 E;  4DT0 A;  3WU2 H;  1LTJ C;  1RQV A;  3RK3 C;  3CMA P;  5EPC A;  2N1T B;  2Y9Z A;  2DKA A;  2FYN B;  3AEA C;  3AE9 C;  2N9B A;  1GL2 B;  1L0L G;  2F7L A;  4KT0 J;  4KHX A;  2ZXE B;  1LTA C;  3CCJ P;  4WX8 A;  2IZ0 A;  4C7N A;  3RK3 E;  3L35 A;  2WSF J;  3V5B A;  2LR2 A;  2H7H A;  3KXD A;  1Q7Y Q;  5CJ0 A;  4KJM A;  2WSC H;  1J3M A;  2NOB A;  1YTZ T;  2XV5 A;  3CCV P;  1NTZ K;  2G3A A;  4EJZ A;  3M9H A;  2Z8U A;  1PP9 D;  1YTB A;  4XE5 B;  4LLH A;  1CI6 A;  5F9C A;  3KRM A;  1SQP E;  1KIL E;  1H89 A;  1SQV J;  3IH7 A;  5APQ A;  2QM8 A;  1ZOY C;  4L73 A;  1BGY E;  1SQB J;  2WPV B;  3II6 A;  1QN4 A;  1FZB A;  2YKP A;  1C47 A;  5CCG C;  1M57 D;  4WY4 B;  2FKM X;  1C4G A;  4DCK A;  3H1I D;  3R2P A;  4B86 A;  3CX5 E;  1GL2 C;  3GW6 A;  1W2B O;  1RQU A;  1VKL A;  1OW7 A;  1DD4 A;  3RK3 B;  3CWB E;  5E79 H;  1LTJ B;  1T8Z A;  1QN5 A;  1LTG C;  1M3H A;  2JHN A;  3CLQ A;  2P2U A;  2R5D A;  3NTN A;  2D0B A;  1FBM A;  3B5N A;  1FS0 E;  1JMB A;  2AEF A;  1BCC E;  1N7S B;  3H25 A;  2P1J A;  5CCH A;  2Y9Y A;  2H8P D;  3BCC D;  1BE3 E;  1FDI A;  2IBZ G;  3NFQ A;  5GTI E;  1KV4 A;  2R44 A;  2MJ7 A;  1DIP A;  5KAF E;  2NOF A;  1IFN A;  3GF3 A;  1N73 A;  1VQL P;  5APX A;  2FFD A;  3IR9 A;  3S9O A;  1HTL C;  5AW7 B;  3TGU D;  2E76 C;  2PAJ A;  4RES B;  2ZYG A;  2LKM A;  3FXE A;  1HJ0 A;  1X22 A;  2UWJ E;  1B9K A;  1YJ9 P;  1NTK J;  4TPS A;  3WUT A;  3H1J J;  1VQM P;  2JJL A;  1KZU B;  1L0N G;  3UIA A;  3OC3 C;  4IFD K;  4Y99 C;  1BCC G;  5HSH A;  3N7N A;  3R4Y A;  5KLV E;  1OXZ A;  1Y9B A;  1IFM A;  4BRY A;  1SQX E;  1NWQ A;  3TDH A;  3H1H E;  3H1K E;  1UII A;  1M5Q 1;  1RHZ B;  3GF7 A;  2O3O A;  1LT1 A;  2JO1 A;  1KMI Z;  5BVZ A;  2K37 A;  3FWN A;  1N3A A;  1YTF A;  2ZT9 C;  1UL7 A;  1IZN B;  1N7L A;  1SQV E;  1U57 A;  1QTS A;  2C9N Y;  2OTK E;  1MP9 A;  3CME P;  1JB0 J;  2NRG A;  2KSE A;  4L74 A;  2WPS A;  1SVF A;  1OVU A;  3OST A;  1L0L J;  1JOC A;  1T3J A;  2FYU K;  3CCR P;  2Q9I A;  3G71 P;  2WSC J;  3ENO C;  2N1T A;  3VN0 A;  1JY2 N;  3H1I E;  2JDI H;  1GW3 A;  1AVO A;  1A02 F;  2JWA A;  1NTM D;  1ZP0 C;  1BGY G;  1AA0 A;  3EAY A;  1VQ4 P;  3CWS A;  1SQQ G;  1KFQ A;  1N2D C;  1P84 D;  1W80 A;  1LWY A;  3ASM A;  1SQX G;  2V9J A;  2OYI C;  3T97 A;  1R4X A;  3WMM 0;  4H13 C;  1YJN P;  1YJW P;  1NJI Q;  1KIL D;  1EZV I;  3RL0 C;  5B66 E;  3CI9 A;  3GHG A;  1T3U A;  2Q7C A;  1SQB K;  3OH6 A;  3PH0 A;  2ZT9 D;  1GU4 A;  5AW1 B;  5B5E E;  2NWV A;  1FE6 A;  1QN3 A;  1VQP P;  3HUS B;  2EHB D;  2KI7 B;  3RBX A;  5IYD P;  3L74 J;  1KQG B;  3Q5S A;  1P84 I;  3LW5 H;  3AE6 C;  3JC2 2;  4N3Y B;  2WSE J;  1KIL B;  2OAR A;  2PWW A;  1YBK A;  3HD7 A;  2G8Y A;  1L4A B;  2H5A X;  1BSN A;  4I6M C;  1FDO A;  2QJK C;  3TE5 A;  1R5L A;  1YHQ P;  1Y8A A;  3MP7 B;  2IBZ E;  3OSM A;  4H44 D;  2D2C D;  2IV8 A;  3CCM P;  2KNC A;  4CPG A;  4C7R A;  1U7M A;  2BAS A;  3AE1 C;  1EZV E;  1SLQ A;  2WSS H;  3SWY A;  1USD A;  3PP5 A;  1KYF A;  3QH9 A;  3BCC E;  3M9B A;  1SQX D;  5AW5 B;  1NOH A;  3L37 A;  1PV3 A;  4IL8 A;  4GDO A;  3T97 B;  4U3F J;  2A06 D;  2JPI A;  3Q5P A;  1M1J A;  5CCH D;  1MUU A;  2Z0F A;  3ABV C;  2WT7 A;  4D6T E;  4H44 B;  1LTT C;  2NPS B;  3LIE A;  3M0A A;  3WUV A;  1VOK A;  1GMJ A;  5KAI E;  1PZQ A;  4NPD A;  5APY A;  3L72 J;  2O01 J;  3A3Y B;  5GTH H;  5AVS B;  2KZJ A;  3MTU E;  3LW5 J;  1LT9 B;  3RK2 B;  1Q9U A;  1NTM E;  2FXP A;  2WPQ A;  2QRC A;  1NTZ G;  1NVO A;  2I8D A;  3AEC C;  1EC5 A;  1J1D C;  2O01 N;  3AEE C;  5AVT B;  3V2R A;  3G9R A;  1KB9 I;  1EXI A;  3BKQ X;  1VQ5 P;  2YA3 A;  3E7K A;  2M5A B;  4HYT B;  2HOD A;  1URQ D;  1PCM X;  1YIT P;  1G1I A;  1K8A Q;  1RF1 B;  3SWK A;  4HKZ H;  4TLF A;  3TYY A;  3V4Q A;  5AW0 B;  2KZI A;  1ZR2 A;  1JY3 N;  5AVX B;  2I1K A;  3H1L E;  2V4H A;  3K5B A;  1GTW A;  4JPZ B;  2P67 A;  2ZVO B;  1J1D B;  2YO3 A;  1WJW A;  3M91 A;  4Q11 A;  1VOL B;  4C46 A;  1JMM A;  1L0L E;  1NTZ E;  4O9B A;  3O6Q B;  1PGO A;  2FKW B;  2K9J A;  1VQ6 P;  1LTB C;  2NLV A;  1FU1 A;  3NMD A;  1LT9 C;  5JMV D;  1KB9 H;  1NTK D;  3L71 G;  2IBZ D;  1S3J A;  1URQ C;  3CCQ P;  2HYN A;  1NU1 G;  2YXQ B;  4GOE A;  1NGM B;  2LAE A;  1LWV A;  5AVR B;  2NPS C;  1R8E A;  1DEE G;  3CCL P;  1KN7 A;  1RF0 C;  3L71 J;  1NO4 A;  3L74 D;  1FAV A;  2YXR B;  3CC7 P;  3HE4 B;  1X0T A;  5K5G B;  1E79 H;  3G6E P;  1WT6 A;  1SQQ K;  1G2C A;  2XNX A;  1M1K Q;  4DJG A;  4OGQ B;  4TT3 H;  2YKQ A;  4RKU J;  2HLO A;  1DD3 A;  2O1J A;  2W27 A;  4WY4 D;  1AFO A;  4K3A A;  4I7Z B;  1BCC J;  1BCC D;  2QE7 H;  1QNC A;  3LID A;  1HF9 A;  5TIS E;  2H89 C;  2FYU J;  3C1L A;  1M1J C;  5TIS H;  2YKO A;  3H1L D;  2QEX P;  2KUB A;  2QJK B;  5AW8 B;  1L4A C;  1RY3 A;  2JKV A;  2H4L X;  4ROE B;  1X79 B;  5CCH C;  1KIL C;  4JQ0 D;  1T2K D;  3EIK A;  2CK3 H;  4YTP C;  1QTP A;  1KFN A;  1EUV A;  3FX0 A;  4M3L A;  1SFC A;  3U1A A;  3AEF C;  1K05 A;  3HUS C;  2JP3 A;  2NOZ A;  2W6A A;  5CHX A;  3ULX A;  2N9Y B;  3L73 E;  1YQ3 C;  2FKF A;  1M90 Q;  2A45 G;  1VL2 A;  3TNU B;  4EI2 A;  1VQ8 P;  1M56 D;  2YIU C;  3RL0 B;  1S4X A;  1LGH B;  3A0B H;  2Z5I A;  3L72 D;  3L4F A;  4MN4 C;  1RE3 A;  1QVG O;  4CFF A;  1NHL A;  4U3F E;  4C7P A;  2DKD A;  3CWU A;  1JUN A;  2P7J A;  1JCD A;  3H32 A;  1MV8 A;  2P58 A;  3KZI E;  2HFE D;  1S9K D;  3C04 A;  1SQP K;  4EAJ A;  1YQK A;  3RL0 D;  2IYP A;  1SQX J;  3L70 E;  1AVY A;  1PZD A;  4U7J A;  2RN0 A;  2SPZ A;  1L0N E;  2P10 A;  2BCC J;  5AVV B;  5AW2 B;  3B71 A;  5DJT B;  1SQB D;  4YXW H;  4ASV A;  2IDB A;  1QEX A;  3P8M C;  1G1J A;  1IFJ A;  2E75 C;  1E42 A;  3VMY A;  3Q5R A;  1TBA B;  1K35 A;  1QN9 A;  3PJS K;  3OCI A;  1KD1 Q;  3CXH E;  5KJ7 A;  2IV9 A;  3CC4 P;  3L71 E;  4N78 E;  3SFE C;  2E42 A;  2WSF H;  3OSE A;  1ZN5 A;  5KTB A;  2NOE A;  1MFT A;  1SQP D;  4ZMD A;  4UB6 E;  4HJG H;  5KLI C;  1EDL A;  1LTS C;  1VQN P;  1SFC D;  1MPG A;  1NTZ D;  4Y99 B;  1BGY D;  2Y0C A;  3VMX A;  1WMK A;  1OMI A;  2KLU A;  1MFZ A;  2YH5 A;  3I0X A;  3PRJ A;  3L70 G;  3AEG C;  1RE4 C;  2FYU G;  1KY6 A;  2CPB A;  1KIL A;  1FZE A;  2AXT H;  2K1A A;  3N89 A;  4EAG A;  4WY4 A;  4EAL A;  4W7Z A;  1NVP A;  3P8C E;  2D2C B;  3UW2 A;  1VQ9 P;  2M3E A;  1VQO P;  1URQ A;  4EOT A;  1H88 A;  2OTL P;  2QJY B;  1UT4 A;  1K04 A;  3CCS P;  3D6Z A;  2QRD A;  3I55 P;  1RM1 A;  1Q82 Q;  3H1Z A;  3S1K A;  4BXL A;  4R4L A;  1LXT A;  3H1L G;  3FGA D;  2E74 B;  1H0T A;  2DKC A;  3L71 D;  4WWI A;  1DEB A;  3CX5 H;  5CJ4 A;  1BDD A;  3A7O A;  1YQR A;  1N86 A;  4WZS D;  5EFW B;  3OA7 A;  5KAF H;  1K2Y X;  2QA4 P;  3WUU A;  1Q2N A;  1PGP A;  2G30 A;  2WIT A;  2XHI A;  3B5N C;  1TGH A;  3L74 G;  4WY4 C;  1KFI A;  1FZF A;  3C9I A;  2OGU A;  1JY2 P;  2I5W A;  5AVW B;  3RSM A;  3V2P A;  2Q3I A;  2Y8L A;  1NU1 D;  1ZW0 A;  5KLV D;  4EIJ A;  1ZV8 A;  3H1J D;  2KYV A;  3I5C A;  1L0L K;  4JF7 A;  2XND H;  1OWA A;  3JCU E;  2FBW C;  3VMA A;  2NOI A;  4U3F D;  1U7J A;  1R5S A;  3HD7 D;  1EZV D;  4C7N B;  1GL2 D;  1QL1 A;  1XTG B;  1PL5 A;  1MKM A;  3NXS A;  1XSZ A;  4PJ0 H;  1FC2 C;  3AE4 C;  3H32 B;  1JFI C;  1SQP J;  4K35 A;  3TF5 A;  4BWN A;  2L91 A;  2C0X A;  1TBP A;  2OOX A;  3RK2 D;  3USS A;  1N7S A;  2I1J A;  2A45 I;  1MZ9 A;  1M7L A;  4R4M A;  3L75 J;  1PP9 E;  2JR8 A;  3L70 D;  3DPU A;  4AUW A;  2FYN C;  1YQ4 C;  2N1T C;  1KTM A;  2AXT E;  2R3C A;  3L72 G;  1VF5 B;  2QRX A;  1NTM K;  1QL2 A;  2XU6 A;  1YI2 P;  3F5H A;  1HWT C;  3IN6 A;  1KQS O;  3H1H G;  3H1K G;  2N1T D;  1TU3 F;  5KLV J;  1USE A;  3SNS A;  3CC2 P;  1NAF A;  1KYO D;  2D0A A;  2FGT A;  4UB8 E;  4ZKP A;  1RE4 A;  2NVM A;  1NTK E;  1PGQ A;  3M9Q A;  1JY2 O;  1NTZ J;  1VPC A;  1SQV K;  1JY3 P;  1AQ5 A;  3E1R A;  3RK3 D;  1HVV A;  1QNB A;  3RBZ A;  1ZME C;  1HGV A;  1X9V A;  5B5E H;  3MIW A;  1VF5 C;  5AVZ B;  3H1I J;  3T4N A;  2V7Q H;  5IYB P;  1KY7 A;  2PRR A;  1N7S D;  1FZA A;  1PP9 G;  1HUC A;  3P8C D;  2ITA A;  2JEE A; 
#chains in the Genus database with same CATH homology
 1T6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...