1T6AA

Crystal structure of protein of unknown function from bacillus stearothermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
AMNTDLKLPAGKTMTIEDVKQLLERYQMALKKTGEQLGWAYEQAAFPYTVRIHESVLYLQGDGRLYKGMAISVRTAGEETFIDIALPPGATHGDKGKANEFSKWLAKTLGGELHLFSGRTMVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RBSTP2229 gene product
publication title X-ray crystal structure of hypothetical protein (RBSTP2229 gene product) from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08968 DUF1885 Domain of unknown function (DUF1885)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.850 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Rbstp2229 protein 1t6aA01
3.30.310.120 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Rbstp2229 like protein 1t6aA02
1T6AA
chains in the Genus database with same CATH superfamily
1YI2P 3H1JG 2A45H 1OMIA 1E79H 1RF0C 3AE2C 3RL0D 2I5WA 2E76C 1JMBA 4N3YB 1KD1Q 2V9JA 1LP1A 1GW4A 2M0BA 2AXTH 4JBZA 3JC22 5CHXA 2Q5UA 2N1TD 3JSVC 1S9KE 1N73B 4EDFA 5B5EH 2C9NY 4DOJA 3OH6A 5APXA 1S9KD 4PD4H 2H43A 1NTME 4AYCA 4WX8A 1SVFA 2NRGA 2CPSA 4WWIA 1NTMD 1PCJX 3U1CA 4I7ZB 3UIAA 2YIUC 1NTMG 3VMAA 2H8PD 5JMVD 1N7SB 5AVZB 2KSEA 4C7NA 1UL7A 1G1IA 1N86A 2Z8UA 1P84I 3A0BH 5KJ7D 1QTSA 5EPCA 2W6AA 2HZMA 2P7JA 2D2CC 3H6PA 4C7RA 3L75J 4PJ0E 1PFIA 5BMNA 3G4SP 2R5BA 2H7HA 2QRCA 2VJ0A 1HGZA 3HS8A 1SQVJ 3B8EB 1SQQJ 2W90A 2WSSH 1WJWA 2POHA 3TGUJ 3H1IJ 3RBXA 4I6MC 2OYHB 1RF1A 1IFNA 1VQKP 1PP9G 5KAIE 5F9CA 4R4LA 2BASA 5BU8B 4WZSD 1NAYA 2JKVA 2HODA 3RK2D 1URQB 5AW7B 3L75D 3VMXA 1NWQA 4NPEA 3Q5RA 4WY4C 3BCCJ 3ENCA 1HU0A 3L70E 1P5DX 4PV1B 2QG4A 3TGUD 3H1ID 3L70D 3D7QA 2YO2A 2IX7C 2E75D 2QVAA 3CCQP 4LC1A 1L0LE 1CW5A 1YJWP 1LWYA 3L70G 5AW5B 4AUWA 3QWOC 1L0LD 2O3JA 2QLVA 3OSMA 1Z56A 3PMGA 4OGQD 1LTBC 1N8RQ 1GL2D 1L0LG 4IL6E 3KHUA 4AQRD 1OZHA 3H1LG 2JJLA 2KUBA 4CFFA 3N89A 1YQ4C 1FZFA 2WSCH 1QTPA 2P1JA 1VQPP 1Y9BA 2WPQA 1YHQP 1EBMA 3GHGA 2E43A 3OCIA 1M57D 1KMIZ 4H13C 1NTKE 2CK3H 3CXHI 1VQ7P 2GM4A 2JR8A 2ZAEB 2WPRA 1QNAA 2MJ7A 1NTKD 2QRDA 2Y9ZA 1GK4A 2L91A 5AW4B 3L73E 1NTKG 4M3LA 3CMAP 1RE4A 2RH0A 3L73D 2DKAA 2FXMA 2KK7A 2N1TA 2QR1A 1RF1B 2HYNA 1NTMK 1ZLLA 1S2EA 2G3AA 1TBAB 1W2BO 1PL5A 1VL2A 1KYOE 5APVA 1N39A 1KYOD 2KS1A 2RMZA 4HKZH 1K73Q 3CCRP 1V5SA 3L72G 3OSTA 1N7LA 1SQXE 1FZGA 5TISE 1SQXD 5AW6B 1ZR4A 5KJ7A 2YKPA 1KILD 1SQXG 1DEEG 3RK3B 2UWJE 3S9OA 1HVVA 4GT1A 2Z5IA 2AXTE 1KFIA 1IFIA 3CPWO 3K5BA 3BRTB 3KPEA 2KP8A 4ZMDA 5B5EE 3PDKA 1FBMA 2GUSA 1SFCB 3KYQA 2HL9A 4PD4E 3SWFA 1G1JA 1RQUA 3RGUA 3LIDA 4PD4D 3KZIH 1VPCA 1FDOA 2QJPB 2QJYB 1N2DC 2AEJA 1C47A 3FWLA 3G6EP 4H0LB 2OOXA 2R3CA 1VF5D 1DIPA 2K1AA 2WPSA 1SQPJ 1LWUB 3V6IA 3RL0B 1J2JB 3CWTA 3A0BE 4L76A 3CWAA 5KTBA 3A5TA 3T97B 3H1ZA 1J1EC 4O9BA 5DJUB 4RODB 3PP5A 1VQ9P 4LLHA 1L0LK 4HB1A 4BRYB 2FYNC 1JO5A 1NVOA 3HTKB 2IFMA 3PH0A 4OWFA 3BKQX 2KS1B 1WRGA 5BMPA 1G2CA 3E1IA 3H32A 3M9QA 2JHNA 4PV1D 1GL2A 1QN3A 4N78E 1YJ9P 3H1KE 2Y8QA 4WB4A 2LR2A 1FOSE 1TU3F 2FKWB 1RE4C 1NTKK 3ASMA 1LTJA 1L0NJ 1Q9UA 1SQBJ 4H44D 3W68A 5AW3B 1DIZA 2B9BA 3H1KG 1YTZT 1FS0E 5APWA 1MFZA 1AFOA 2NLVA 2KNCA 2XZRA 1LWVA 2A06E 1W80A 1Q7YQ 1H0TA 4U3FE 5L8RJ 1S3JA 1OW8A 5KLIB 2A06D 3SFEC 3B4SA 3B5ND 4U3FD 1NGMB 4DZOA 3CCVP 1JY3O 2M5AA 2FKFA 3F5HA 2JOIA 1IJDB 4U3FG 5AW1B 1LXTA 5AVTB 3G9RA 3HUSA 1N3CA 3O8ZA 2N9BA 3A3YB 3KDPB 2G8YA 3V5BA 1X22A 2ZVNB 1QX8A 5KJ7C 3TF5A 3RK2B 2XHIA 4A7PA 3R4YA 5APUA 4BWNA 5KKZC 1EDKA 1LT9A 1NAFA 1NU1J 1AVOA 1SQXK 1N73A 3U1AA 1FZCA 5KL0A 4D7QA 3VYIA 4W7YA 3MZWB 4NPFX 3I55P 1K8AQ 1J1DB 4IFFA 2FFDC 1M1JC 2E75B 2J59M 1AQTA 4Y99B 1KILA 1U7JA 2V92A 3CL3D 1BE3E 4EAIA 3H1HE 1PPJE 2OTLP 1CZQA 3TNUB 1GZLA 1BE3D 1G2CB 1D7MA 3FXDA 3HD7C 3H1HD 1RQVA 1PPJD 2BCCJ 3OAKA 5AVRB 1FDIA 1R8EA 4ZNCA 1BE3G 1OIPA 5KLVE 2OTJP 3H1HG 3RK3E 1VOKA 1PPJG 3L74E 1IFJA 4L73A 3H25A 2ZXXA 1FZEA 1KYOI 3RK3D 4WVZA 3L74D 4EALA 3RL0g 1LTJB 1ZN5A 1VTOA 2OYIC 2W83C 5KLVG 4JQ0D 3ABVC 3L74G 3M0AA 1FN7A 1YQRA 2Z0FA 1CI6B 2WTYA 1SFCD 2GA1A 1BDDA 1OX3A 3NMDA 2FKMX 2ZXEB 2XKMA 1JY2N 4JPZB 5BU5A 2R5DA 2A45I 1PIXA 1DEBA 3Q1MA 1MV8A 3A0HH 1IC2A 1ZP0C 1YTFA 4TPSA 5AN4A 2HL8A 3HUSB 3IH7A 2OQQA 1S5LX 2NPSC 3L4FA 1KYFA 1URQA 2P67A 1PZDA 1JB0J 1CDWA 4DULA 3OJAB 2WITA 4PD4I 1YQ3C 4TLFA 3VMZA 3I0WA 1LT9B 1K9MQ 1OWAA 3V2PA 4YXDC 2P2UA 4EOTA 4UB6H 2L5GB 3KZIE 2JDIH 2WZ7A 1FZCB 1W5CE 2PWWA 2C0WA 3AE4C 3Q5PA 2NOEA 3FXEA 5CCHD 1KILB 4HJGH 1JY3N 3NA5A 2HKPA 2QE7H 3B71A 3T4NA 1UT7A 2B88A 1KY7A 4GKGA 1T2KD 3A7OA 3IF4A 2KOGA 3IAOA 1VQOP 3G3ZA 2I1JA 3B5NA 1WMKA 5TJHA 1JNMA 3RPJA 1A02J 4TT3H 3N4XA 1NO4A 1N73C 1RY3A 4RESB 1PP9J 1ZW0A 1NTZJ 2K9YA 1MKMA 3Q5SA 2E74C 1VF5B 4WY4B 2BEZF 2ZT9C 5IYCP 3CMEP 5AW0B 4BXLA 2AEFA 3CWBJ 3CC7P 1FOSF 2QRXA 2IBZE 4W80A 1TUOA 4EJYA 1N7SC 1VQNP 2IBZD 2Q3IA 1WQAA 4R4MA 1KN7A 1AV1A 1EDIA 3L75E 1ZV8A 1KB9E 2K88A 1NHLA 2IBZG 3ZDMA 1XSZA 1KB9D 1MFTA 5AVXB 1SQVE 3P8CD 1SQQE 3OA7A 4GOEA 5AVQB 3F89A 3L75G 2Z4EA 1SQVD 3TGUE 3H1IE 1SQQD 3TSIA 4D6TJ 3IR9A 5KLVK 1OW6A 3H1LJ 1MPGA 1SQQG 4U7JA 2R5XA 2PP6A 3CCMP 3CI9A 3TGUG 3H1IG 3D6ZA 1YQMA 1VDFA 4DJGA 5CBNA 4MN4C 1LTSC 3DPTA 1KQLA 1JFIC 4H44B 5C39A 2F7LA 1YITP 1EQ7A 1VTLE 1IK9A 2OYHC 3BCCE 5APYA 3GLMA 1X8YA 3BCCD 1SFCA 4QMAA 1U7MA 2HPCA 3C1LA 1YJNP 1URQC 3BCCG 1UIIA 3AEEC 1NH4A 3B5NB 1T8ZA 1AA0A 2FYUJ 5E79H 3CCUP 1QN4A 1X0TA 3L71J 2E76D 4PV1C 1ZMEC 1HJBA 3AEBC 3II6A 1LWUA 3VP8A 2WMMA 4IL6X 1YTBA 3T97A 3CWUA 1GTWA 4DT0A 3W67A 3L73G 1Q82Q 3L72J 2LAEA 1QL2A 1ZRTE 2E5YA 3TK1A 4BRYA 1ZRTD 1JCCA 3HTKA 1GU5A 3AE3C 5CCHA 1PCMX 3MD0A 3I0XA 1OVUA 5APQA 3OGDA 2ZFDB 1K35A 1Q86Q 3CVTA 1Y47A 5DJTB 2NOBA 3A0HE 1DX7A 2W8ZA 3USSA 1KILE 1KQFB 5APSA 2W6JH 3EFGA 2D2CD 3PHLA 2I1KA 1GW3A 3EWKA 1RF1C 1QN5A 2A45G 4UB6E 3NTNA 2KI7B 5EFWB 3D4VA 1FDMA 3V4WA 3DPUA 1MZ9A 4HH2A 2CPBA 2HPCB 2ZJSE 1NGMA 1PCZA 1SS1A 2NOIA 3E7KA 1N3AA 2RKLA 3WUUA 3Q3DA 2IDBA 2NOLA 2FXOA 4EAJA 3PTZA 1NKNA 1GMJA 1KFQA 4GODA 3PLNA 1B9KA 1R5LA 4WY4D 4ASVA 1NOHA 1IK7A 1SQQK 2KIKA 3NFQA 1NYHA 2B87A 4XFJA 1QVFO 2DKDA 1ZXGA 3VOPA 1AISA 3CCLP 1TBPA 1DD3A 3HS9A 3IFMA 5AW8B 2WWWA 1YIJP 2V4HA 2PAJA 4W7ZA 3MP7B 1KC8Q 4K35A 1SP4A 2KXPB 2YKQA 1BSHA 1PGJA 1SQPE 3GHGC 2V7QJ 3PRJA 1KZUB 4K3AA 1SQPD 5M1BA 4OVNF 3TNUA 1XTGB 1FE6A 4C46A 1TGHA 2Q3EA 1NJIQ 1BGYJ 2V8QA 3L35A 2IBZI 5AVSB 1OVVA 2D0BA 4H0LC 2R3SA 1QN7A 2HG5D 4H13D 3RL0C 5AW2B 3CD6P 2C9LY 3R2PA 2N9YB 4YXWH 2JO1A 2XNXA 3BRVB 2FGTA 3C04A 1ZOYC 2N1TC 1CI6A 1C9BB 1KB9H 3L37A 4B0AA 5KKZB 1MUUA 2B89A 1JEKA 5CCGD 5IYDP 4D7RA 3JCUH 3AE8C 2JP3A 1T6AA 1M3QA 2KZIA 2Q9IA 4Y28J 1L0NE 1SQBE 2A06G 4MRQA 1R5SA 3CCSP 2FFDB 1L0ND 1M1JB 1SQBD 1PZQA 2SPZA 3MHVA 2QREA 4GDOA 1VQ6P 2O1KA 1OFCX 3RBZA 1ZR2A 1SQBG 2QJKB 3GG2A 2K9JB 2WSFJ 3CX5H 3HD7B 2B87B 3AE6C 3GF3A 4L75A 1JY2P 1FAVA 5E79E 1USDA 2H5AX 2NOHA 3M9HA 4ZKUA 5KLIC 3NXSA 4KT0J 1AJYA 2QSIA 5JN5A 1NU1E 1KFMA 1FJKA 5KAFE 2FUVA 2VRSA 1NU1D 3VN5A 4C7PA 3M9BA 4HJHA 1PVSA 1Q81Q 1J3MA 2WVRA 3VMYA 3RK2C 3CXHD 1BDCA 5H2FH 1FZAA 4KJMA 1L4AB 1BCCJ 2P10A 3M0DA 2Z5HA 1U57A 3BASA 3V2NA 1OXZA 2NPSB 2KSJA 2E76B 3H1JJ 2JEEA 1JY3P 2BCCE 3FWNA 1AQ5A 1OW7A 3IN6A 3UW2A 1YQLA 4WY4A 2E75C 1HH0A 3TE5A 1USEA 3D6YA 2BCCD 4Y99C 4HYTB 3AEFC 1QLED 1BSNA 4WBAA 2IV8A 2YO3A 2I8DA 4OGQC 3C8VA 4LGDE 3E1RA 1M1KQ 1XTCC 2WT7B 4ROEB 1GL2C 2DKCA 1BCCD 3O6QA 3TDHA 4RO0A 1HWTC 1JDYA 1K05A 2YKOA 2YIUB 1PGOA 3CC2P 5CMZA 3BVHA 3CCJP 1LTJC 1M5Q1 5BVZA 3LW5J 1EUVA 1NTMJ 1FZBA 1QNBA 1Q90D 2MZ8A 2WSEJ 3FGAD 2K37A 1R4XA 1NH2A 1HTLC 1LTTC 2D2CB 5AVWB 2ZYAA 3CVSA 2E74B 4YTPC 1QNCA 5B66H 2ZT9B 3HUSC 3M91A 3SWKA 2HR3A 4UB8H 1GDTA 5CCGA 4IL8A 2K3RA 3I3WA 3V2RA 3VN0A 3WU2H 3OC3C 3P8MC 3OLPA 3P7KA 1QVGO 1RHZB 1L0NK 3HE4B 2MKVA 1SQBK 1LT9C 4JF7A 1QGKB 2O1JA 4N6JA 3N7NA 2C0XA 1JOCA 3AEDC 5GTIH 4JYBA 4RJTA 1QEXA 2KYVA 1FZCC 1DH3A 1QNEA 5GTHH 1PGPA 1YTZI 2KLUA 4I2LC 1X79B 2AEMA 2H88C 2R44A 3D71A 3MUDA 1KILC 1P84H 1VQ8P 3SNSA 2XU6A 1S72P 5HSHA 1VOLB 4I7ZC 2Y9YA 1PP9E 3KTUA 2KB7P 1NTZE 3S1KA 1M3HA 3O6QB 3LIEA 2KZJA 3MTUE 1PP9D 3P8CE 1NTZD 1LTAC 3L70J 2V7QH 1IFPA 1T3JA 3HD7D 3JCUE 1NU1K 1JTHA 1HGVA 1HUCA 3TDKA 1NTZG 4I1LA 3CWBE 3M0DC 5CJ0A 3OSEA 3AEGC 3HE5B 1L0LJ 1OVRA 3CWBD 3WUTA 1SQVG 2IYOA 1VF5C 4H13B 3CWBG 1JCDA 1LP1B 2D0AA 2NOFA 1MP9A 2D0CA 3CX5E 2FBWC 3OW2O 1Y8AA 1K04A 2XNDH 1K2YX 1KYUA 3CX5D 4D6TE 1KTMA 1KQGB 1NTKJ 1RM1A 3CC4P 3H1LE 4D6TD 3CW7A 3GW6A 3H1LD 1KFNA 1L4AD 2AXCA 2NZ2A 3S4RA 4D6TG 5AVYB 3L73J 1HJ0A 5AVVB 2NPSD 2NWVA 4C7NB 2QM8A 2HFED 1HBWA 2J5UA 3ENOC 3SSUA 4KHXA 5IYBP 1GK6A 1CSBA 2Q7CA 2O01N 1M7LA 3EAYA 2WSFH 3V2QA 1C4GA 3MGNA 5KAFH 1YQKA 4PY5A 4H44C 2O01J 3WUVA 3SFDC 5H2FE 1QN9A 2FYUE 1NKZB 3A2AA 1EXJA 1VQMP 3CXHH 3L71E 2FYUD 2IV9A 1H88A 3L71D 5CCGC 1LT1A 2QIWA 2FYUG 1SQXJ 3HRNA 3RSMA 3I56P 3B5NC 3L71G 2YMKA 4IFDK 1JTHB 1YBKA 4BJUA 1P5GX 1GD2E 1E5WA 1T3UA 2HLOA 4XE5B 3KRMA 2P58A 3L72E 2IZ1A 1EZVE 3ITKA 2HODB 3L72D 1IO4A 1EZVD 2QEXP 1S5LH 3AECC 1QN8A 3OH9A 3MUDC 1EZVG 2OOYA 5CBOA 2M3EA 2OYOA 2E74D 3QH9A 4ZKPA 1H89A 2H89C 2ZT9D 1WT6A 1S4XA 1IFDA 4GOFA 1L2PA 2PGDA 4IFMA 2R32A 4ROCB 1KV4A 1J1EB 1N7SD 1RH5B 1IFMA 1RE3A 2FFDA 1M1JA 4CPGA 2FXPA 2DW3A 1SLQA 2M3BA 1NTZK 2FYNB 3AE9C 1LNQA 3KQGA 2ZYGA 2FY8A 3GHGB 1DD4A 5B66E 1PV3A 3P32A 4UB8E 1SQVK 2K9JA 2YNYA 3HD7A 3WU2E 3RK3C 4YPCA 4I8OA 3LW5H 1KY6A 4EYYQ 3VP9A 2ZFCA 2XDJA 4GIFA 2PRRA 4IOIH 3C9IA 4EAKA 2WSEH 1LTIC 2BEQD 5GTIE 1VQ5P 1SFCC 2OYIA 5GTHE 4XA4A 1W2EA 2FYZA 2N1TB 2QJPC 3H1KJ 2G30A 1IZNB 2QJYC 1P84E 3G71P 1QN6A 4EJZA 2Y0DA 4B86A 1P84D 1SQPG 1URQD 3PJSK 1JY2O 3KXDA 3U59A 1A02F 4NPDA 3BATA 1LWUC 3F10A 1KB9I 2QM7A 4QG5A 2JPIA 4PJ0H 1L4AA 3GF7A 4WXAA 3CCEP 2ZYDA 1E42A 3L36A 4U3FJ 2NPSA 1RF0A 2Y8LA 1KO9A 1EC5A 4JYCA 5AVUB 4N78D 3SWYA 1BGYE 3H1KD 1BGYD 3M06A 3EQ2A 5KAIH 1JUNA 5CCHC 1KORA 4Z1MH 1BGYG 2FYUK 2YMYA 2WPVB 1UT4A 2Q1KA 2ZVOB 2WT7A 1JM0A 1X9VA 2Y0CA 2WSCJ 3CX5I 3CWSA 2IYPA 1T2KC 4EAGA 2IPPA 1L0NG 5K5GB 2ITAA 2H4LX 1LGHB 3AE7C 2NOZA 1LJ2A 1LTGC 3I5CA 3ULXA 2QA4P 1EXIA 2IFNA 3MIWA 2YH5A 2E42A 1EDLA 2J58A 2NVMA 2OGUA 1AVYA 1VQLP 4L74A 1BE3J 1LWWA 2MJZA 3H1HJ 3AE1C 2PFXA 2OYIB 1NVPA 2XV5A 4IL6H 1M90Q 1KQSO 3EFFK 3V4QA 2E5TA 1RE3C 2LKMA 5KLVJ 2YXRB 2W6BA 2Y0EA 4DCKA 3L74J 1VKLA 2YXQB 3Q2YA 1M8OB 2O3OA 3F0ZA 3CXHE 2YA3A 4ASWA 1NU1G 2QJKC 1HF9A 1FC2C 2KLVA 1KYDA 3HE4A 1H8AA 2RN0A 2HZSA 1N7SA 4OGQB 3H32B 4EIJA 1GU4A 1GL2B 1JMMA 2JHJA 2GUVA 5AW9B 2M8RA 3AE5C 1UIXA 2OARA 1J1DC 2W27A 3GMAA 1VQ4P 5KLVD 2OTKE 1PGQA 1EZVI 1Q2NA 1FU1A 1S1CX 3AEAC 2JWAA 1S5LE 2IZ0A 2O01H 2BCCG 2LXCB 3VTPC 1KYOH 1BCCE 2EHBD 2KNCB 2Q6QA 3TYYA 3EIKA 2WQYC 1H0TB 3WMM0 1YYCA 1D3UA 5APTA 1SQPK 3H1JE 4OH8B 1QL1A 1BCCG 3CLQA 1EDJA 2OYHA 1FJPA 2JWDA 2LXBA 3H1JD 2M5AB 5TISH 5CJ4A 4EI2A 4Q11A 4RKUJ 1L4AC 4H0LD 3FX0A 1M56D 3D70A 3HE5A
chains in the Genus database with same CATH topology
1T6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6A A; 
#chains in the Genus database with same CATH topology
 1YI2 P;  3H1J G;  2A45 H;  1OMI A;  1E79 H;  1RF0 C;  3AE2 C;  3RL0 D;  2I5W A;  2E76 C;  1JMB A;  4N3Y B;  1KD1 Q;  2V9J A;  1LP1 A;  1GW4 A;  2M0B A;  2AXT H;  4JBZ A;  3JC2 2;  5CHX A;  2Q5U A;  2N1T D;  3JSV C;  1S9K E;  1N73 B;  4EDF A;  5B5E H;  2C9N Y;  4DOJ A;  3OH6 A;  5APX A;  1S9K D;  4PD4 H;  2H43 A;  1NTM E;  4AYC A;  4WX8 A;  1SVF A;  2NRG A;  2CPS A;  4WWI A;  1NTM D;  1PCJ X;  3U1C A;  4I7Z B;  3UIA A;  2YIU C;  1NTM G;  3VMA A;  2H8P D;  5JMV D;  1N7S B;  5AVZ B;  2KSE A;  4C7N A;  1UL7 A;  1G1I A;  1N86 A;  2Z8U A;  1P84 I;  3A0B H;  5KJ7 D;  1QTS A;  5EPC A;  2W6A A;  2HZM A;  2P7J A;  2D2C C;  3H6P A;  4C7R A;  3L75 J;  4PJ0 E;  1PFI A;  5BMN A;  3G4S P;  2R5B A;  2H7H A;  2QRC A;  2VJ0 A;  1HGZ A;  3HS8 A;  1SQV J;  3B8E B;  1SQQ J;  2W90 A;  2WSS H;  1WJW A;  2POH A;  3TGU J;  3H1I J;  3RBX A;  4I6M C;  2OYH B;  1RF1 A;  1IFN A;  1VQK P;  1PP9 G;  5KAI E;  5F9C A;  4R4L A;  2BAS A;  5BU8 B;  4WZS D;  1NAY A;  2JKV A;  2HOD A;  3RK2 D;  1URQ B;  5AW7 B;  3L75 D;  3VMX A;  1NWQ A;  4NPE A;  3Q5R A;  4WY4 C;  3BCC J;  3ENC A;  1HU0 A;  3L70 E;  1P5D X;  4PV1 B;  2QG4 A;  3TGU D;  3H1I D;  3L70 D;  3D7Q A;  2YO2 A;  2IX7 C;  2E75 D;  2QVA A;  3CCQ P;  4LC1 A;  1L0L E;  1CW5 A;  1YJW P;  1LWY A;  3L70 G;  5AW5 B;  4AUW A;  3QWO C;  1L0L D;  2O3J A;  2QLV A;  3OSM A;  1Z56 A;  3PMG A;  4OGQ D;  1LTB C;  1N8R Q;  1GL2 D;  1L0L G;  4IL6 E;  3KHU A;  4AQR D;  1OZH A;  3H1L G;  2JJL A;  2KUB A;  4CFF A;  3N89 A;  1YQ4 C;  1FZF A;  2WSC H;  1QTP A;  2P1J A;  1VQP P;  1Y9B A;  2WPQ A;  1YHQ P;  1EBM A;  3GHG A;  2E43 A;  3OCI A;  1M57 D;  1KMI Z;  4H13 C;  1NTK E;  2CK3 H;  3CXH I;  1VQ7 P;  2GM4 A;  2JR8 A;  2ZAE B;  2WPR A;  1QNA A;  2MJ7 A;  1NTK D;  2QRD A;  2Y9Z A;  1GK4 A;  2L91 A;  5AW4 B;  3L73 E;  1NTK G;  4M3L A;  3CMA P;  1RE4 A;  2RH0 A;  3L73 D;  2DKA A;  2FXM A;  2KK7 A;  2N1T A;  2QR1 A;  1RF1 B;  2HYN A;  1NTM K;  1ZLL A;  1S2E A;  2G3A A;  1TBA B;  1W2B O;  1PL5 A;  1VL2 A;  1KYO E;  5APV A;  1N39 A;  1KYO D;  2KS1 A;  2RMZ A;  4HKZ H;  1K73 Q;  3CCR P;  1V5S A;  3L72 G;  3OST A;  1N7L A;  1SQX E;  1FZG A;  5TIS E;  1SQX D;  5AW6 B;  1ZR4 A;  5KJ7 A;  2YKP A;  1KIL D;  1SQX G;  1DEE G;  3RK3 B;  2UWJ E;  3S9O A;  1HVV A;  4GT1 A;  2Z5I A;  2AXT E;  1KFI A;  1IFI A;  3CPW O;  3K5B A;  3BRT B;  3KPE A;  2KP8 A;  4ZMD A;  5B5E E;  3PDK A;  1FBM A;  2GUS A;  1SFC B;  3KYQ A;  2HL9 A;  4PD4 E;  3SWF A;  1G1J A;  1RQU A;  3RGU A;  3LID A;  4PD4 D;  3KZI H;  1VPC A;  1FDO A;  2QJP B;  2QJY B;  1N2D C;  2AEJ A;  1C47 A;  3FWL A;  3G6E P;  4H0L B;  2OOX A;  2R3C A;  1VF5 D;  1DIP A;  2K1A A;  2WPS A;  1SQP J;  1LWU B;  3V6I A;  3RL0 B;  1J2J B;  3CWT A;  3A0B E;  4L76 A;  3CWA A;  5KTB A;  3A5T A;  3T97 B;  3H1Z A;  1J1E C;  4O9B A;  5DJU B;  4ROD B;  3PP5 A;  1VQ9 P;  4LLH A;  1L0L K;  4HB1 A;  4BRY B;  2FYN C;  1JO5 A;  1NVO A;  3HTK B;  2IFM A;  3PH0 A;  4OWF A;  3BKQ X;  2KS1 B;  1WRG A;  5BMP A;  1G2C A;  3E1I A;  3H32 A;  3M9Q A;  2JHN A;  4PV1 D;  1GL2 A;  1QN3 A;  4N78 E;  1YJ9 P;  3H1K E;  2Y8Q A;  4WB4 A;  2LR2 A;  1FOS E;  1TU3 F;  2FKW B;  1RE4 C;  1NTK K;  3ASM A;  1LTJ A;  1L0N J;  1Q9U A;  1SQB J;  4H44 D;  3W68 A;  5AW3 B;  1DIZ A;  2B9B A;  3H1K G;  1YTZ T;  1FS0 E;  5APW A;  1MFZ A;  1AFO A;  2NLV A;  2KNC A;  2XZR A;  1LWV A;  2A06 E;  1W80 A;  1Q7Y Q;  1H0T A;  4U3F E;  5L8R J;  1S3J A;  1OW8 A;  5KLI B;  2A06 D;  3SFE C;  3B4S A;  3B5N D;  4U3F D;  1NGM B;  4DZO A;  3CCV P;  1JY3 O;  2M5A A;  2FKF A;  3F5H A;  2JOI A;  1IJD B;  4U3F G;  5AW1 B;  1LXT A;  5AVT B;  3G9R A;  3HUS A;  1N3C A;  3O8Z A;  2N9B A;  3A3Y B;  3KDP B;  2G8Y A;  3V5B A;  1X22 A;  2ZVN B;  1QX8 A;  5KJ7 C;  3TF5 A;  3RK2 B;  2XHI A;  4A7P A;  3R4Y A;  5APU A;  4BWN A;  5KKZ C;  1EDK A;  1LT9 A;  1NAF A;  1NU1 J;  1AVO A;  1SQX K;  1N73 A;  3U1A A;  1FZC A;  5KL0 A;  4D7Q A;  3VYI A;  4W7Y A;  3MZW B;  4NPF X;  3I55 P;  1K8A Q;  1J1D B;  4IFF A;  2FFD C;  1M1J C;  2E75 B;  2J59 M;  1AQT A;  4Y99 B;  1KIL A;  1U7J A;  2V92 A;  3CL3 D;  1BE3 E;  4EAI A;  3H1H E;  1PPJ E;  2OTL P;  1CZQ A;  3TNU B;  1GZL A;  1BE3 D;  1G2C B;  1D7M A;  3FXD A;  3HD7 C;  3H1H D;  1RQV A;  1PPJ D;  2BCC J;  3OAK A;  5AVR B;  1FDI A;  1R8E A;  4ZNC A;  1BE3 G;  1OIP A;  5KLV E;  2OTJ P;  3H1H G;  3RK3 E;  1VOK A;  1PPJ G;  3L74 E;  1IFJ A;  4L73 A;  3H25 A;  2ZXX A;  1FZE A;  1KYO I;  3RK3 D;  4WVZ A;  3L74 D;  4EAL A;  3RL0 g;  1LTJ B;  1ZN5 A;  1VTO A;  2OYI C;  2W83 C;  5KLV G;  4JQ0 D;  3ABV C;  3L74 G;  3M0A A;  1FN7 A;  1YQR A;  2Z0F A;  1CI6 B;  2WTY A;  1SFC D;  2GA1 A;  1BDD A;  1OX3 A;  3NMD A;  2FKM X;  2ZXE B;  2XKM A;  1JY2 N;  4JPZ B;  5BU5 A;  2R5D A;  2A45 I;  1PIX A;  1DEB A;  3Q1M A;  1MV8 A;  3A0H H;  1IC2 A;  1ZP0 C;  1YTF A;  4TPS A;  5AN4 A;  2HL8 A;  3HUS B;  3IH7 A;  2OQQ A;  1S5L X;  2NPS C;  3L4F A;  1KYF A;  1URQ A;  2P67 A;  1PZD A;  1JB0 J;  1CDW A;  4DUL A;  3OJA B;  2WIT A;  4PD4 I;  1YQ3 C;  4TLF A;  3VMZ A;  3I0W A;  1LT9 B;  1K9M Q;  1OWA A;  3V2P A;  4YXD C;  2P2U A;  4EOT A;  4UB6 H;  2L5G B;  3KZI E;  2JDI H;  2WZ7 A;  1FZC B;  1W5C E;  2PWW A;  2C0W A;  3AE4 C;  3Q5P A;  2NOE A;  3FXE A;  5CCH D;  1KIL B;  4HJG H;  1JY3 N;  3NA5 A;  2HKP A;  2QE7 H;  3B71 A;  3T4N A;  1UT7 A;  2B88 A;  1KY7 A;  4GKG A;  1T2K D;  3A7O A;  3IF4 A;  2KOG A;  3IAO A;  1VQO P;  3G3Z A;  2I1J A;  3B5N A;  1WMK A;  5TJH A;  1JNM A;  3RPJ A;  1A02 J;  4TT3 H;  3N4X A;  1NO4 A;  1N73 C;  1RY3 A;  4RES B;  1PP9 J;  1ZW0 A;  1NTZ J;  2K9Y A;  1MKM A;  3Q5S A;  2E74 C;  1VF5 B;  4WY4 B;  2BEZ F;  2ZT9 C;  5IYC P;  3CME P;  5AW0 B;  4BXL A;  2AEF A;  3CWB J;  3CC7 P;  1FOS F;  2QRX A;  2IBZ E;  4W80 A;  1TUO A;  4EJY A;  1N7S C;  1VQN P;  2IBZ D;  2Q3I A;  1WQA A;  4R4M A;  1KN7 A;  1AV1 A;  1EDI A;  3L75 E;  1ZV8 A;  1KB9 E;  2K88 A;  1NHL A;  2IBZ G;  3ZDM A;  1XSZ A;  1KB9 D;  1MFT A;  5AVX B;  1SQV E;  3P8C D;  1SQQ E;  3OA7 A;  4GOE A;  5AVQ B;  3F89 A;  3L75 G;  2Z4E A;  1SQV D;  3TGU E;  3H1I E;  1SQQ D;  3TSI A;  4D6T J;  3IR9 A;  5KLV K;  1OW6 A;  3H1L J;  1MPG A;  1SQQ G;  4U7J A;  2R5X A;  2PP6 A;  3CCM P;  3CI9 A;  3TGU G;  3H1I G;  3D6Z A;  1YQM A;  1VDF A;  4DJG A;  5CBN A;  4MN4 C;  1LTS C;  3DPT A;  1KQL A;  1JFI C;  4H44 B;  5C39 A;  2F7L A;  1YIT P;  1EQ7 A;  1VTL E;  1IK9 A;  2OYH C;  3BCC E;  5APY A;  3GLM A;  1X8Y A;  3BCC D;  1SFC A;  4QMA A;  1U7M A;  2HPC A;  3C1L A;  1YJN P;  1URQ C;  3BCC G;  1UII A;  3AEE C;  1NH4 A;  3B5N B;  1T8Z A;  1AA0 A;  2FYU J;  5E79 H;  3CCU P;  1QN4 A;  1X0T A;  3L71 J;  2E76 D;  4PV1 C;  1ZME C;  1HJB A;  3AEB C;  3II6 A;  1LWU A;  3VP8 A;  2WMM A;  4IL6 X;  1YTB A;  3T97 A;  3CWU A;  1GTW A;  4DT0 A;  3W67 A;  3L73 G;  1Q82 Q;  3L72 J;  2LAE A;  1QL2 A;  1ZRT E;  2E5Y A;  3TK1 A;  4BRY A;  1ZRT D;  1JCC A;  3HTK A;  1GU5 A;  3AE3 C;  5CCH A;  1PCM X;  3MD0 A;  3I0X A;  1OVU A;  5APQ A;  3OGD A;  2ZFD B;  1K35 A;  1Q86 Q;  3CVT A;  1Y47 A;  5DJT B;  2NOB A;  3A0H E;  1DX7 A;  2W8Z A;  3USS A;  1KIL E;  1KQF B;  5APS A;  2W6J H;  3EFG A;  2D2C D;  3PHL A;  2I1K A;  1GW3 A;  3EWK A;  1RF1 C;  1QN5 A;  2A45 G;  4UB6 E;  3NTN A;  2KI7 B;  5EFW B;  3D4V A;  1FDM A;  3V4W A;  3DPU A;  1MZ9 A;  4HH2 A;  2CPB A;  2HPC B;  2ZJS E;  1NGM A;  1PCZ A;  1SS1 A;  2NOI A;  3E7K A;  1N3A A;  2RKL A;  3WUU A;  3Q3D A;  2IDB A;  2NOL A;  2FXO A;  4EAJ A;  3PTZ A;  1NKN A;  1GMJ A;  1KFQ A;  4GOD A;  3PLN A;  1B9K A;  1R5L A;  4WY4 D;  4ASV A;  1NOH A;  1IK7 A;  1SQQ K;  2KIK A;  3NFQ A;  1NYH A;  2B87 A;  4XFJ A;  1QVF O;  2DKD A;  1ZXG A;  3VOP A;  1AIS A;  3CCL P;  1TBP A;  1DD3 A;  3HS9 A;  3IFM A;  5AW8 B;  2WWW A;  1YIJ P;  2V4H A;  2PAJ A;  4W7Z A;  3MP7 B;  1KC8 Q;  4K35 A;  1SP4 A;  2KXP B;  2YKQ A;  1BSH A;  1PGJ A;  1SQP E;  3GHG C;  2V7Q J;  3PRJ A;  1KZU B;  4K3A A;  1SQP D;  5M1B A;  4OVN F;  3TNU A;  1XTG B;  1FE6 A;  4C46 A;  1TGH A;  2Q3E A;  1NJI Q;  1BGY J;  2V8Q A;  3L35 A;  2IBZ I;  5AVS B;  1OVV A;  2D0B A;  4H0L C;  2R3S A;  1QN7 A;  2HG5 D;  4H13 D;  3RL0 C;  5AW2 B;  3CD6 P;  2C9L Y;  3R2P A;  2N9Y B;  4YXW H;  2JO1 A;  2XNX A;  3BRV B;  2FGT A;  3C04 A;  1ZOY C;  2N1T C;  1CI6 A;  1C9B B;  1KB9 H;  3L37 A;  4B0A A;  5KKZ B;  1MUU A;  2B89 A;  1JEK A;  5CCG D;  5IYD P;  4D7R A;  3JCU H;  3AE8 C;  2JP3 A;  1T6A A;  1M3Q A;  2KZI A;  2Q9I A;  4Y28 J;  1L0N E;  1SQB E;  2A06 G;  4MRQ A;  1R5S A;  3CCS P;  2FFD B;  1L0N D;  1M1J B;  1SQB D;  1PZQ A;  2SPZ A;  3MHV A;  2QRE A;  4GDO A;  1VQ6 P;  2O1K A;  1OFC X;  3RBZ A;  1ZR2 A;  1SQB G;  2QJK B;  3GG2 A;  2K9J B;  2WSF J;  3CX5 H;  3HD7 B;  2B87 B;  3AE6 C;  3GF3 A;  4L75 A;  1JY2 P;  1FAV A;  5E79 E;  1USD A;  2H5A X;  2NOH A;  3M9H A;  4ZKU A;  5KLI C;  3NXS A;  4KT0 J;  1AJY A;  2QSI A;  5JN5 A;  1NU1 E;  1KFM A;  1FJK A;  5KAF E;  2FUV A;  2VRS A;  1NU1 D;  3VN5 A;  4C7P A;  3M9B A;  4HJH A;  1PVS A;  1Q81 Q;  1J3M A;  2WVR A;  3VMY A;  3RK2 C;  3CXH D;  1BDC A;  5H2F H;  1FZA A;  4KJM A;  1L4A B;  1BCC J;  2P10 A;  3M0D A;  2Z5H A;  1U57 A;  3BAS A;  3V2N A;  1OXZ A;  2NPS B;  2KSJ A;  2E76 B;  3H1J J;  2JEE A;  1JY3 P;  2BCC E;  3FWN A;  1AQ5 A;  1OW7 A;  3IN6 A;  3UW2 A;  1YQL A;  4WY4 A;  2E75 C;  1HH0 A;  3TE5 A;  1USE A;  3D6Y A;  2BCC D;  4Y99 C;  4HYT B;  3AEF C;  1QLE D;  1BSN A;  4WBA A;  2IV8 A;  2YO3 A;  2I8D A;  4OGQ C;  3C8V A;  4LGD E;  3E1R A;  1M1K Q;  1XTC C;  2WT7 B;  4ROE B;  1GL2 C;  2DKC A;  1BCC D;  3O6Q A;  3TDH A;  4RO0 A;  1HWT C;  1JDY A;  1K05 A;  2YKO A;  2YIU B;  1PGO A;  3CC2 P;  5CMZ A;  3BVH A;  3CCJ P;  1LTJ C;  1M5Q 1;  5BVZ A;  3LW5 J;  1EUV A;  1NTM J;  1FZB A;  1QNB A;  1Q90 D;  2MZ8 A;  2WSE J;  3FGA D;  2K37 A;  1R4X A;  1NH2 A;  1HTL C;  1LTT C;  2D2C B;  5AVW B;  2ZYA A;  3CVS A;  2E74 B;  4YTP C;  1QNC A;  5B66 H;  2ZT9 B;  3HUS C;  3M91 A;  3SWK A;  2HR3 A;  4UB8 H;  1GDT A;  5CCG A;  4IL8 A;  2K3R A;  3I3W A;  3V2R A;  3VN0 A;  3WU2 H;  3OC3 C;  3P8M C;  3OLP A;  3P7K A;  1QVG O;  1RHZ B;  1L0N K;  3HE4 B;  2MKV A;  1SQB K;  1LT9 C;  4JF7 A;  1QGK B;  2O1J A;  4N6J A;  3N7N A;  2C0X A;  1JOC A;  3AED C;  5GTI H;  4JYB A;  4RJT A;  1QEX A;  2KYV A;  1FZC C;  1DH3 A;  1QNE A;  5GTH H;  1PGP A;  1YTZ I;  2KLU A;  4I2L C;  1X79 B;  2AEM A;  2H88 C;  2R44 A;  3D71 A;  3MUD A;  1KIL C;  1P84 H;  1VQ8 P;  3SNS A;  2XU6 A;  1S72 P;  5HSH A;  1VOL B;  4I7Z C;  2Y9Y A;  1PP9 E;  3KTU A;  2KB7 P;  1NTZ E;  3S1K A;  1M3H A;  3O6Q B;  3LIE A;  2KZJ A;  3MTU E;  1PP9 D;  3P8C E;  1NTZ D;  1LTA C;  3L70 J;  2V7Q H;  1IFP A;  1T3J A;  3HD7 D;  3JCU E;  1NU1 K;  1JTH A;  1HGV A;  1HUC A;  3TDK A;  1NTZ G;  4I1L A;  3CWB E;  3M0D C;  5CJ0 A;  3OSE A;  3AEG C;  3HE5 B;  1L0L J;  1OVR A;  3CWB D;  3WUT A;  1SQV G;  2IYO A;  1VF5 C;  4H13 B;  3CWB G;  1JCD A;  1LP1 B;  2D0A A;  2NOF A;  1MP9 A;  2D0C A;  3CX5 E;  2FBW C;  3OW2 O;  1Y8A A;  1K04 A;  2XND H;  1K2Y X;  1KYU A;  3CX5 D;  4D6T E;  1KTM A;  1KQG B;  1NTK J;  1RM1 A;  3CC4 P;  3H1L E;  4D6T D;  3CW7 A;  3GW6 A;  3H1L D;  1KFN A;  1L4A D;  2AXC A;  2NZ2 A;  3S4R A;  4D6T G;  5AVY B;  3L73 J;  1HJ0 A;  5AVV B;  2NPS D;  2NWV A;  4C7N B;  2QM8 A;  2HFE D;  1HBW A;  2J5U A;  3ENO C;  3SSU A;  4KHX A;  5IYB P;  1GK6 A;  1CSB A;  2Q7C A;  2O01 N;  1M7L A;  3EAY A;  2WSF H;  3V2Q A;  1C4G A;  3MGN A;  5KAF H;  1YQK A;  4PY5 A;  4H44 C;  2O01 J;  3WUV A;  3SFD C;  5H2F E;  1QN9 A;  2FYU E;  1NKZ B;  3A2A A;  1EXJ A;  1VQM P;  3CXH H;  3L71 E;  2FYU D;  2IV9 A;  1H88 A;  3L71 D;  5CCG C;  1LT1 A;  2QIW A;  2FYU G;  1SQX J;  3HRN A;  3RSM A;  3I56 P;  3B5N C;  3L71 G;  2YMK A;  4IFD K;  1JTH B;  1YBK A;  4BJU A;  1P5G X;  1GD2 E;  1E5W A;  1T3U A;  2HLO A;  4XE5 B;  3KRM A;  2P58 A;  3L72 E;  2IZ1 A;  1EZV E;  3ITK A;  2HOD B;  3L72 D;  1IO4 A;  1EZV D;  2QEX P;  1S5L H;  3AEC C;  1QN8 A;  3OH9 A;  3MUD C;  1EZV G;  2OOY A;  5CBO A;  2M3E A;  2OYO A;  2E74 D;  3QH9 A;  4ZKP A;  1H89 A;  2H89 C;  2ZT9 D;  1WT6 A;  1S4X A;  1IFD A;  4GOF A;  1L2P A;  2PGD A;  4IFM A;  2R32 A;  4ROC B;  1KV4 A;  1J1E B;  1N7S D;  1RH5 B;  1IFM A;  1RE3 A;  2FFD A;  1M1J A;  4CPG A;  2FXP A;  2DW3 A;  1SLQ A;  2M3B A;  1NTZ K;  2FYN B;  3AE9 C;  1LNQ A;  3KQG A;  2ZYG A;  2FY8 A;  3GHG B;  1DD4 A;  5B66 E;  1PV3 A;  3P32 A;  4UB8 E;  1SQV K;  2K9J A;  2YNY A;  3HD7 A;  3WU2 E;  3RK3 C;  4YPC A;  4I8O A;  3LW5 H;  1KY6 A;  4EYY Q;  3VP9 A;  2ZFC A;  2XDJ A;  4GIF A;  2PRR A;  4IOI H;  3C9I A;  4EAK A;  2WSE H;  1LTI C;  2BEQ D;  5GTI E;  1VQ5 P;  1SFC C;  2OYI A;  5GTH E;  4XA4 A;  1W2E A;  2FYZ A;  2N1T B;  2QJP C;  3H1K J;  2G30 A;  1IZN B;  2QJY C;  1P84 E;  3G71 P;  1QN6 A;  4EJZ A;  2Y0D A;  4B86 A;  1P84 D;  1SQP G;  1URQ D;  3PJS K;  1JY2 O;  3KXD A;  3U59 A;  1A02 F;  4NPD A;  3BAT A;  1LWU C;  3F10 A;  1KB9 I;  2QM7 A;  4QG5 A;  2JPI A;  4PJ0 H;  1L4A A;  3GF7 A;  4WXA A;  3CCE P;  2ZYD A;  1E42 A;  3L36 A;  4U3F J;  2NPS A;  1RF0 A;  2Y8L A;  1KO9 A;  1EC5 A;  4JYC A;  5AVU B;  4N78 D;  3SWY A;  1BGY E;  3H1K D;  1BGY D;  3M06 A;  3EQ2 A;  5KAI H;  1JUN A;  5CCH C;  1KOR A;  4Z1M H;  1BGY G;  2FYU K;  2YMY A;  2WPV B;  1UT4 A;  2Q1K A;  2ZVO B;  2WT7 A;  1JM0 A;  1X9V A;  2Y0C A;  2WSC J;  3CX5 I;  3CWS A;  2IYP A;  1T2K C;  4EAG A;  2IPP A;  1L0N G;  5K5G B;  2ITA A;  2H4L X;  1LGH B;  3AE7 C;  2NOZ A;  1LJ2 A;  1LTG C;  3I5C A;  3ULX A;  2QA4 P;  1EXI A;  2IFN A;  3MIW A;  2YH5 A;  2E42 A;  1EDL A;  2J58 A;  2NVM A;  2OGU A;  1AVY A;  1VQL P;  4L74 A;  1BE3 J;  1LWW A;  2MJZ A;  3H1H J;  3AE1 C;  2PFX A;  2OYI B;  1NVP A;  2XV5 A;  4IL6 H;  1M90 Q;  1KQS O;  3EFF K;  3V4Q A;  2E5T A;  1RE3 C;  2LKM A;  5KLV J;  2YXR B;  2W6B A;  2Y0E A;  4DCK A;  3L74 J;  1VKL A;  2YXQ B;  3Q2Y A;  1M8O B;  2O3O A;  3F0Z A;  3CXH E;  2YA3 A;  4ASW A;  1NU1 G;  2QJK C;  1HF9 A;  1FC2 C;  2KLV A;  1KYD A;  3HE4 A;  1H8A A;  2RN0 A;  2HZS A;  1N7S A;  4OGQ B;  3H32 B;  4EIJ A;  1GU4 A;  1GL2 B;  1JMM A;  2JHJ A;  2GUV A;  5AW9 B;  2M8R A;  3AE5 C;  1UIX A;  2OAR A;  1J1D C;  2W27 A;  3GMA A;  1VQ4 P;  5KLV D;  2OTK E;  1PGQ A;  1EZV I;  1Q2N A;  1FU1 A;  1S1C X;  3AEA C;  2JWA A;  1S5L E;  2IZ0 A;  2O01 H;  2BCC G;  2LXC B;  3VTP C;  1KYO H;  1BCC E;  2EHB D;  2KNC B;  2Q6Q A;  3TYY A;  3EIK A;  2WQY C;  1H0T B;  3WMM 0;  1YYC A;  1D3U A;  5APT A;  1SQP K;  3H1J E;  4OH8 B;  1QL1 A;  1BCC G;  3CLQ A;  1EDJ A;  2OYH A;  1FJP A;  2JWD A;  2LXB A;  3H1J D;  2M5A B;  5TIS H;  5CJ4 A;  4EI2 A;  4Q11 A;  4RKU J;  1L4A C;  4H0L D;  3FX0 A;  1M56 D;  3D70 A;  3HE5 A; 
#chains in the Genus database with same CATH homology
 1T6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...