1T6AA

Crystal structure of protein of unknown function from bacillus stearothermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
AMNTDLKLPAGKTMTIEDVKQLLERYQMALKKTGEQLGWAYEQAAFPYTVRIHESVLYLQGDGRLYKGMAISVRTAGEETFIDIALPPGATHGDKGKANEFSKWLAKTLGGELHLFSGRTMVFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RBSTP2229 gene product
publication title X-ray crystal structure of hypothetical protein (RBSTP2229 gene product) from Bacillus stearothermophilus
rcsb
source organism Geobacillus stearothermophilus
molecule tags Structural genomics, unknown function
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08968 DUF1885 Domain of unknown function (DUF1885)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.850 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Rbstp2229 protein 1t6aA01
3.30.310.120 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Rbstp2229 like protein 1t6aA02
1T6AA
chains in the Genus database with same CATH superfamily
1RF1C 1NTKJ 1D7MA 2CPSA 3CXHE 2VRSA 1YHQP 2J5UA 4ZKUA 1K73Q 2W90A 2WSSH 4WY4A 1KB9H 2Z5IA 3PRJA 3CX5H 5AVVB 4EAKA 4OH8B 1FDOA 3M0DA 1N73C 3V4WA 1Q86Q 4O9BA 3H6PA 2E5TA 1OW8A 1UIIA 3OH9A 1L2PA 1EDIA 3RBZA 3CD6P 3HE5A 2A06D 5TISH 1L0LG 1KD1Q 2LAEA 2DKDA 3Q5SA 1T6AA 2MJ7A 2B87B 5CJ0A 3D71A 1PZDA 2Y9YA 1OMIA 2GUSA 4Y99B 3H1JJ 1SLQA 1FZCA 1QNEA 3FX0A 3OSEA 3KQGA 4EAJA 3V2NA 3TSIA 2QG4A 3HD7C 3KXDA 1RF1A 2ZFCA 1GD2E 4K35A 2OYIC 3CCVP 2N9BA 1K05A 1LTTC 1FZAA 2W8ZA 5K5GB 3HUSB 3P8MC 3H1KJ 3T97B 1FBMA 1GK4A 1IK9A 1NO4A 1OX3A 1G2CA 1N2DC 3HE4A 3L72J 2FFDC 4U3FD 1B9KA 1WMKA 3PTZA 1U7MA 2WQYC 3DPTA 3JCUE 3GHGA 1K9MQ 4ROEB 3RK3B 3P7KA 2UWJE 2MJZA 2B88A 4JYBA 2K3RA 3MZWB 5KJ7C 5APSA 1GTWA 1JMBA 2FYZA 1TUOA 2Z5HA 2YKOA 1YTZT 2WT7B 1NU1E 1S5LX 1UL7A 3M9HA 4UB8H 5AW9B 3AE4C 1KQFB 1NU1K 3V4QA 3BKQX 2MZ8A 3UIAA 3ULXA 2NOEA 4DT0A 1HGVA 4D6TD 2A06G 3OGDA 5JN5A 5AW8B 3ITKA 1FAVA 1CI6B 1K35A 2RH0A 4IFMA 3UW2A 2NOHA 3ENOC 2B9BA 1Q7YQ 3I3WA 1URQB 5BU5A 3PDKA 1PP9D 2E42A 1C47A 3CLQA 5KJ7A 1M1JA 1SFCC 1Y8AA 1TBPA 1VQPP 1J1DC 3V2PA 3B5NC 4HJHA 1EXJA 3TF5A 1IFMA 1N7SC 3O6QB 5CCGD 1EZVE 2XV5A 1QL2A 1JTHA 2HL9A 3L37A 3B8EB 1J1EB 4GOFA 3AE5C 1ZV8A 2R5XA 4RODB 4OVNF 2FYNC 1KYOE 1BGYE 1U7JA 2Q6QA 3GG2A 2QIWA 1VF5D 1VQLP 2KK7A 3L71J 2XNXA 3L75D 1MFZA 4N78D 2FUVA 4OGQD 1KORA 1S9KE 1KFNA 1OVRA 1PZQA 1AVYA 4PD4E 2E74C 4GIFA 2O1JA 2LXBA 1USDA 4ZKPA 3PJSK 1SFCA 2BASA 5KAIE 3U1CA 4OWFA 1RM1A 2M3BA 4PJ0E 5H2FH 1M1KQ 3HS9A 1KILE 1XSZA 4QG5A 5AW6B 1RHZB 4PV1B 3CCMP 3B5NA 1PVSA 2D2CB 1SQPG 1WRGA 3RGUA 4D6TG 1HU0A 1L0LE 2NOFA 1ZRTD 2XZRA 3P32A 1RH5B 2HODB 1PCJX 4ASVA 1QVGO 1SS1A 3CL3D 2KNCB 1SQXE 1L0LK 3CCRP 4TLFA 1JY3P 1SQXK 1KY7A 1JY2O 1KYFA 1PP9G 1RQUA 1H89A 2JP3A 1KB9E 1NTMG 2BEZF 3CX5E 1FZFA 2WT7A 1X9VA 3VYIA 2KS1B 1NVPA 1L4AB 5KTBA 1QL1A 1K2YX 5TISE 2OTKE 1LWUC 2E76C 1JFIC 3IAOA 1LT9C 1FJPA 3CI9A 2YKPA 1M90Q 5AVSB 1NTKD 2GA1A 3JSVC 4EDFA 3OSTA 3AEDC 4YXDC 3ASMA 1MUUA 1HWTC 3JC22 1H0TB 3CCQP 1M56D 3RK2C 3SNSA 3A3YB 3F0ZA 1QN6A 4H0LC 2ZYAA 2KYVA 1OW6A 3EIKA 3RPJA 1BE3J 1DEEG 3C9IA 2O01N 3A2AA 1BDCA 5AW3B 4XFJA 1IFDA 2NPSB 1VQ8P 3SFDC 1WT6A 3VTPC 2WSCJ 1QX8A 1D3UA 1Q2NA 1KILC 3H1JD 2WSFJ 3M06A 1KYDA 5BMPA 2A06E 3CCLP 1LT9A 1AISA 2WSEJ 1EDKA 3CVSA 4DOJA 1LTBC 2Q3IA 2J58A 3TK1A 3N4XA 2V9JA 3H1KD 2FXPA 2RMZA 3HRNA 4UB8E 2E5YA 2H88C 3AE6C 1WJWA 1USEA 5HSHA 3L72D 2Y9ZA 3E1RA 4BWNA 1KYUA 2XNDH 3LW5J 2QRDA 3HE5B 2K37A 1GL2A 2C0XA 1Y47A 4HJGH 1FN7A 3RL0C 4U3FE 2QJKC 3IF4A 1FZCB 5CCHD 4H0LD 5IYBP 4IL6X 1J3MA 1NTKG 1RF1B 4UB6H 2NOIA 3S9OA 4WXAA 3FWNA 2N1TA 1YIJP 2R32A 2LR2A 1PCZA 5AW2B 1P5DX 3NTNA 4QMAA 2QR1A 2YH5A 3MIWA 2ZT9B 1K8AQ 1MPGA 3E7KA 2GM4A 3HE4B 5E79H 2QA4P 4GKGA 1M3QA 3V5BA 2DKCA 4W7YA 2HZMA 1KN7A 3OA7A 4YXWH 1YQ4C 3GHGB 3OAKA 3L70J 3H1JG 3CWAA 4D6TE 4DZOA 1GZLA 2Q1KA 1KFMA 2YKQA 3VMXA 2IZ1A 1HVVA 1W2BO 3HD7B 2YIUC 1T2KD 3VMYA 1PP9E 4EYYQ 1SQVD 2QE7H 1JY3N 2IX7C 4H13B 3CC7P 3OLPA 4C7PA 5H2FE 1W5CE 1NTME 4HB1A 3M91A 1N86A 3H1IJ 1NTMK 1YQMA 1EZVG 1S4XA 2OYHA 2IBZI 2FFDB 1YQKA 1NTZJ 2KP8A 4I8OA 3TYYA 1HUCA 2NLVA 1Q90D 2XKMA 1OVVA 3L71D 2SPZA 3VMAA 1QNCA 2XHIA 2G3AA 1OIPA 3FGAD 2NWVA 2CPBA 3CWBJ 2W83C 1VOLB 3L75E 4N78E 2IBZD 3H1LJ 2QJPC 1M57D 2HKPA 2QJYC 3CWTA 3P8CD 4R4LA 1RE4A 2Z4EA 4GOEA 1JTHB 2A45G 2YO3A 1N7LA 3FWLA 3GMAA 3IFMA 2IV9A 2NPSD 4TT3H 1N39A 3WUTA 4RESB 2WZ7A 1TU3F 2R5BA 1FE6A 1ZR4A 2P67A 2ZJSE 1SQXG 1ZRTE 1IK7A 2AEMA 5AVRB 1R5LA 1LTGC 2O3JA 3WUUA 1PGPA 1S1CX 5APVA 3U59A 2R5DA 1SFCB 1M5Q1 3H1ZA 1SQVG 1KQSO 2G30A 1J1DB 2QVAA 4WY4D 1QTPA 2FXMA 3AE8C 1SQQD 1HGZA 3L74J 4L76A 3B5NB 2QM7A 5AW7B 3NFQA 1JM0A 1NGMB 1N7SB 4L75A 4H44D 2QRCA 3VN0A 1XTCC 3OH6A 2JHJA 1N73A 5BU8B 2Q7CA 2POHA 1JO5A 2OTJP 2NRGA 2GUVA 2H7HA 5CBNA 3L71G 2QLVA 2FYNB 1RF0C 2FYUJ 2WPVB 5KLVD 5CCGC 1NTKE 3PH0A 1MFTA 2JR8A 3Q2YA 1BE3D 2M0BA 3QH9A 3Q3DA 3OW2O 1NTKK 4Y28J 4GT1A 3AEEC 3L73J 2E74B 1LWWA 2IBZG 3CWUA 3BRVB 3HD7A 4ROCB 1VF5C 1GDTA 3B4SA 4L73A 1DD3A 2OYIA 2OYOA 2PFXA 4OGQC 3V2QA 3U1AA 2ZT9D 2WTYA 1BGYJ 1LWYA 2I1KA 1X0TA 1IFJA 3SWKA 3L36A 2NOZA 2QM8A 2KOGA 5APQA 2WPSA 3CWSA 4EIJA 3CCEP 2FFDA 3H1JE 3KYQA 1JY3O 2DKAA 5JMVD 2K9JA 1OWAA 2OARA 4IOIH 4BRYB 4UB6E 3IH7A 5CCGA 3NMDA 1DX7A 4C7RA 1IFPA 1P84I 3WMM0 2JDIH 4LC1A 3H1KE 1Y9BA 2AEFA 4WX8A 1IO4A 3OC3C 1SQQG 5E79E 1L0LJ 3SWYA 3L72E 2JHNA 3R4YA 2WSCH 2YMKA 1C9BB 1VDFA 4AYCA 2E76B 5BMNA 3CVTA 3S4RA 1P84D 4U3FG 1LT9B 2I1JA 1JCDA 3TDKA 3VP8A 1VQOP 3A5TA 1YTFA 2WSEH 5KLVG 5AVQB 1VTOA 2V7QJ 2AXCA 4NPFX 2IDBA 3QWOC 3G6EP 1S2EA 1QEXA 2ZXEB 1L0ND 1BCCJ 2I5WA 1GK6A 2WITA 2KSEA 3L70D 3LW5H 1GL2B 3M9BA 2OGUA 5AVUB 1LXTA 4EI2A 5CHXA 3CCUP 1KO9A 1GU5A 3Q5RA 1NGMA 1N7SA 1HTLC 1KILB 4XE5B 2IYOA 3IR9A 2FBWC 1OVUA 4L74A 2KUBA 1VQ6P 1P84H 2FY8A 2E75B 2JOIA 2N1TB 4BXLA 2KIKA 4JYCA 3H1ID 1DH3A 1FOSE 1SQVE 1VQKP 1NTZD 1SQVK 1YQRA 2BCCJ 1QN4A 1Q82Q 2OTLP 1Z56A 1JCCA 3EFGA 1OW7A 3RSMA 5GTIH 1S5LH 1KTMA 1J2JB 3BCCJ 3RL0B 5AW1B 2HPCB 3DPUA 2QJKB 3H1HD 3CWBD 1TGHA 1VOKA 3L71E 1CSBA 1BSHA 2FKMX 1QGKB 4DCKA 2KSJA 3H1LD 3RK3D 2CK3H 5C39A 2O01J 3L75G 4BRYA 3TDHA 1LTJC 5CCHC 1DIPA 2OQQA 1J1EC 5KKZB 1T3JA 1FZGA 2IBZE 3I55P 1PPJD 2KZIA 3G4SP 1L0NG 4K3AA 2D0BA 3P8CE 3NXSA 2OYHB 4GODA 3TGUJ 3HTKA 4B86A 4N3YB 3VN5A 1E5WA 1T8ZA 2R3SA 1WQAA 1MKMA 3T4NA 1PGOA 3I0WA 1NJIQ 1OFCX 1AFOA 1SVFA 1LWUA 2P1JA 1PL5A 1GW4A 1JUNA 1NH2A 2JWAA 2AEJA 3GW6A 4EJZA 3OJAB 2YNYA 2YIUB 5APYA 2KZJA 3L74D 5EFWB 3G71P 3II6A 4D7QA 1AA0A 1VQ4P 4I1LA 1URQD 3V6IA 3AE7C 1LTJA 1NKZB 1SQPJ 1LJ2A 4D6TJ 4IFFA 1W80A 1SQQE 3A7OA 1NTZG 2KLVA 1YI2P 1T2KC 5EPCA 1QN3A 1HJ0A 1SQQK 3I0XA 3Q5PA 1K04A 3GF3A 1KYOI 2FYUD 2RN0A 2W6BA 1JY2P 1AV1A 5B5EH 1ZLLA 4EOTA 3EFFK 3H1HG 1KILA 3MP7B 3CWBG 3TNUA 3F10A 2RKLA 3D4VA 3KPEA 3L73D 1NAFA 1NVOA 1NTMJ 5KLVE 3EWKA 2HFED 2ITAA 2YXRB 5KLVK 1BE3E 2FKWB 1FDMA 2QJPB 1KMIZ 2O1KA 4C7NB 1FZEA 2P10A 4IFDK 2QJYB 4HKZH 3MD0A 4W7ZA 3SWFA 1PPJG 4C46A 2OOYA 4XA4A 5AN4A 3LIEA 1N73B 2R3CA 1MZ9A 1R8EA 1TBAB 3A0HH 2NOLA 1SQBJ 3VP9A 3RBXA 1DD4A 4PV1D 3MGNA 1KC8Q 5AVYB 2IYPA 2ZFDB 3R2PA 2D2CD 4EAGA 2D0AA 1FS0E 1YTBA 2HPCA 4DJGA 2O3OA 3CC4P 1VQMP 1AJYA 2NPSC 2KI7B 3C8VA 1EQ7A 3CX5I 1OZHA 2N1TD 2H4LX 1FC2C 2K9YA 3CCSP 2WVRA 2IPPA 3H1KG 5KL0A 2OYIB 4WBAA 1MV8A 5DJUB 3AECC 1HH0A 3PHLA 1UT4A 1ZN5A 2JJLA 1LTAC 3F5HA 3L72G 4I7ZC 4WY4C 1ZW0A 2FYUG 1NH4A 1L4AD 1RE3C 2K9JB 1LGHB 2PP6A 1P84E 4WB4A 1VQ9P 1KZUB 1EDJA 1CZQA 2JKVA 4H44C 1YJ9P 3S1KA 5AVWB 2H89C 2PGDA 2XDJA 2VJ0A 2C0WA 3CC2P 2WPQA 1BCCD 2Q5UA 1JB0J 3SFEC 2MKVA 1QN7A 4NPDA 3SSUA 3MTUE 2KLUA 2JWDA 5AW4B 2L5GB 1VF5B 4LGDE 3CCJP 1L0NE 4OGQB 4EAIA 3AEGC 5GTIE 1S5LE 1L0NK 3L70E 3D6YA 1EBMA 4RKUJ 1GMJA 2YA3A 2WPRA 3TE5A 3ZDMA 2QRXA 1H8AA 4HH2A 3WU2H 4AQRD 2LXCB 1BDDA 2ZT9C 4DULA 1RE3A 1NU1J 4RO0A 3VOPA 1LP1A 2K1AA 1X22A 1X79B 1NYHA 2V7QH 4R4MA 5APXA 1VQNP 5APTA 3GHGC 5APUA 2QEXP 2ZXXA 2KB7P 3Q1MA 4IL6H 2Q3EA 2PAJA 1HF9A 1N3CA 4EJYA 2BCCD 5APWA 3H1IE 2Y0EA 1C4GA 2V92A 4W80A 2P2UA 4C7NA 2HYNA 3BCCD 1M7LA 2LKMA 2JO1A 4YTPC 1NTZE 2QREA 1XTGB 3W67A 1JDYA 1NTZK 2W6AA 4BJUA 3KZIH 3AEBC 4H13C 4WVZA 2OOXA 1YYCA 2YO2A 3C1LA 5KLIC 3H1HE 3N89A 3OSMA 3CWBE 1JY2N 2F7LA 1PGJA 1JNMA 1PIXA 3H1LE 3RK3E 1S72P 1BCCG 3G3ZA 1T3UA 1UIXA 3TGUD 2FKFA 3C04A 3NA5A 1PPJE 5BVZA 1VTLE 4AUWA 1ZMEC 1M1JC 1QN9A 3B71A 1R5SA 3MHVA 3OCIA 4WWIA 1RQVA 1E42A 5B5EE 4KT0J 3IN6A 2Y0DA 2JEEA 4YPCA 1FU1A 3A0BH 1NHLA 5TJHA 3EQ2A 1LTIC 1FJKA 2AXTH 1RF0A 1LNQA 5B66H 2O01H 2ZAEB 1SQPD 2B89A 2QSIA 4JQ0D 2H8PD 1Q81Q 2NVMA 3L74E 3HD7D 4ASWA 2BCCG 3K5BA 1KY6A 1NOHA 3HTKB 3A0HE 3BCCG 1P5GX 4H13D 4Y99C 5AW5B 1EDLA 1SQXJ 1YQLA 2M8RA 1IJDB 1GW3A 1LWUB 1QNBA 3AEFC 3EAYA 1BSNA 2WSFH 1NTMD 1UT7A 2FYUE 3FXEA 1Q9UA 3HUSC 3CXHI 2FYUK 1SQVJ 5KAFH 2Y8QA 4ZMDA 1VQ7P 1A02J 3L73E 1M3HA 1JEKA 1S3JA 3O8ZA 1BE3G 3RK2B 1KQLA 1LTJB 3BRTB 5KJ7D 4H0LB 1NWQA 2NZ2A 2I8DA 1SQBD 3TGUG 3H32B 1ZXGA 4NPEA 3RK3C 5GTHH 1ZOYC 3PP5A 2B87A 3CXHD 3L4FA 2M5AB 2DW3A 3RL0g 4ZNCA 4Q11A 2R44A 3CPWO 3CW7A 1HJBA 3TNUB 3PLNA 1G1IA 1IFIA 2V4HA 1R4XA 1EC5A 4KHXA 1AQ5A 2IZ0A 1JMMA 1FOSF 3HUSA 3T97A 1QTSA 3CMAP 2H43A 4JBZA 4B0AA 1A02F 2Y8LA 2NOBA 4CFFA 3V2RA 2P7JA 2ZVNB 1VL2A 2WWWA 1SFCD 2D0CA 1LT1A 1GU4A 1NAYA 2G8YA 2HL8A 1JOCA 3ABVC 1EXIA 1YJWP 2M3EA 4LLHA 4JPZB 2FXOA 3D70A 5DJTB 1RY3A 3B5ND 1FZBA 1URQC 1VQ5P 4N6JA 2Y0CA 1N7SD 3CXHH 1NKNA 2YXQB 3WU2E 1YITP 3HS8A 2J59M 2ZYDA 1G1JA 3L35A 3BASA 3I56P 1YBKA 1VKLA 2IFMA 2L91A 1SQQJ 1ZR2A 1AVOA 5L8RJ 1V5SA 3WUVA 2XU6A 4IL6E 1MP9A 1ZP0C 1IFNA 3MUDC 1BCCE 4WZSD 3H25A 1SQBG 2E74D 1SP4A 4U3FJ 1W2EA 2V8QA 1OXZA 3LIDA 3L70G 2HG5D 1CI6A 4M3LA 5KLVJ 3D7QA 3I5CA 1NU1D 2JPIA 2Z8UA 3KZIE 1PGQA 2W27A 3GF7A 1URQA 4TPSA 3CMEP 3M9QA 3E1IA 4MN4C 1H88A 5CBOA 2C9NY 5CMZA 4EALA 5IYCP 1GL2C 2Q9IA 4PV1C 1CW5A 3USSA 4KJMA 2D2CC 3O6QA 1QVFO 1KQGB 4CPGA 1YJNP 3MUDA 3KHUA 2PRRA 2Z0FA 3H1IG 5AW0B 5CCHA 3JCUH 2BCCE 1EZVI 1X8YA 2E75C 2N1TC 3H32A 3ENCA 3BCCE 4I7ZB 1YQ3C 1QNAA 1KV4A 1FDIA 4WY4B 1DIZA 1IC2A 4A7PA 4HYTB 2M5AA 1HBWA 2PWWA 3A0BE 1LP1B 3KRMA 1PP9J 2E76D 3G9RA 2E43A 4H44B 1LWVA 2AXTE 5B66E 3BATA 1VPCA 4I6MC 1EZVD 4PD4I 3H1LG 2ZVOB 1N8RQ 5AVTB 3W68A 1L4AC 3AE9C 1QN8A 1PFIA 4U7JA 4RJTA 2K88A 2YMYA 3RK2D 4JF7A 1KYOD 5AVXB 1BGYD 2A45I 1LTSC 3GLMA 3TGUE 3AE2C 1KFIA 4GDOA 2HODA 2KNCA 2N9YB 1S9KD 5M1BA 1QN5A 4PD4D 2HR3A 1GL2D 1NU1G 1KFQA 1QLED 5KKZC 2FGTA 4PY5A 3L75J 2H5AX 3KTUA 1KILD 5KAFE 3VMZA 1G2CB 2OYHC 1N3AA 1PV3A 1L0NJ 2KS1A 1KB9I 3D6ZA 2WMMA 2E75D 2IFNA 1AQTA 4D7RA 2HLOA 3N7NA 1SQPE 1L0LD 1L4AA 3L74G 1PCMX 1CDWA 2P58A 3AEAC 1M8OB 5GTHE 4MRQA 1SQXD 1SQPK 3FXDA 3BVHA 3AE3C 1KYOH 1U57A 2BEQD 2W6JH 1KB9D 5CJ4A 3CX5D 1H0TA 4Z1MH 1RE4C 4PD4H 2ZYGA 2C9LY 3AE1C 3PMGA 3M0DC 1E79H 5KLIB 3RL0D 3F89A 5KAIH 2HZSA 3KDPB 1YTZI 4PJ0H 5AVZB 3L73G 4IL8A 2A45H 2KXPB 2NPSA 4I2LC 1IZNB 1DEBA 1BGYG 1FZCC 5IYDP 2EHBD 1SQBE 3M0AA 2IV8A 3H1HJ 5F9CA 1M1JB 1SQBK 1EUVA
chains in the Genus database with same CATH topology
1T6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T6A A; 
#chains in the Genus database with same CATH topology
 1RF1 C;  1NTK J;  1D7M A;  2CPS A;  3CXH E;  2VRS A;  1YHQ P;  2J5U A;  4ZKU A;  1K73 Q;  2W90 A;  2WSS H;  4WY4 A;  1KB9 H;  2Z5I A;  3PRJ A;  3CX5 H;  5AVV B;  4EAK A;  4OH8 B;  1FDO A;  3M0D A;  1N73 C;  3V4W A;  1Q86 Q;  4O9B A;  3H6P A;  2E5T A;  1OW8 A;  1UII A;  3OH9 A;  1L2P A;  1EDI A;  3RBZ A;  3CD6 P;  3HE5 A;  2A06 D;  5TIS H;  1L0L G;  1KD1 Q;  2LAE A;  2DKD A;  3Q5S A;  1T6A A;  2MJ7 A;  2B87 B;  5CJ0 A;  3D71 A;  1PZD A;  2Y9Y A;  1OMI A;  2GUS A;  4Y99 B;  3H1J J;  1SLQ A;  1FZC A;  1QNE A;  3FX0 A;  3OSE A;  3KQG A;  4EAJ A;  3V2N A;  3TSI A;  2QG4 A;  3HD7 C;  3KXD A;  1RF1 A;  2ZFC A;  1GD2 E;  4K35 A;  2OYI C;  3CCV P;  2N9B A;  1K05 A;  1LTT C;  1FZA A;  2W8Z A;  5K5G B;  3HUS B;  3P8M C;  3H1K J;  3T97 B;  1FBM A;  1GK4 A;  1IK9 A;  1NO4 A;  1OX3 A;  1G2C A;  1N2D C;  3HE4 A;  3L72 J;  2FFD C;  4U3F D;  1B9K A;  1WMK A;  3PTZ A;  1U7M A;  2WQY C;  3DPT A;  3JCU E;  3GHG A;  1K9M Q;  4ROE B;  3RK3 B;  3P7K A;  2UWJ E;  2MJZ A;  2B88 A;  4JYB A;  2K3R A;  3MZW B;  5KJ7 C;  5APS A;  1GTW A;  1JMB A;  2FYZ A;  1TUO A;  2Z5H A;  2YKO A;  1YTZ T;  2WT7 B;  1NU1 E;  1S5L X;  1UL7 A;  3M9H A;  4UB8 H;  5AW9 B;  3AE4 C;  1KQF B;  1NU1 K;  3V4Q A;  3BKQ X;  2MZ8 A;  3UIA A;  3ULX A;  2NOE A;  4DT0 A;  1HGV A;  4D6T D;  2A06 G;  3OGD A;  5JN5 A;  5AW8 B;  3ITK A;  1FAV A;  1CI6 B;  1K35 A;  2RH0 A;  4IFM A;  3UW2 A;  2NOH A;  3ENO C;  2B9B A;  1Q7Y Q;  3I3W A;  1URQ B;  5BU5 A;  3PDK A;  1PP9 D;  2E42 A;  1C47 A;  3CLQ A;  5KJ7 A;  1M1J A;  1SFC C;  1Y8A A;  1TBP A;  1VQP P;  1J1D C;  3V2P A;  3B5N C;  4HJH A;  1EXJ A;  3TF5 A;  1IFM A;  1N7S C;  3O6Q B;  5CCG D;  1EZV E;  2XV5 A;  1QL2 A;  1JTH A;  2HL9 A;  3L37 A;  3B8E B;  1J1E B;  4GOF A;  3AE5 C;  1ZV8 A;  2R5X A;  4ROD B;  4OVN F;  2FYN C;  1KYO E;  1BGY E;  1U7J A;  2Q6Q A;  3GG2 A;  2QIW A;  1VF5 D;  1VQL P;  2KK7 A;  3L71 J;  2XNX A;  3L75 D;  1MFZ A;  4N78 D;  2FUV A;  4OGQ D;  1KOR A;  1S9K E;  1KFN A;  1OVR A;  1PZQ A;  1AVY A;  4PD4 E;  2E74 C;  4GIF A;  2O1J A;  2LXB A;  1USD A;  4ZKP A;  3PJS K;  1SFC A;  2BAS A;  5KAI E;  3U1C A;  4OWF A;  1RM1 A;  2M3B A;  4PJ0 E;  5H2F H;  1M1K Q;  3HS9 A;  1KIL E;  1XSZ A;  4QG5 A;  5AW6 B;  1RHZ B;  4PV1 B;  3CCM P;  3B5N A;  1PVS A;  2D2C B;  1SQP G;  1WRG A;  3RGU A;  4D6T G;  1HU0 A;  1L0L E;  2NOF A;  1ZRT D;  2XZR A;  3P32 A;  1RH5 B;  2HOD B;  1PCJ X;  4ASV A;  1QVG O;  1SS1 A;  3CL3 D;  2KNC B;  1SQX E;  1L0L K;  3CCR P;  4TLF A;  1JY3 P;  1SQX K;  1KY7 A;  1JY2 O;  1KYF A;  1PP9 G;  1RQU A;  1H89 A;  2JP3 A;  1KB9 E;  1NTM G;  2BEZ F;  3CX5 E;  1FZF A;  2WT7 A;  1X9V A;  3VYI A;  2KS1 B;  1NVP A;  1L4A B;  5KTB A;  1QL1 A;  1K2Y X;  5TIS E;  2OTK E;  1LWU C;  2E76 C;  1JFI C;  3IAO A;  1LT9 C;  1FJP A;  3CI9 A;  2YKP A;  1M90 Q;  5AVS B;  1NTK D;  2GA1 A;  3JSV C;  4EDF A;  3OST A;  3AED C;  4YXD C;  3ASM A;  1MUU A;  1HWT C;  3JC2 2;  1H0T B;  3CCQ P;  1M56 D;  3RK2 C;  3SNS A;  3A3Y B;  3F0Z A;  1QN6 A;  4H0L C;  2ZYA A;  2KYV A;  1OW6 A;  3EIK A;  3RPJ A;  1BE3 J;  1DEE G;  3C9I A;  2O01 N;  3A2A A;  1BDC A;  5AW3 B;  4XFJ A;  1IFD A;  2NPS B;  1VQ8 P;  3SFD C;  1WT6 A;  3VTP C;  2WSC J;  1QX8 A;  1D3U A;  1Q2N A;  1KIL C;  3H1J D;  2WSF J;  3M06 A;  1KYD A;  5BMP A;  2A06 E;  3CCL P;  1LT9 A;  1AIS A;  2WSE J;  1EDK A;  3CVS A;  4DOJ A;  1LTB C;  2Q3I A;  2J58 A;  3TK1 A;  3N4X A;  2V9J A;  3H1K D;  2FXP A;  2RMZ A;  3HRN A;  4UB8 E;  2E5Y A;  2H88 C;  3AE6 C;  1WJW A;  1USE A;  5HSH A;  3L72 D;  2Y9Z A;  3E1R A;  4BWN A;  1KYU A;  2XND H;  3LW5 J;  2QRD A;  3HE5 B;  2K37 A;  1GL2 A;  2C0X A;  1Y47 A;  4HJG H;  1FN7 A;  3RL0 C;  4U3F E;  2QJK C;  3IF4 A;  1FZC B;  5CCH D;  4H0L D;  5IYB P;  4IL6 X;  1J3M A;  1NTK G;  1RF1 B;  4UB6 H;  2NOI A;  3S9O A;  4WXA A;  3FWN A;  2N1T A;  1YIJ P;  2R32 A;  2LR2 A;  1PCZ A;  5AW2 B;  1P5D X;  3NTN A;  4QMA A;  2QR1 A;  2YH5 A;  3MIW A;  2ZT9 B;  1K8A Q;  1MPG A;  3E7K A;  2GM4 A;  3HE4 B;  5E79 H;  2QA4 P;  4GKG A;  1M3Q A;  3V5B A;  2DKC A;  4W7Y A;  2HZM A;  1KN7 A;  3OA7 A;  4YXW H;  1YQ4 C;  3GHG B;  3OAK A;  3L70 J;  3H1J G;  3CWA A;  4D6T E;  4DZO A;  1GZL A;  2Q1K A;  1KFM A;  2YKQ A;  3VMX A;  2IZ1 A;  1HVV A;  1W2B O;  3HD7 B;  2YIU C;  1T2K D;  3VMY A;  1PP9 E;  4EYY Q;  1SQV D;  2QE7 H;  1JY3 N;  2IX7 C;  4H13 B;  3CC7 P;  3OLP A;  4C7P A;  5H2F E;  1W5C E;  1NTM E;  4HB1 A;  3M91 A;  1N86 A;  3H1I J;  1NTM K;  1YQM A;  1EZV G;  1S4X A;  2OYH A;  2IBZ I;  2FFD B;  1YQK A;  1NTZ J;  2KP8 A;  4I8O A;  3TYY A;  1HUC A;  2NLV A;  1Q90 D;  2XKM A;  1OVV A;  3L71 D;  2SPZ A;  3VMA A;  1QNC A;  2XHI A;  2G3A A;  1OIP A;  3FGA D;  2NWV A;  2CPB A;  3CWB J;  2W83 C;  1VOL B;  3L75 E;  4N78 E;  2IBZ D;  3H1L J;  2QJP C;  1M57 D;  2HKP A;  2QJY C;  3CWT A;  3P8C D;  4R4L A;  1RE4 A;  2Z4E A;  4GOE A;  1JTH B;  2A45 G;  2YO3 A;  1N7L A;  3FWL A;  3GMA A;  3IFM A;  2IV9 A;  2NPS D;  4TT3 H;  1N39 A;  3WUT A;  4RES B;  2WZ7 A;  1TU3 F;  2R5B A;  1FE6 A;  1ZR4 A;  2P67 A;  2ZJS E;  1SQX G;  1ZRT E;  1IK7 A;  2AEM A;  5AVR B;  1R5L A;  1LTG C;  2O3J A;  3WUU A;  1PGP A;  1S1C X;  5APV A;  3U59 A;  2R5D A;  1SFC B;  1M5Q 1;  3H1Z A;  1SQV G;  1KQS O;  2G30 A;  1J1D B;  2QVA A;  4WY4 D;  1QTP A;  2FXM A;  3AE8 C;  1SQQ D;  1HGZ A;  3L74 J;  4L76 A;  3B5N B;  2QM7 A;  5AW7 B;  3NFQ A;  1JM0 A;  1NGM B;  1N7S B;  4L75 A;  4H44 D;  2QRC A;  3VN0 A;  1XTC C;  3OH6 A;  2JHJ A;  1N73 A;  5BU8 B;  2Q7C A;  2POH A;  1JO5 A;  2OTJ P;  2NRG A;  2GUV A;  2H7H A;  5CBN A;  3L71 G;  2QLV A;  2FYN B;  1RF0 C;  2FYU J;  2WPV B;  5KLV D;  5CCG C;  1NTK E;  3PH0 A;  1MFT A;  2JR8 A;  3Q2Y A;  1BE3 D;  2M0B A;  3QH9 A;  3Q3D A;  3OW2 O;  1NTK K;  4Y28 J;  4GT1 A;  3AEE C;  3L73 J;  2E74 B;  1LWW A;  2IBZ G;  3CWU A;  3BRV B;  3HD7 A;  4ROC B;  1VF5 C;  1GDT A;  3B4S A;  4L73 A;  1DD3 A;  2OYI A;  2OYO A;  2PFX A;  4OGQ C;  3V2Q A;  3U1A A;  2ZT9 D;  2WTY A;  1BGY J;  1LWY A;  2I1K A;  1X0T A;  1IFJ A;  3SWK A;  3L36 A;  2NOZ A;  2QM8 A;  2KOG A;  5APQ A;  2WPS A;  3CWS A;  4EIJ A;  3CCE P;  2FFD A;  3H1J E;  3KYQ A;  1JY3 O;  2DKA A;  5JMV D;  2K9J A;  1OWA A;  2OAR A;  4IOI H;  4BRY B;  4UB6 E;  3IH7 A;  5CCG A;  3NMD A;  1DX7 A;  4C7R A;  1IFP A;  1P84 I;  3WMM 0;  2JDI H;  4LC1 A;  3H1K E;  1Y9B A;  2AEF A;  4WX8 A;  1IO4 A;  3OC3 C;  1SQQ G;  5E79 E;  1L0L J;  3SWY A;  3L72 E;  2JHN A;  3R4Y A;  2WSC H;  2YMK A;  1C9B B;  1VDF A;  4AYC A;  2E76 B;  5BMN A;  3CVT A;  3S4R A;  1P84 D;  4U3F G;  1LT9 B;  2I1J A;  1JCD A;  3TDK A;  3VP8 A;  1VQO P;  3A5T A;  1YTF A;  2WSE H;  5KLV G;  5AVQ B;  1VTO A;  2V7Q J;  2AXC A;  4NPF X;  2IDB A;  3QWO C;  3G6E P;  1S2E A;  1QEX A;  2ZXE B;  1L0N D;  1BCC J;  2I5W A;  1GK6 A;  2WIT A;  2KSE A;  3L70 D;  3LW5 H;  1GL2 B;  3M9B A;  2OGU A;  5AVU B;  1LXT A;  4EI2 A;  5CHX A;  3CCU P;  1KO9 A;  1GU5 A;  3Q5R A;  1NGM A;  1N7S A;  1HTL C;  1KIL B;  4XE5 B;  2IYO A;  3IR9 A;  2FBW C;  1OVU A;  4L74 A;  2KUB A;  1VQ6 P;  1P84 H;  2FY8 A;  2E75 B;  2JOI A;  2N1T B;  4BXL A;  2KIK A;  4JYC A;  3H1I D;  1DH3 A;  1FOS E;  1SQV E;  1VQK P;  1NTZ D;  1SQV K;  1YQR A;  2BCC J;  1QN4 A;  1Q82 Q;  2OTL P;  1Z56 A;  1JCC A;  3EFG A;  1OW7 A;  3RSM A;  5GTI H;  1S5L H;  1KTM A;  1J2J B;  3BCC J;  3RL0 B;  5AW1 B;  2HPC B;  3DPU A;  2QJK B;  3H1H D;  3CWB D;  1TGH A;  1VOK A;  3L71 E;  1CSB A;  1BSH A;  2FKM X;  1QGK B;  4DCK A;  2KSJ A;  3H1L D;  3RK3 D;  2CK3 H;  5C39 A;  2O01 J;  3L75 G;  4BRY A;  3TDH A;  1LTJ C;  5CCH C;  1DIP A;  2OQQ A;  1J1E C;  5KKZ B;  1T3J A;  1FZG A;  2IBZ E;  3I55 P;  1PPJ D;  2KZI A;  3G4S P;  1L0N G;  4K3A A;  2D0B A;  3P8C E;  3NXS A;  2OYH B;  4GOD A;  3TGU J;  3HTK A;  4B86 A;  4N3Y B;  3VN5 A;  1E5W A;  1T8Z A;  2R3S A;  1WQA A;  1MKM A;  3T4N A;  1PGO A;  3I0W A;  1NJI Q;  1OFC X;  1AFO A;  1SVF A;  1LWU A;  2P1J A;  1PL5 A;  1GW4 A;  1JUN A;  1NH2 A;  2JWA A;  2AEJ A;  3GW6 A;  4EJZ A;  3OJA B;  2YNY A;  2YIU B;  5APY A;  2KZJ A;  3L74 D;  5EFW B;  3G71 P;  3II6 A;  4D7Q A;  1AA0 A;  1VQ4 P;  4I1L A;  1URQ D;  3V6I A;  3AE7 C;  1LTJ A;  1NKZ B;  1SQP J;  1LJ2 A;  4D6T J;  4IFF A;  1W80 A;  1SQQ E;  3A7O A;  1NTZ G;  2KLV A;  1YI2 P;  1T2K C;  5EPC A;  1QN3 A;  1HJ0 A;  1SQQ K;  3I0X A;  3Q5P A;  1K04 A;  3GF3 A;  1KYO I;  2FYU D;  2RN0 A;  2W6B A;  1JY2 P;  1AV1 A;  5B5E H;  1ZLL A;  4EOT A;  3EFF K;  3H1H G;  1KIL A;  3MP7 B;  3CWB G;  3TNU A;  3F10 A;  2RKL A;  3D4V A;  3KPE A;  3L73 D;  1NAF A;  1NVO A;  1NTM J;  5KLV E;  3EWK A;  2HFE D;  2ITA A;  2YXR B;  5KLV K;  1BE3 E;  2FKW B;  1FDM A;  2QJP B;  1KMI Z;  2O1K A;  4C7N B;  1FZE A;  2P10 A;  4IFD K;  2QJY B;  4HKZ H;  3MD0 A;  4W7Z A;  3SWF A;  1PPJ G;  4C46 A;  2OOY A;  4XA4 A;  5AN4 A;  3LIE A;  1N73 B;  2R3C A;  1MZ9 A;  1R8E A;  1TBA B;  3A0H H;  2NOL A;  1SQB J;  3VP9 A;  3RBX A;  1DD4 A;  4PV1 D;  3MGN A;  1KC8 Q;  5AVY B;  2IYP A;  2ZFD B;  3R2P A;  2D2C D;  4EAG A;  2D0A A;  1FS0 E;  1YTB A;  2HPC A;  4DJG A;  2O3O A;  3CC4 P;  1VQM P;  1AJY A;  2NPS C;  2KI7 B;  3C8V A;  1EQ7 A;  3CX5 I;  1OZH A;  2N1T D;  2H4L X;  1FC2 C;  2K9Y A;  3CCS P;  2WVR A;  2IPP A;  3H1K G;  5KL0 A;  2OYI B;  4WBA A;  1MV8 A;  5DJU B;  3AEC C;  1HH0 A;  3PHL A;  1UT4 A;  1ZN5 A;  2JJL A;  1LTA C;  3F5H A;  3L72 G;  4I7Z C;  4WY4 C;  1ZW0 A;  2FYU G;  1NH4 A;  1L4A D;  1RE3 C;  2K9J B;  1LGH B;  2PP6 A;  1P84 E;  4WB4 A;  1VQ9 P;  1KZU B;  1EDJ A;  1CZQ A;  2JKV A;  4H44 C;  1YJ9 P;  3S1K A;  5AVW B;  2H89 C;  2PGD A;  2XDJ A;  2VJ0 A;  2C0W A;  3CC2 P;  2WPQ A;  1BCC D;  2Q5U A;  1JB0 J;  3SFE C;  2MKV A;  1QN7 A;  4NPD A;  3SSU A;  3MTU E;  2KLU A;  2JWD A;  5AW4 B;  2L5G B;  1VF5 B;  4LGD E;  3CCJ P;  1L0N E;  4OGQ B;  4EAI A;  3AEG C;  5GTI E;  1S5L E;  1L0N K;  3L70 E;  3D6Y A;  1EBM A;  4RKU J;  1GMJ A;  2YA3 A;  2WPR A;  3TE5 A;  3ZDM A;  2QRX A;  1H8A A;  4HH2 A;  3WU2 H;  4AQR D;  2LXC B;  1BDD A;  2ZT9 C;  4DUL A;  1RE3 A;  1NU1 J;  4RO0 A;  3VOP A;  1LP1 A;  2K1A A;  1X22 A;  1X79 B;  1NYH A;  2V7Q H;  4R4M A;  5APX A;  1VQN P;  5APT A;  3GHG C;  5APU A;  2QEX P;  2ZXX A;  2KB7 P;  3Q1M A;  4IL6 H;  2Q3E A;  2PAJ A;  1HF9 A;  1N3C A;  4EJY A;  2BCC D;  5APW A;  3H1I E;  2Y0E A;  1C4G A;  2V92 A;  4W80 A;  2P2U A;  4C7N A;  2HYN A;  3BCC D;  1M7L A;  2LKM A;  2JO1 A;  4YTP C;  1NTZ E;  2QRE A;  1XTG B;  3W67 A;  1JDY A;  1NTZ K;  2W6A A;  4BJU A;  3KZI H;  3AEB C;  4H13 C;  4WVZ A;  2OOX A;  1YYC A;  2YO2 A;  3C1L A;  5KLI C;  3H1H E;  3N89 A;  3OSM A;  3CWB E;  1JY2 N;  2F7L A;  1PGJ A;  1JNM A;  1PIX A;  3H1L E;  3RK3 E;  1S72 P;  1BCC G;  3G3Z A;  1T3U A;  1UIX A;  3TGU D;  2FKF A;  3C04 A;  3NA5 A;  1PPJ E;  5BVZ A;  1VTL E;  4AUW A;  1ZME C;  1M1J C;  1QN9 A;  3B71 A;  1R5S A;  3MHV A;  3OCI A;  4WWI A;  1RQV A;  1E42 A;  5B5E E;  4KT0 J;  3IN6 A;  2Y0D A;  2JEE A;  4YPC A;  1FU1 A;  3A0B H;  1NHL A;  5TJH A;  3EQ2 A;  1LTI C;  1FJK A;  2AXT H;  1RF0 A;  1LNQ A;  5B66 H;  2O01 H;  2ZAE B;  1SQP D;  2B89 A;  2QSI A;  4JQ0 D;  2H8P D;  1Q81 Q;  2NVM A;  3L74 E;  3HD7 D;  4ASW A;  2BCC G;  3K5B A;  1KY6 A;  1NOH A;  3HTK B;  3A0H E;  3BCC G;  1P5G X;  4H13 D;  4Y99 C;  5AW5 B;  1EDL A;  1SQX J;  1YQL A;  2M8R A;  1IJD B;  1GW3 A;  1LWU B;  1QNB A;  3AEF C;  3EAY A;  1BSN A;  2WSF H;  1NTM D;  1UT7 A;  2FYU E;  3FXE A;  1Q9U A;  3HUS C;  3CXH I;  2FYU K;  1SQV J;  5KAF H;  2Y8Q A;  4ZMD A;  1VQ7 P;  1A02 J;  3L73 E;  1M3H A;  1JEK A;  1S3J A;  3O8Z A;  1BE3 G;  3RK2 B;  1KQL A;  1LTJ B;  3BRT B;  5KJ7 D;  4H0L B;  1NWQ A;  2NZ2 A;  2I8D A;  1SQB D;  3TGU G;  3H32 B;  1ZXG A;  4NPE A;  3RK3 C;  5GTH H;  1ZOY C;  3PP5 A;  2B87 A;  3CXH D;  3L4F A;  2M5A B;  2DW3 A;  3RL0 g;  4ZNC A;  4Q11 A;  2R44 A;  3CPW O;  3CW7 A;  1HJB A;  3TNU B;  3PLN A;  1G1I A;  1IFI A;  2V4H A;  1R4X A;  1EC5 A;  4KHX A;  1AQ5 A;  2IZ0 A;  1JMM A;  1FOS F;  3HUS A;  3T97 A;  1QTS A;  3CMA P;  2H43 A;  4JBZ A;  4B0A A;  1A02 F;  2Y8L A;  2NOB A;  4CFF A;  3V2R A;  2P7J A;  2ZVN B;  1VL2 A;  2WWW A;  1SFC D;  2D0C A;  1LT1 A;  1GU4 A;  1NAY A;  2G8Y A;  2HL8 A;  1JOC A;  3ABV C;  1EXI A;  1YJW P;  2M3E A;  4LLH A;  4JPZ B;  2FXO A;  3D70 A;  5DJT B;  1RY3 A;  3B5N D;  1FZB A;  1URQ C;  1VQ5 P;  4N6J A;  2Y0C A;  1N7S D;  3CXH H;  1NKN A;  2YXQ B;  3WU2 E;  1YIT P;  3HS8 A;  2J59 M;  2ZYD A;  1G1J A;  3L35 A;  3BAS A;  3I56 P;  1YBK A;  1VKL A;  2IFM A;  2L91 A;  1SQQ J;  1ZR2 A;  1AVO A;  5L8R J;  1V5S A;  3WUV A;  2XU6 A;  4IL6 E;  1MP9 A;  1ZP0 C;  1IFN A;  3MUD C;  1BCC E;  4WZS D;  3H25 A;  1SQB G;  2E74 D;  1SP4 A;  4U3F J;  1W2E A;  2V8Q A;  1OXZ A;  3LID A;  3L70 G;  2HG5 D;  1CI6 A;  4M3L A;  5KLV J;  3D7Q A;  3I5C A;  1NU1 D;  2JPI A;  2Z8U A;  3KZI E;  1PGQ A;  2W27 A;  3GF7 A;  1URQ A;  4TPS A;  3CME P;  3M9Q A;  3E1I A;  4MN4 C;  1H88 A;  5CBO A;  2C9N Y;  5CMZ A;  4EAL A;  5IYC P;  1GL2 C;  2Q9I A;  4PV1 C;  1CW5 A;  3USS A;  4KJM A;  2D2C C;  3O6Q A;  1QVF O;  1KQG B;  4CPG A;  1YJN P;  3MUD A;  3KHU A;  2PRR A;  2Z0F A;  3H1I G;  5AW0 B;  5CCH A;  3JCU H;  2BCC E;  1EZV I;  1X8Y A;  2E75 C;  2N1T C;  3H32 A;  3ENC A;  3BCC E;  4I7Z B;  1YQ3 C;  1QNA A;  1KV4 A;  1FDI A;  4WY4 B;  1DIZ A;  1IC2 A;  4A7P A;  4HYT B;  2M5A A;  1HBW A;  2PWW A;  3A0B E;  1LP1 B;  3KRM A;  1PP9 J;  2E76 D;  3G9R A;  2E43 A;  4H44 B;  1LWV A;  2AXT E;  5B66 E;  3BAT A;  1VPC A;  4I6M C;  1EZV D;  4PD4 I;  3H1L G;  2ZVO B;  1N8R Q;  5AVT B;  3W68 A;  1L4A C;  3AE9 C;  1QN8 A;  1PFI A;  4U7J A;  4RJT A;  2K88 A;  2YMY A;  3RK2 D;  4JF7 A;  1KYO D;  5AVX B;  1BGY D;  2A45 I;  1LTS C;  3GLM A;  3TGU E;  3AE2 C;  1KFI A;  4GDO A;  2HOD A;  2KNC A;  2N9Y B;  1S9K D;  5M1B A;  1QN5 A;  4PD4 D;  2HR3 A;  1GL2 D;  1NU1 G;  1KFQ A;  1QLE D;  5KKZ C;  2FGT A;  4PY5 A;  3L75 J;  2H5A X;  3KTU A;  1KIL D;  5KAF E;  3VMZ A;  1G2C B;  2OYH C;  1N3A A;  1PV3 A;  1L0N J;  2KS1 A;  1KB9 I;  3D6Z A;  2WMM A;  2E75 D;  2IFN A;  1AQT A;  4D7R A;  2HLO A;  3N7N A;  1SQP E;  1L0L D;  1L4A A;  3L74 G;  1PCM X;  1CDW A;  2P58 A;  3AEA C;  1M8O B;  5GTH E;  4MRQ A;  1SQX D;  1SQP K;  3FXD A;  3BVH A;  3AE3 C;  1KYO H;  1U57 A;  2BEQ D;  2W6J H;  1KB9 D;  5CJ4 A;  3CX5 D;  1H0T A;  4Z1M H;  1RE4 C;  4PD4 H;  2ZYG A;  2C9L Y;  3AE1 C;  3PMG A;  3M0D C;  1E79 H;  5KLI B;  3RL0 D;  3F89 A;  5KAI H;  2HZS A;  3KDP B;  1YTZ I;  4PJ0 H;  5AVZ B;  3L73 G;  4IL8 A;  2A45 H;  2KXP B;  2NPS A;  4I2L C;  1IZN B;  1DEB A;  1BGY G;  1FZC C;  5IYD P;  2EHB D;  1SQB E;  3M0A A;  2IV8 A;  3H1H J;  5F9C A;  1M1J B;  1SQB K;  1EUV A; 
#chains in the Genus database with same CATH homology
 1T6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...