2IV8A

Beta appendage in complex with b-arrestin peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT BETA-1
publication title Role of the Ap2 Beta-Appendage Hub in Recruiting Partners for Clathrin-Coated Vesicle Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis/regulator
total genus 59
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2iv8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2iv8A02
3H1ZA 3HS9A 1QTPA 4RODB 2MJ7A 3ASMA 1AISA 1QN3A 4ROEB 1PZDA 1QN5A 4WZSD 1CDWA 2D0AA 1NGMA 1QTSA 1QN4A 2VJ0A 1NH2A 1KY6A 2G30A 1VTOA 1NVPA 1JFIC 1VOKA 1W80A 1QNEA 1E42A 1KY7A 1KYFA 1D3UA 1KYUA 1TBAB 1TGHA 2D0CA 1RM1A 1QNBA 3VN5A 3EIKA 5IYDP 5IYBP 2IV9A 2D0BA 1TBPA 1MP9A 3OCIA 1QN9A 4PY5A 1VOLB 1QNCA 2Z8UA 5IYCP 1QN6A 1YTFA 3HS8A 1VTLE 1PCZA 4ROCB 3OC3C 1R4XA 4B0AA 1QN8A 1QNAA 1QN7A 2IV8A 1B9KA 1C9BB 1YTBA 1KYDA
chains in the Genus database with same CATH superfamily
2BIQA 3DO3A 3QC5X 2R0LH 4N0FA 4JO2L 1IEHA 2W65B 1D5MA 2DICA 2WIMA 1XGUB 2VR6A 2J8UB 3LXUX 2VR8A 1S78D 5HHOD 1SXCA 3TLRA 4OFIA 1KY7A 4PRBA 4KNTA 4PTTA 1XF3A 2OXHB 4Q56A 4B0MM 2GABA 1EFXA 4JPSA 2AMGA 2OULB 1BD2B 4ETYA 4F20A 3M7FB 3ENEA 4HIEA 4BA0A 3EFDH 1NOFA 1MIMH 3VXPA 1PLGH 3GMPA 5C0BA 3RX9A 1DIZA 4K3EL 3NCYP 2W5PA 3UPAA 2BP8A 2HTKC 3MO1A 1QN3A 2OQJA 1KT2B 3MAWA 5ES4B 4XVSH 1BVLA 3H9YA 4NWUL 1OCCB 3AG3B 3PGDB 4FQQA 3S3SA 3SZKC 3NA4A 2VMDA 1GR7A 4PY7A 4RX4A 4WFFE 2ITEA 1V55B 1DCLA 1G9NC 4GI8A 2VABB 3RL1B 2XSKA 4JW3A 3BJ91 1BA9A 3LB6D 4IIQA 4KY2A 3ZIMA 2W94A 2VLJB 1OY3B 4P3DA 3TT3H 5AW6B 4HOZA 5BPPA 3RVWD 1QG3A 1GIGL 4IOIB 5IV2B 1EHNA 4TNWF 5EZOH 2CPCA 2KMWA 2YR3A 2J8HA 2DM4A 4NRZB 4HG4J 1CQYA 4P8QA 3CZFB 1G9NH 1KUMA 2P5EB 1Z9NA 1UADC 4NKOA 1HEHC 5ICXA 4YBLB 2OMXA 3LTVA 2EZ0D 3HI6H 3HTLX 43CAB 2ADFH 3SDCC 5EBWA 3CU1A 4U6YA 4XPAH 5F7MC 2AV7B 5EDSA 1ZIAA 3II1A 1DVSA 5GZOD 3HE7A 1UM5H 2RH0A 5DFTA 1FL3B 3EBIA 5EU6A 4AV0A 4KAQH 4KQ4L 5KS9A 3BKQX 1YTBA 3H9SA 1QKZH 4KJQC 1QZ1A 1KJVA 1SEBB 1M05A 4J2QA 4BGDA 3B2MA 3CLEL 3ZL4H 4EN2A 6TAAA 3RVXD 1ZLWH 3KLSA 1GGTA 1VEMA 2MRYA 2W0FA 4NAJA 4UILH 5CCGE 1LK3L 1VZIA 2WINA 2P7TB 3PGFH 5IR1A 1JZ3A 2AEPL 2YA3A 2B4CL 4LPWA 3O2WH 3NH7L 3VW3H 1K8IB 3L2NA 2AEWA 2JMRA 1ZHKB 2VERN 4MXWH 5EBLB 4WW2C 5I1AA 4S1RH 1TQTA 3ZDZF 2ZFDB 2AFNA 4HJ0D 2OAAA 2B15A 1CI5A 3U7YH 2WKOF 3POHA 4OKVB 4NQUA 1G5GA 4Q6IA 2YHGA 2MHAB 4JRYB 1E6OH 5CS7A 4JKPH 2BZDA 3V4PH 1E5BA 2H26A 3DVNB 1MN4A 3ECWA 4PS3A 4HIJA 3V8OA 5I1HH 2ZXCA 1NCNA 3STBA 3LH2L 32C2B 4FLOA 5DZNA 4ZSOE 5C0FB 3ZO9A 2GHZA 4F1SA 2ZUQC 2P8PB 1TTAA 4KJPC 3X3FH 1V7MH 1QUNA 4H26A 3IRCA 3MV8E 1SLWA 4ZFOB 4Q9RH 5CJQL 3MV11 5TQ2L 1JPFA 1NZRA 5BOZG 4X4YA 1KXQA 1WE5A 2DW5A 3U9PH 1XD0A 5BMNA 2HP4A 1FG2B 3LXCA 4YHPA 3V4LA 1OGAA 1I7RB 3L3JA 3T4NA 2V5YA 4QYOB 4URKA 4KX9A 2WZAA 3DXAD 2X44D 3O6KH 3P69A 1IAOB 1H6TA 3VH8B 1FNSL 1MWAL 1UZGA 5B7EA 5JW5B 2ILLA 1NBZA 1SBSL 1TLKA 3IGLA 3DBXB 2O6FA 5ILTH 3C6SB 1CXIA 3F58H 3UDWC 2V9RA 2ZXWB 5J57B 4XX1E 5AL0A 4DKFL 4PRHE 4PJDB 1Q9OB 5C0CE 1O6VA 3VFOB 1DBAH 3L4XA 1H6EA 5GIRB 4IBSA 1ML0A 1AKJA 1HU0A 3PPEA 3PUUA 2AJ3B 1E4KA 5E8NB 1RZKL 1TU2B 3WHE0 2CGRL 3FQNA 1AE6H 3N85L 4P2RD 1T5KA 5I5JA 5IVOA 2PCFA 4IKIA 1UM6H 1HCZA 1T0PB 4FQPA 3NJIA 4M7JH 3VXMA 4EN3A 2OZ4A 3L4WA 4MXQC 3GXDA 3FS9A 2XZCL 1AGCB 1L7IL 3KL0A 3Q3GB 1MFVA 2Z35A 4H88H 4MWFB 1ITBB 4OLZH 2E7HA 3E9UA 4JFHD 2LGNA 3OSEA 4V1DB 3V0GA 3A67L 4EEEA 1KO9A 4JFTA 4XH2B 3QFGA 1JFQH 3AS1A 4XO5A 5IBTL 4G9FD 2WPGA 1SVZA 4YR6A 3SDAA 3SPIA 2YEQA 4Y5VA 1OPGH 5LG1A 4D9RE 1EEYB 2VIRB 5GRJL 4GQPH 1CDHA 1N0LA 4JY4B 5CAYB 3ULUF 1KYAA 5KVFH 3EGSB 2I85A 1DBKH 3I84A 2W9DH 2JB6B 4PIBA 4APXB 2VXQL 2CAKA 4RGNC 3VFPB 1P7QA 3MZGB 2C4FT 1N8ZA 4LGSB 4H13C 5CCKH 3VYOA 2BRRL 4XC1H 3OJDB 1DN2A 5AZEL 1L9PA 1INQB 3D34A 3FU7A 1E8XA 2NZIA 3BIAX 4Z7QB 2I27N 4CN4A 4UMGA 4NUPA 2BNQD 2D2CC 1YEIH 4HGKC 4Z76A 1SFHA 3P40A 4X4ZA 5CEYA 4LPYA 3H3PL 12E8H 2J71A 3DSNB 4FNUA 1HNGA 4WW2B 4YFLF 2XZAL 4TUJA 4M5ZL 3S3PA 5CF3A 1A3RH 1KG0B 1WDAA 3RTQA 1QNEA 3OR6A 5BUAA 3K1KC 5CILL 2IO5A 1MJJA 1A2YA 1OTSD 2DH2A 1FI8C 2YUWA 5CJ8A 4FABL 3BYYA 4GQ9H 5J13B 5KSBE 2HX9A 1X9UA 1AR1D 2Z31C 2ZUQB 1KBGH 2VDKH 3EJZD 1BV8A 1M3HA 4OCLC 2KI6A 2Y7LA 4LSSH 1MZYA 5TGBA 3K4AA 5K69A 2GBTA 2F8VA 3CCHB 1HKLL 1BVZA 3ARYA 5I5MA 5IEKB 4HKZB 4Z0BH 3NCCB 3I6KA 1S9YB 4JR9H 3DNKA 4GXVH 2R1YB 3WFHB 2WP3T 4M02A 4BKSC 1MCNA 3O9WB 2Q7AA 4N0YH 5I0WA 4UNTA 2VUYA 3LEXB 3ZTJG 1CFSB 3QUYB 1MF2L 5K59F 3VD9A 3C5XA 4TNEA 1UVQA 3G04B 1HIML 4XBMA 1Q0XL 2DOCA 5DF0A 1EANA 3B7YA 2WAQA 3WJLC 5TK2A 3MX0A 1I7ZA 1MUJA 3GBDA 4QNPE 1G6RH 4TVUA 1T03L 3MRFB 4X6FB 4UINL 2W38A 4JPVH 3IF1A 4U1MA 3OMNB 4L9DA 3IYLW 2WCGA 3RZCA 1HHHB 2C3HA 2LAGB 3MV9E 4PJGB 4Z9KB 4LVOC 1OTUC 1H3UA 2WNWA 1VEPA 3FT9A 1XZ0A 3ORJA 4U1IB 5T5FA 2D9QB 3IM1A 1LVEA 1G87A 2FO4A 1XF1A 4GRWE 2DLGA 3CH8A 1MCIA 3NJMA 4PP2A 5D7IE 1OHQA 5T1KA 1S5HA 1MFUA 1ZKAA 3K6FA 3NACH 4CBZA 1PNDA 2V2WA 2QRDA 2YRZA 3AABA 5DHDA 1KTBA 1K4CA 2L3BA 2MNWA 3V0WL 2XWRA 4APQD 2FATL 4JCMA 1R3KA 1G0YR 3VXUE 2IXQB 5D6DA 5F7LB 3B1UA 4GSDH 4S2SA 4LGRB 1CTNA 3KL3A 2VM9A 1MRDL 1RLWA 3BQUA 4PQXA 4A37A 4OV5B 2GC7C 2GY7B 3PS6A 4Y4KD 3ELQA 3RWGA 2XG5A 5DJ6A 35C8L 3BWSA 3ULXA 4FAAB 4AQAB 2P80D 4KVCL 1AMYA 2HSIA 4NPJA 3GRWA 1S7XA 4C83A 5T33H 2O5NA 1FWXA 4IDJL 1UA7A 1N3NB 1F3RB 4QXUL 5CGYC 4H8UA 2IC2A 3KZ8A 4WDIA 5EPMB 4GO9A 1M6UA 2XZZA 4N86A 2SEBB 4RGNB 1OSZA 4W6WB 4AGNA 3SHSA 5E8OB 5IW1B 2LTQC 1PG7L 4ELMF 5EO0A 3T6QC 3LY6A 4ALAL 3L54A 1YNTF 4GUCA 5E4IA 3TH2T 3WD5H 3PWPA 5AYUL 4UM9A 2WXMA 2APWA 1UCBL 4W9ZA 5GGRY 5K93A 3KR3H 4JM2F 3GMOB 1QSED 4ZQKB 5FW8A 1XIWA 5DUML 5BCAA 4XMPL 5IHLB 1A1OA 3C04A 1KBVA 5T1JA 3PWVB 4OTXH 2VDKB 1FNHA 1FE8H 5BRQA 1IX2A 2CIIB 4PJCB 4P5KB 1WFNA 1DVFD 3EXLA 3QR1A 3D48R 4EDWH 4MJIE 2MMXA 2XUWA 4M5TA 1ONQA 3PAUA 3FFOA 4IIQC 1J5DA 3PDOA 3NZSA 4PCSA 4DFHA 1IBYA 1JNLL 1T3FA 2Z31B 4LCYB 4PIRF 2Q9OA 3BEVB 3HRPA 5DMKA 1RL1A 2BX5A 4M1GH 3VFNB 2X2YA 5KYWA 2VH5H 4H7VA 2KDYA 4FG6D 4FMVA 4KXAA 4RWYH 4N8VA 2F53B 4B0MB 3NP3A 3TN0B 3RWDB 4BRVA 1KJ2A 1RZ8A 2NNXA 2G5RA 3E3QE 3UO1L 4AUUA 1G6RB 2ZCZA 3O2VH 1T1XB 2ESVA 2BSDA 1AY1L 4DQOH 5ADPH 4JHZA 5FCUL 2M2DA 3BWAA 4OCSL 4LCWA 3FO9A 4MNGA 5GISH 4WI6A 3CVIL 2YEZB 2A9MH 3OMZA 3HE7C 1J1OL 3N43F 1HL4A 1KZQA 4LARL 5EN2A 4ZFGH 3DPUA 1JYVA 2HMIC 4PJAB 1JF1A 1ZEAH 1T2QH 2X3CA 3GRBA 4KH9A 1OZUA 4KROD 4MAUL 3U7AA 5DHMC 2YA2A 3AROA 3VI4A 1FZOA 4ABQA 1E4WL 1G7QB 4UUJA 5A3ID 5LQBH 2CBPA 1HJBC 3AXIA 2NVMA 4HJIA 3LNEA 4E9XA 4RFOL 1UWXK 3HNVL 3QP3A 1S6NA 3DIFB 1A8ZA 1E7VA 5JHDA 1KELH 3F84A 3OPZL 1BF8A 2JTDA 3WTXA 1P6WA 1Z5HA 1EEZA 1W91A 4U49A 2NOYA 3CFCH 4YS4A 4JFYA 4Q6IC 1NWPA 3ULVC 4DERA 3T2OA 5C1MB 2AQTA 1SNRA 3MGAA 1Z5YD 2ICWJ 4LLDA 1GGYA 3JYCA 2PWEA 1DQML 2XVLA 2FHFA 1RP9A 3MLSL 3VXTB 4E9LA 3DRQB 3V4VL 3FCTA 4NUGL 3N1QC 3K46A 4QTHB 3LPGA 4XO8A 1EWHA 1E67A 3DX3A 5DDHA 2XN9E 3ULVH 5J1TC 1BW8A 1D5MB 1NGYA 1TYEB 3PJLA 2E0PA 1CS6A 2QVIA 4CDGC 1WIUA 2JKXA 3MACL 1EJ6A 3EYVA 3ZRCC 4NT6A 4KI5D 2VL5B 5EULV 2XQYA 1DVQA 4DPCX 5T3XD 5MEOA 2BDNL 3HMXL 2X09A 5B1KA 5EU5A 3K5SA 4P04A 4OLVH 2UYLA 4HIEB 5F0JB 3FB6A 3NRPA 3D52A 1C12A 1KYDA 4FG0A 4F8OA 2VCOA 4AY0A 2BP8B 1KN4H 3MO1B 2OQJB 2VN6A 4E9WA 4QRRD 2ADIA 1IEAB 3NCMA 1BVLB 4AMKH 5B38B 1HL9A 3EYOA 5AENA 3X1BA 4Y88A 3TBVA 3VFTA 2M26A 3X1EA 4XP5L 2CA3A 4EIGB 4XN7A 4ODHL 1YMHB 4EN3C 5KVDH 4LU5L 2YAEA 4OH2A 4WUUE 2W0PA 1UUNA 1E0OB 1AZRA 1BP3B 2DQTL 4JY6A 1YEFH 4UTAL 1Q9WA 1T04A 2LW3A 4K7PL 4GI9A 2OZ4H 3DVFA 5F9AC 2AAVA 4HWZA 2LAAA 3NIFF 4B60A 1PFCA 2Y1AA 3V5HB 3SDAC 4Y5VC 2CUMA 3I0XA 2X4TA 2JH2A 2BVOA 1M7DB 1IV8A 1B3IA 4HCGA 3P0GB 2B9BA 2WQSA 1C5BL 2AZUA 2A73A 5C3IA 1X5AA 4IBUA 3HE7B 1SXSA 1F02I 2IV8A 3VYNA 5EU6B 4YAQA 5KS9B 5B21A 2NOHA 3H9SB 4FLQA 1C08A 1M05B 1YNLH 1JHLH 2YMTA 4N2HA 4ZUVA 1DDHA 4ZRGA 4ZW6A 3MYJA 3BPLC 3DTUB 3N50A 5DEGA 4LLQA 3S3DB 3OB0K 4X9IA 1NGQH 4XNMA 2W0FB 3KPNA 5DTFB 3ESNA 2X6MA 4JFFA 4P2OD 4Z77A 4CFFA 3F62A 2WC7A 2K7QA 3GNMH 5H4YA 2ZONA 3RPBA 1O7SA 5B4MC 3AQXA 4XE0A 1HCYA 2NLJA 5I1AB 1CYXA 4UTCA 3P3UA 5D2NE 2AEIT 3Q9PA 3MOAH 3QHFH 3QQXA 2QADD 1U8QA 3RTQC 3EYQC 5ITBH 3DECA 4NN7C 5IM7B 4XP1H 4LVHC 1BOGB 4KXZH 5FYLD 4FFYA 1M1XA 4BK4A 3TU6A 1H5BA 4HIJB 2ICWI 2R8SL 3FCSA 3H4FA 3GM8A 4U6HA 4MD4A 3E1ZA 4XMVA 1UHVA 3U46A 5ABDE 5GRZA 2J3SA 4H26B 3UEZA 1Q0YH 4RSYA 1ERNA 1NMBL 4MD0B 4PY8I 1JPFB 1UGNA 3HC0B 3LKRA 4X7EC 4XZ4A 5DJAB 4ZUTA 4JUSA 2H1XA 4UDUA 1E4XH 4LGPB 1FGVH 3OCIA 4QHMA 1OCRB 4MMXA 1XDTT 1UOVA 2EADA 3QDJD 4WZSD 2IH1B 3MV7E 2K9FB 2JE8A 4YHKH 1VDGA 4P5TA 1XH3B 2P45B 2F7QA 1DCEA 5HHOA 1NBZB 4PI2A 2Y24A 4J6RH 4N3UA 2IDFA 2RACA 4N5ED 4HULB 3J27A 4LLVA 3VAEA 3MJ6A 2NOIA 2IV9A 4PJ5E 4Q9CA 1VJSA 1WWBX 4LCIL 2R51A 1TETH 3CBKB 1AKJB 2A6IB 5DI8B 4ELDA 5I28A 4Y1TA 4QHLB 3FU3A 4N2KA 3RZCC 3U2SA 4WXAA 1RKRA 2VLLB 3FQNB 4QJ3B 2C7UA 4ODSL 2NCEA 4X7TB 4ZK8A 3WSQL 3QEGH 5EORH 3SJVA 1OM3L 5CHNA 5D70H 2CUIA 4EN3B 2Y69B 1HDMA 1ZV9A 3VXMB 3L08A 4JFSA 5EEVA 3QJHA 4YDIL 2E46A 4AENA 1DBJH 3DLQR 1HT6A 1LO0H 3T0BA 3JUZA 4HW6A 5L6YH 2XFGB 1W0WA 2QQKL 1TBPA 5T5FH 5L2KA 1TZIA 4P9HL 2BO0A 2CDGB 5D6DC 4QRPA 5C0JB 2ATKA 2EYTA 2G3ZA 2JJSA 4DCQB 3QFJB 1W6WA 3MDJA 4W9HC 1A7PH 3BQUC 1UB6A 5I1LB 1T6AA 4PJXF 4YGAB 4LHUD 5IHHA 4XX1G 1XCXA 4FQIH 4MS8C 4Y5VB 3SDAB 1YMME 1N0LB 4NKDA 4F9PA 3FCGA 2ROYA 2XKSA 5GS2H 5HYSG 1P84K 4JLRB 5DZJA 5EV7A 5I0DA 3TT3L 1D7CA 3FOLB 4XP6L 5D7SL 3CX5J 2EHBD 3LNIA 3ZE0F 1P7QB 1OHZA 1FGNL 4KUZL 3MKKA 3DVIA 4IRSA 1GW6A 5C08D 5KJRL 3BPLB 3GRWH 1MW2A 2IBGA 3GXNA 1HQ4A 3AGWA 3T09A 5GZOA 1OOAA 3GPEA 3PCYA 3P73A 4Z76B 5IF0B 1ID5I 1U4FA 1XIWC 4R97C 5CEYB 5CMAB 4RGOH 3BGFC 5B7FA 2RGSA 4WHYG 1BFVL 4TSAL 3CFIC 3RTQB 4ZTOH 1UM5L 2XRAL 5AB9A 4JN2B 4KAQL 3K6NA 3FSAA 4NN7B 3UXFA 4BWTA 1MJJB 3ILQD 3CZSA 1A2YB 4G1MB 3S34L 4GQRA 2B0SL 1AOHA 1X7TA 4G1EA 1NGZA 5IJVB 4GG6F 4X7FC 1JZFA 5FECA 1NA8A 4JG0L 4NUJB 1KCSL 4TQPA 4PCTA 3IXTA 1KCBA 3WJJA 3QEQA 4G3YH 1FZMA 4I5BA 4JFPA 5TGBB 4PP1C 4A39A 3R8QA 2IWGA 1JFIC 2MH4A 2QR0A 4G7RB 5ABAA 4E2OA 1ZGLA 1R47A 1NEZG 1KPVB 5ID0A 2QGCA 3ME0A 4WFGD 1PG7X 5GGQL 4JFZL 5IQ9A 5AVWB 1PEZA 2BSED 3C9NA 1FORL 5C07E 1EAOA 2X4RA 4LOFA 1UVQB 4X9GA 5BZDA 3BFOA 4G8AC 3WU1A 1OP5K 3GUFA 2IGTA 3MRGA 4KGLA 3ATEA 4FFTA 1KJ2H 3HUJA 3X3FL 3KS0H 1QRNE 4PD4J 3MCLL 5IB2B 4YLQT 43C9A 1CD8A 5DJDB 3L3HA 2X1WL 4E41D 2B5IC 3IF1B 4U1MB 1XXDC 3RWCA 4WI0A 2EDKA 5I6MA 1Z0NA 3KM1A 3UOAB 4AC4A 3CBRA 2LV4A 3NK4A 5I30L 3O4OC 1NWOA 3HE6A 1QABA 4X7SH 1GZHA 1YN7A 2FO4B 3L17A 4PP2B 1S5HB 2WSPA 1GCYA 1RK7A 4NZRH 2V2WB 5I1GH 2WQVA 1A9BA 1JK8B 3BP4A 1PLBA 2FK9A 4UNVA 2WJ5A 1B0GA 1U8CA 1YEWA 4ZT1A 2Q8BH 3CJJA 4XODA 4NFDA 4H20L 3ZZSA 4P2RA 1IGMH 4UZSA 1F0LA 2PPCA 2VXSH 5CLYA 2DIJA 4S2SB 3SYAA 1MEXH 2ADYA 5LDSA 3BQUB 2CD0A 2HPOA 4F2EA 4G8FA 4KKRA 1DN0B 4WY7L 5KW9H 3RWGB 5JW4N 2I32A 2XG5B 3CHXA 5DJ6B 5E70A 3U36A 5T3ZE 1TEYA 2WYZA 5B1AB 2YC1B 4ODVH 1VFBA 4XOBA 5B1JA 4C83B 3N3EA 3P3RA 1HK6A 1T7YA 2ROXA 3F05A 4I89A 4NSKA 5HHQA 3C08L 4UM8B 3X3GL 3LMJL 3JWDL 3MJ8A 4WDIB 5HDOA 3VFGL 4DPAX 1JGUL 1IFRA 2WWNA 5EO0B 5SWSD 1E6JL 4DGIL 3IDJA 5DJ0A 1Q8MA 5DT1H 3EJSA 2JCCE 3Q8FA 4QJ4B 1JFQL 3PWPB 1LWYA 4NAQA 4WK2B 3U6RB 3QXUA 3RUGE 3UGXA 1E27B 1M71A 4NKQB 1ZLEA 3LKSA 1A1OB 1QSZA 3OLGA 5TF1H 3ZOAA 4FJZA 2FWLB 2EDLA 5D55A 1GS8A 2YD6A 1U8HA 2C34A 3BAKA 2GJZB 4J7RA 1FDLL 2UVFA 4UNIA 2G60H 3D85B 3ETBJ 1V54B 5IB3A 4LP4A 2DLTA 3O81A 4U1KA 1BGXL 5FDWA 3KW8A 1B0RA 1A7RH 4RAHA 1T3FB 2ZX6A 1JV5A 2AQNA 3F6JA 3GS0A 1HILB 1QSFA 5CZKA 4N8VB 2WSDA 2PYED 2FKMX 2BVTA 1YEKH 4OI7A 1KJ2B 1RZ8B 4UOW0 1BQKA 2AXGA 2PP8A 3LHPH 4UOZA 5DVNA 4I18B 3CDYA 5CZVL 4TLTA 1AZBA 2GSMB 2X0WA 4LCWB 3FO9B 4MNGB 4OJDH 5CEZL 1F90L 3PP3K 3V52H 2NR6D 1TNMA 3N40F 3BCDA 4EALA 1JF1B 2X1OA 4PRPB 5IVXF 1YUHB 4FCAA 5HDLA 4QY8B 1YNKH 2ZZUT 1FFPA 3VI4B 3LZOA 3FRUB 4X98A 2ED8A 4UUJB 5I18H 3D87B 1J0KA 1IGFH 4OCYL 2BS9A 3GJEA 5SV3A 3QZLA 5JHDB 1E7UA 3SE9H 4K23H 1KCKA 3FUIA 1EEZB 1NLBL 2IDCA 1UOLA 3EJPA 2OTWA 3HOGA 5IROA 1RI8A 4A2HA 4OGYL 1IEBB 2Z65C 2XXMB 3CSTA 4KH2A 4POZC 1LO3H 5JIPA 3RX8A 1H5BC 3LKPB 3ZKND 5TE4H 2XDHA 3FCTB 3X13A 1AHMA 5D72H 2CALA 3INUH 1GA2A 3F5WA 4UQ2A 3T0XA 2VJ8A 4XN5A 4PSRA 1JNJA 1T22A 3NP4A 1NGYB 2YPLE 3Q2NA 2H8PB 3OH6A 4FFYH 3H3KA 2ARWA 2VRKA 3FC8A 4MJJA 4KJYB 4M6OL 5DO2D 1T2JA 1OQXA 3QZOA 4N2IA 3UTQA 2B59A 4MMXC 3CMOL 1AO7E 4Y4KA 1JTOA 2FDBP 4KPHH 3Q1SH 2HT4C 1P7BA 5EU5B 4D0DA 3ATDA 3SYPA 4KTGA 1NFKA 3OC3C 2P80A 3FB6B 4QO1B 2X4QA 5ANMB 4P5TC 3FAXA 2HFGH 5AVYB 2GBAA 3KCPA 4MCNA 1ITCA 1ID2A 3JWNC 4IMLA 5ENWB 1ESOA 1OTTD 4IM8A 4GYBA 2VAAA 2ATAA 4KFZC 25C8L 1DO6A 3EFOB 1X4YA 2ADIB 5AALA 2FSEA 1ZPUA 2ZCKL 2WUCL 2Y2YA 3K2UH 5IQMA 1MHPH 3VFTB 4BA8A 1ZJAA 5BMFH 1DSFH 4BEIA 3UJIH 2E8YA 2O3OA 3MLZL 1EK3A 4YE4L 3VSUA 4PYGA 4XTRC 4ZYKA 1A7QH 3IJ7A 1HZHL 4L1LA 1IUZA 2MCPL 3ZHFA 1GJWA 2J6EL 1EDHA 4WEMB 1DLHB 4NDMA 3WEOA 1FRGH 1S9VA 4WFEE 4PPTA 1AQKH 4JY6B 5E00A 4D9QE 4NKIH 4YPJA 4R4BA 2PPAA 3ZSTA 4NO5A 1Q9WB 4ZMZA 1T04B 5DZPA 4YDKL 4L2LA 4NZUH 1DVFA 1FNGB 1E5YA 1VAHA 2JJSC 2X4PB 1U8NA 3RL2A 2A7BA 1WZAA 4LAQH 1R24A 1SXAA 2BIIA 3RLSA 5I2IA 1MLCA 1GHFH 1MFCL 5E8EB 3F6IA 1DSWA 4O2CA 3TBYA 1MPGA 1YQLA 1E40A 3UZQA 3PYCA 3FSVA 4F9PC 3NEEA 2WOBA 3NCBB 4NZFA 4C4KO 3EZ8A 4GI6A 4GINA 3D9AH 2OJZH 3BPOC 1WBZA 4YAQB 1JNNH 2EXWC 3RY4A 5E9DE 1C08B 3QXTA 5FLVA 3KPLA 1FV1A 3VXRE 3MKGA 2HVJB 4PJBB 2HLFD 4ZUVB 2HJKA 4IRSC 3MYJB 4Q6YA 2ETWA 5DEGB 2D4FA 4LLQB 1IRAY 3SDXE 4G6FB 1TJXA 2H7WA 2NX5E 5ETUB 2X6UA 5GZOC 3KPNB 2AJYL 3C87A 3L2MA 4OT1L 4PVMA 5EIIB 1DJZA 2YRLA 1KLFB 1MCFA 1IAII 1WD8A 5F93C 4C47A 5BW7A 1DLFH 1IQDA 1U8QB 3V10A 1WTGT 3MRMB 5LGJA 4E5XA 1JGDA 3QWRA 3RVXC 5EUOF 5LXGL 2ZUXA 5C97A 4CADA 3WIAA 3BLKA 1JBJA 1WCBB 1XH0A 3HR6A 3KDPB 3ENCA 1MCOH 5KSAD 3T0EB 4RFEA 3LIZA 1M1XB 1H5BB 4FN0A 2F0CA 3FCSB 1YAZA 4QOKD 3H85A 4HJ0C 4U6HB 1OP3H 4EPSA 2XFXA 4MD4B 2R0KH 3C12A 3WJJC 2EO7A 4KBPA 1RJYA 3MLUH 2YD7A 3FH5A 4JB9L 3H4HA 3FRPA 4NZTL 4FNLL 5KVEH 4ZUTB 1A6AB 2D3LA 3HG2A 4PGDA 1LM8V 3ARTA 1S7VA 3R7QA 4XMZA 4UT9L 3KDMB 4AJYV 4MMXB 3TEXA 2BJMH 4YOKA 2WTRB 1OE1A 4I3RH 2E86A 4HSQA 3FT3A 4YZFE 1KC5H 2ADGB 4UQAA 2IDTA 5FUOL 3D39A 4B53A 5HHOB 4P05A 3SE8H 4PBWD 4ENZA 1S7WB 1KFAL 3P77B 4IMKA 3TH4T 1CVRA 4X6CA 3ROLA 3JTSA 3SQOL 3HG1E 4KDVA 3IDIA 2FT8A 3W0WA 2WO3B 2C9UA 4TLSA 1F58H 4AYFB 3L81A 4WENB 4IS6B 1OAKH 5FUZH 4B7LA 3DROB 5CZXC 2D2OA 3HAEG 4LSTL 3EF7A 1PG7W 2P24A 3HE6C 4PV8A 2C7UB 3D4GA 4P4RA 1GZHC 3QXWA 2QEJA 4NBZB 4OJYA 5FKPB 4Z7VA 4KDWA 1FBIH 1BXUA 1FLTX 1DDTA 5C6TL 5E24E 4ODTH 1NIAA 4QRRA 2FX7H 5C71A 1G0XA 3QZBA 3P4NB 5GGSB 3MV8D 3G7TA 4EDXB 1UG9A 3NZHH 5AVXB 4P4KD 1IC5L 5D6CA 2K4WA 2ATKB 4GS7C 3KVDD 3TDHA 3T8XB 4RLDA 3HMWH 2P5WD 3G08B 2GIMA 1QEWB 4O51A 4BFJA 3K6SA 2X28A 5J9PA 1U0QA 1Z2KA 1MW1A 4NKDB 4NXSA 1ZDQA 3D69A 4EI5A 1OGSA 3PRZA 5B1JC 1R75A 4X0KA 3PGCB 4XNYL 3DOSB 3BPOB 5C0CD 1J8HD 3M86A 1UYWL 1XCTB 4GFTB 4JM4L 3MMEB 1OD9A 4OQ1A 1MRFL 3ZX1A 5I1KH 3ZJAA 5JOFA 5IW6A 4RAVA 5LGHL 4TNVF 5I6KA 3BZ4B 3SQBB 2ZXDA 2O5ZL 4NNYB 3GXMA 1JJUA 1HQ4B 5TE7H 3AWEA 1PX3A 3HI5H 5D1XE 2DQCL 4O58H 2ITCB 2MPAH 3MROA 3P73B 5F96H 5FLUA 3BQVA 4E0RA 3I02B 4MQTB 1I8IB 3VQLA 1PKQA 1HNYA 2VQ1A 4YHML 1NFDF 4KY1L 4UCFA 5DZVA 3KVQA 4I1PA 2R59A 4MGXA 1JUFB 3PJNA 2E7BA 2GTZB 4P2OA 4WI3A 5D71L 1U3HD 3ZDXE 5A1AA 4IRZL 2W1NA 5I1CH 3LJ3A 2WLYA 1NGZB 1QYGL 2KPWA 1KEML 4GEIA 4OF8A 5FECB 1M9SA 1HXYA 1Z9SA 1HH9A 2JQMA 5F88A 3BJLA 3IXTB 4HHAB 2EDRA 2FEDC 4MZ3A 3ZDYE 1FZMB 4I5BB 4JFPB 3IS1X 2UV3A 3QNZA 5AVTB 5SV4A 4M00A 2QR0B 3FONA 1PJ9A 5K33A 1OT1A 4DP8X 1W8EA 3ME0B 1TEGA 1WAAA 5ITBL 1H8NA 3C9NB 5EZPA 4YHIA 1N6VA 2XY2A 3HB3C 3EJZC 5E4AA 1JYWA 5HGDA 2X4RB 2BERA 3QYCA 3UG3A 5BZDB 4HAFA 2CA4A 1NSNL 3B2VL 2CMRH 3GXFA 3BVDB 4PJEE 1A7NH 4XWOD 4Z95H 1U9KA 3LRKA 4K94C 2Q86A 2R69L 2V6HA 3HUJB 2A1WH 5SX4H 3BP5B 3L3HB 2GFBB 4DP5X 3DXAB 2LHAA 3RWCB 2CR3A 3AXLB 3PAYA 2CLZA 3L3OA 4QAWA 1TNNA 1FYHB 4MRCA 1JZ2A 2Z9TA 2BS8A 1WEJH 1HHIB 3ALPA 5DS8A 3TV3L 3ZVVA 4K94H 1EBMA 5HP5A 4YJZL 3D05A 4XXCA 3WXVH 1JV2B 4JM2D 5AW3B 4FJYA 2GJ6E 2N4IA 1RIHH 3FFCE 4LEOA 3BP4B 3FXIC 4MFHA 3FYIB 3W82A 5DVLA 5I73C 4NM8H 1U8CB 5IROC 4XT1C 2WM0A 2QKSA 4GY4A 4P2RB 3OLIA 4OIBA 1KIQA 5DXWA 1AQDB 4BSVB 1D5ZB 3U25A 4POYA 3NN8A 2RQEA 3EHBD 3QJSB 4L4TE 3PWNA 3ES6A 1M2VA 4G8FB 2ZCHH 4JQIL 5DMIL 3QGVA 4ERSH 2DWYA 4F2ME 4JRWA 4NQEE 3IS0X 1YUKB 4F15C 3KPRE 4JY5H 1BXVA 2VR5A 5F97E 3H9HA 3NGBC 4NSKB 1Z9MA 1C7SA 3BAYA 2ODHA 2L7JA 3GI8L 3MJ8B 4LHUA 3SGEI 4G42B 4G9FB 4Y4KC 4D9LL 1KF9B 2GSGA 4HZ1A 3O3DA 3TBCA 1GH7A 1NAKH 3E9TA 3VGGA 2D7OA 3KPMB 3OG4B 4NC1C 2AMUA 5IB1A 2PTUA 2YJLA 2YAHA 4M7KH 5JXED 1JVKA 4JFVA 4RMWA 3P30H 3AU1B 1M7XA 4AQ1A 4KHTH 4M61A 4NBXB 3AM8A 3TYGH 3NAAH 3LKSB 5BRPA 1M7IB 5C08A 4PJDF 5DC2A 3LPFA 3C8KB 3BLBA 1ZT4B 1HWGB 3EKCA 2F54D 3VXUD 4GMSL 1JXJA 4AGMA 1OE3A 1ZGLP 2YUVA 1A9VA 5EO1A 2VLRD 2ZJSL 2BNQB 5FB8B 1NL0L 4JANA 2N59A 2DMCA 5A2CA 5IB3B 1G7JA 5HHNB 4U1KB 2ZOUA 1P84J 5FDWB 1KTDA 4U6VL 2K78A 1EXUA 4W4NA 4GEJA 1FL5A 1E5ZA 3ULUE 3LZFH 3MLVL 5DQDL 5DD1H 1DVFC 2FR4A 4KMQA 3MRHA 2IOMA 1MFEH 2MQ3A 4JZJA 1BLIA 4PJIB 5GJTL 4OZIA 3QNFA 3EOAA 3DA0A 2CBQA 3IFPA 5EU7C 5I17B 2UWEA 2BIHA 3IH7A 3K4ZA 2TRYA 3MCKA 5HI5C 3ZQWA 1CGWA 4Z7UA 1P4BH 2WVTA 1PLAA 4UBDD 5JORA 2YSTA 4ZD3H 1KJMA 2YWYA 3DGGA 1CDUA 5BRZE 1MVYA 1SDDA 4YEFA 5E4EC 1A65A 1J0YA 4Y4FD 2IFGA 4X98B 4EOWL 4NEHB 3ZYJA 2Y06H 5MEND 2X4SA 4BJLA 3G5VA 3GJEB 4MZIA 4DF9A 3IRZA 1H3PH 3CHPA 3IAPA 1U3YA 1QI5A 1UH4A 2C1OA 1CN4A 1NCCH 4PRAB 3DKHA 3PFQA 1EEUA 2G0LA 4Z7QF 1EGJL 1LMKA 3HBPA 4E41A 1I85A 5BW7C 1W0YT 5AB0A 3NJHA 1MXDA 3MRLB 2QVTA 4R83A 4WW2F 2WNKA 5I73B 3NFPB 2OTWB 1O0VA 4Z7IA 3C60D 1GMIA 2CHNA 5TFSL 3OKMA 3L4UA 3WNLA 2CO6B 4UQ3A 3VE0A 3VWJA 4WJ5A 5B39B 1J1XL 4RDQF 1ZLSL 3T1FA 2OK0L 3SKMA 3X13B 4C59B 4APQB 5J0BA 3F5WB 4XNDA 2JFCA 2B20A 3RVTC 4F15B 3QAZB 3PWUA 2NY4C 3U4BL 2NYYC 3LIZH 5IUCA 1YRKA 1NLDL 1BQUA 4Y9BA 1LO5B 2FL5A 5T1LD 4PWGA 4DKDC 1GW0A 1KCUH 2Q8BL 3UTQB 4N22A 4Y4KB 4KZDL 2ZX8A 4HMDA 2FB4H 2UXVA 3FQ4A 2VXSL 2ZKHH 4Z7AA 4AQEA 4C56E 2RCSH 3B56A 4LASL 4TYUA 5IMOA 2X4QB 4PS7A 4YWGH 1TUOA 3E6HA 1NAML 5DEZA 3RI5F 2NQ3A 2MQ0A 4IMKC 3KCPB 2CPUA 1H0DA 3QXDA 4IMLB 4KI5C 3RGHA 3D51A 2B9AA 1R33A 1S8DB 3FF8A 3LQAL 4OR1A 2DYPA 3OHMB 3BAEH 2FSEB 4OZGF 4KV5E 4LL1A 3H9ZA 3M7OA 4R7VA 3ZKQD 4HLZG 2G9HA 4NN5C 2QELA 4XPFL 3ZRFC 3N55A 3GS4A 1U8KA 2H47C 2YD3A 4O2FB 4PJGF 1QSEB 1SN5A 2B08A 4LP5A 4JFEA 3VCLA 1RZGA 5T3XH 1Q9UA 1EZUA 4Y7MA 1OOWA 3H42L 3MFFA 5A6MA 5E00B 3CN4A 4MS6A 3IMBA 2XPYA 3VMPA 1OAYL 2XTJD 4GFXA 4N8CH 4D8PA 3WMQA 1BJ1H 1DVFB 4EF3A 3DTXA 4GIOA 1RIUL 2NQDA 3D30A 4WSKA 1Q9LA 1WBYB 2HN7A 1U8NB 2OSWA 4OFVA 3RL2B 3C5JA 4CGUB 1JDAA 5F7DB 2ZOKA 4OCNC 4O2CB 3GS7A 2BSRA 4PGCB 5DFWH 3TBYB 4EQ3A 2BMKA 2IMMA 3S37L 3UZQB 1W2KT 3GO1L 2DQEH 4LK4A 4XAKE 3TWCH 4EI5C 2OMUA 3EYFB 3GIVA 4RIRA 2ZUWA 1WBZB 3LVTA 3BPNC 4QRQB 5E4OA 1FLRH 4GW1A 4KK5C 3KPLB 3O0LA 4E9QA 2HG5B 3OHXA 2EUXA 1BM3H 2HJKB 1BREA 1JHKH 5E4EB 4A55A 4ODUA 5IJKA 3HG0A 4YSOA 4G5ZL 3U4EA 3V6ZA 3ZKSD 1KJ3L 3U0PA 2NR6A 5D1QD 1ZLUH 4DP7X 3VXSD 2AK4A 1IM3D 5DURD 1RV6X 1JPGA 5ITFA 1SM3L 4WUUD 2Y7OA 4ZW3A 4TSBH 2I26N 1IAKA 1OE2A 1RHFA 1IQDB 3JT2A 3NPSC 2EYRA 4FXTA 4KROB 4A6YH 3BIBX 4FG2A 3RTLA 4V33A 1SXZA 3TIDA 3VDAA 3UJTH 3B37A 3DV6A 4ZTPH 3FFDA 4BFBD 4P2OC 3HS0A 3LEYL 4HIXH 5IBLC 1J5HA 2WHVA 1JP5A 5EC1A 1RZFL 1I9JL 1TSRA 4LOVA 2AHIA 1O9WA 1U8PA 4GJTB 2QADC 1QAWA 2XFXB 2DF3A 5F9JB 1EUTA 5ESQA 1CL7H 5DUBA 3V9FA 5IQNA 1ND0A 2F18A 1SEQL 3TESA 3SBQA 2B1OA 4UTBA 1X5FA 3OKYA 5J6HA 4FXGA 5DJYA 1GPOH 3DMMA 1L0QA 2XWBA 1NCIA 3F7LA 1KCWA 1WF5A 2VO5A 3DIVA 3QORA 1G9ML 1AG0A 4P5RA 3BO8A 1FN4A 4G6MH 2XZQH 1B4TA 4P07A 2F61A 4ELKA 3FT3B 1N67A 1G1KA 1HI6B 3D12B 3D39B 1BDYA 3DPBB 4R7LA 5FYLH 3ZXAC 3MYZA 3O3UN 1ZDSA 4B3EA 1KPRA 4KRLB 2NUTA 4LSUH 1BLNA 3JTSB 2A9BA 2WBXA 2UXTA 5I1IH 3BRDA 4C8XA 2HRLA 1NMAH 3BN9D 3LSOA 3RDTD 4A38A 2YMXH 3L3OC 4QYAA 3K0WA 3LS4L 1BCIA 4L48A 5F9WC 5C9JB 2J55A 4N1CA 2JJWA 4NN5B 1IM9D 3GBNL 3WNJA 4P4RB 7FABL 9PCYA 3FU6A 4XXCC 4OCWL 1BBDL 1Q9KB 4CVWA 4QRRB 1UJ3A 3TCXA 4FQXD 4DO6A 4HDIA 5DSCB 4NO3A 2C4XA 1UZ6F 2QZQA 3BVTA 3JWOL 5GS0D 2AJUL 3EAKA 3RNKA 4E9YA 3OTTA 1LGVA 4XCFH 2GAZB 2WXOA 3SKOB 3TM6A 3G6DL 3W9DA 5HYJE 3D0LA 3FN3A 3QHZH 4IRJD 4DN3H 4Z7OF 1D5RA 3PUCA 1MHPL 2FHCA 3F7VB 5K1NA 4DQAA 2X3AA 4LRNL 4JPKH 4EIBA 2WZ0A 4PVLA 4BCXA 4B97A 2CHWA 3CDFA 4U1GC 4I8OA 2CM5A 1YG9A 3AC0A 3D69B 1QBLL 4LLMA 2Y8LA 1F1AA 1PMYA 4WI7A 2EH8H 4X0KB 3BPNB 2XWXA 3FUNA 5TQ0L 3RJQB 1IAIL 1EJOH 3AJ7A 1MJUH 4NZUL 4RAVB 4A6YB 5IW6B 3RSMA 5C7ZA 1USQA 2AABL 2CO2A 1YPZE 3APNA 2Q3ZA 1R3IL 2RD0A 3HHSA 1DJYA 1JZGA 2L8AA 1LP9E 1EERB 3VXQA 2OM5A 4WCYH 3QQ9D 4AQ1C 3GKWL 3AM8C 3FUEA 1DR9A 2ZKWA 1BQLH 2P28B 3VSVA 3ZE1E 1J5OH 4M6ML 1SGKA 4HH8A 2Z7YA 1ZOXA 3C6LD 3DYPA 3QQNA 5FXCH 2XA8H 1FO0L 4JRXE 1PEWA 4JREB 1VADA 4E42A 1MPAH 5GGVL 4W6XB 4P2OB 2B1HL 1D2PA 2Q87A 1UOWA 2BNRE 4ZS6D 5ACZB 1YN6A 4D3CL 3CXDH 1RVFL 3LNGA 1Z9SB 2QADB 2DKSA 1QFOA 4Y9GA 5F88B 4QIRA 1AVAA 1F97A 3CBJB 1SOXA 1JK9A 3GPSA 3BVVA 1JXKA 4DWHA 2GITA 4AT6A 5JA9A 5KTEL 8FABA 3QNZB 4PJ9D 1EBPA 1U92A 1RK0B 4F27A 4TN9A 3FONB 4JZJC 3SOTA 3E6FA 1WAEA 3LIUA 2GEQA 4QOKA 2QLVA 2FD6H 1L5GA 1NKGA 2J43A 5HI3D 2D3JA 4W93A 2UZIL 4YHIB 3NSFA 2EKJA 5HGDB 2DQDH 3MN8A 3P9MA 2EE6A 2WAHA 4JDZA 3ESVF 1YECH 5FYJE 1KXVA 2ZPKL 5E1HB 5C0GB 4NN6C 5JIKA 1FL6A 4BZ1H 1DQDH 3CSPA 3D4CA 4U0QB 1INEH 4OLYH 2Q86B 3CX2A 1AR2A 5KS9F 4KMLB 3P0VL 4XCCL 3C5ZD 2WWKT 4NQQA 3VH8G 4WU5B 2CLZB 3L3OB 1X5YA 1YYLL 3RJDA 3ZPDA 4Z3FA 4OCRH 1QUPA 4KFMA 2KLRA 4EBQH 2G2PA 5DS8B 2A83A 3WIHA 1KNOB 2I7OA 2NZ9C 4X99A 1I85C 2N56A 4LMQE 4FQ2H 4LEOB 1SQ2N 4M9OA 4JL2A 1UWEL 4S0SD 5HDBE 4YUEH 3RWFA 3ILPA 2D0AA 4U31A 3E1F1 4L3CB 1GZPA 3TBBA 1CGVA 4JHBA 3ULVF 2WCSA 3ZTJH 1KIQB 2VLKE 3VWJC 3MBEA 5D9SA 4ZS7H 5EOTA 4ZSOA 3NN8B 3VGBA 1PIGA 1TZAA 3QRFM 4X9HA 2C9AA 3PWNB 3ES6B 3RNQB 4LCCA 4A7UA 3MV8A 1U8IA 2WCPA 2C3VA 4FTVE 3L4YA 2XCMC 3HEIB 1FP5A 4P4KA 4NI3A 5ICYB 4ODTL 1TQUA 3HZKB 4MASA 1QRND 1KV7A 3IJHA 4LHUB 1XXFC 3OXSA 5TPWL 1Y0LA 1BJ8A 3QZWG 4W9LC 4LEXL 3O3DB 3M1BA 5FAAA 2E7CA 1CICA 5GRXG 4NUQA 1THAA 5IB1B 4OGXL 4U1SB 5AZUA 4Y5YB 1HESA 3CW7A 5C0CA 1WGOA 1J8HA 4XNUH 3Q05A 4AQ1B 4UI2A 1YQMA 5EOCH 5H35A 4N2EA 4Q0XH 5C08B 3HC2A 3RAJL 1RD6A 1Y6NR 3KCWA 1XWVA 3AACA 4RODB 4JEGB 5D7LD 5EO1B 3D0VA 3VD1A 4K9JA 5DJ8A 1DFBL 3QG7L 4JANB 1B4JH 3OC8A 5B1BB 3L3DB 1G7JB 3UCRA 2IPTL 4BWWA 1JD9A 4C4BA 4ZDHB 2W91A 5CJXA 1D5IH 1FL5B 2MPAL 4RDQG 3V0VA 1KN2L 5F96L 3DYMA 4C7PA 4M7LL 3EYUL 3O11A 2OYLA 3NIGB 2IFFL 1AGDA 4XVJL 3KWXA 4OZIB 1EAPA 3KL5A 5F9OL 1I1AA 2ZX9A 5E2TH 4I9WE 2EC9U 5BV7C 4M6NH 1CDGA 4QRTA 1YA5A 2UWEB 3P2BA 4FA6A 4RMBA 1SF5A 4YSSA 5FYKH 4N6RA 4BZ2A 3MRKA 4FQCH 4Z7UB 1M56B 3PJSB 3ZK0A 2YFOA 4J4PA 4Z3JA 1LLAA 1TFPA 4FFVC 4EE2A 1G9EA 3EIKA 4NN6B 1KV3A 5JORB 3QWOA 2COQA 3CFQA 1V3JA 1D6VH 3DGGB 3JV6A 1SHSA 4MDJA 3CFKB 3NDYE 1DBBH 3OHXC 5BV7H 1MCBA 4XMUA 4FZ8H 2IBBA 4G6KL 1TMCB 4WEBL 4M62H 2C9XA 4WO4D 5IJKC 2DKCA 1G0DA 1A3LL 3GHBH 3WFDL 3RWIB 2NR6C 2ZYIA 1AD9A 3ARWA 4M1DH 4TULH 1CJYA 1BZOA 4F58L 2X4SB 2YMOA 3G5VB 2J20A 3J7HA 4TUKL 3KJ4B 1Q1PA 2PPFA 5BOJA 1KPUA 4M5YH 4QUOA 3VFRA 1A4AA 4E41B 1W9XA 2V3DA 5EA0H 1P5UA 2A6JB 3DSFL 3GEWB 3CHOA 2ID5A 1X5XA 4LLWB 1KWKA 4IKNA 2OMYB 3IMWA 5GJSH 4E9SA 3HS0C 3UBXG 1HHJA 3OKMB 1R5VA 5KN5A 1IBBA 3M1OA 4UQ3B 3VE0B 3OQ3B 4WJ5B 1PZ2A 3F10A 4GRLD 3QUXA 3T1FB 3L4TA 4Z3IA 1HINH 1OP9A 4PJ8A 3T3ME 4NZJA 2IBZY 2W9EH 3S37X 2A74A 1WEJL 2J56A 5I8CA 1VOKA 3CN1A 1XB3A 1FCGA 1MFMA 1SJEB 3PWUB 4DKTA 5IQ7L 4FXGC 1RIHL 3DMMC 2QPEB 2VE6A 4Z8FL 3QORC 1PYWA 3A21A 4K3GA 1OANA 4X8GA 3VI3E 3I3WA 3CFDA 4UTBH 1IFHH 5IMOB 4X42A 2ICES 3E6HB 4N1EA 4TPSA 4HFUH 2J1WA 1AXSA 1F4XL 4KVNL 4IEFB 3LN5A 3OSTA 1H0DB 4AK2A 4KK6D 2Z8SA 3Q5OA 2PXYD 1NGPH 3QQDA 4K73A 4HBCL 2ZAIA 1IAMA 4BE5A 3W57A 5JMVD 3DTDA 2A77L 1ILSA 2FIKA 2HKHH 1YEDB 2CJUL 2G9HB 5D7IA 3F7RA 1JYNA 1T1YB 1QA9B 1OTTC 4DO5A 2IAMA 3LNHA 3MLYL 4H2CA 4JFEB 4LLAA 1RZGB 3ZHKA 2IANE 4NWTH 1U21A 1UJ3C 2HKFL 2EECA 1KLGA 2OCCB 4LQ1A 3VXUA 1EZSA 1P53A 5BVPH 9CGTA 2BW5A 2VLRA 1LWJA 3U4KA 2ZOWA 1XB6A 3NAAL 4D8PB 2MNJB 1MLBA 2CZNA 5IG7A 1ZCRA 4S0TD 5D8JH 4EAJA 5ALBL 3ZIYA 4PJHA 3C5JB 1UKSA 2VYRE 3BN3B 2YGNA 2IGFL 3NSJA 3BD3A 3LV3A 4HV8B 1L0PA 2BSRB 5BV7B 3MRPA 3FYEB 1CBVH 3FUKA 1RZIB 3NFSH 2GY5A 3IFLL 2JIXD 4JE4B 4WGVB 4KK8D 2M8XA 2PYEB 2OMUB 3GIVB 4RIRB 5LUMA 4EKJA 3K2IA 4X4XA 2VQTA 5AZ2H 1NKRA 3M46A 5B3JF 1ZWIA 5E5MA 1S5IH 2J4WL 2K6ZA 4KTDL 4QWWC 4YQXL 1XGPA 4HXAH 2NY3C 3BWZA 4ZNCD 5JUEL 2EXTA 5K9JL 2EVIA 1E2VA 3U4EB 4TQEH 3V6ZB 4RMVA 1GYCA 4N8PA 3T6XA 1IARB 4PYHA 1L9TA 2EEFA 5DRNA 1LWVA 3HZVA 3CC5A 5ITFB 1IAKB 2EYRB 2D3VA 4FC3E 4KKCC 4Y4FA 5HPMA 1I9RL 4BHUA 1YZZA 4ZD3L 2OP4L 1UT4A 3MLRH 1YEJH 1CUOA 3MBXH 4BH7B 5JQ6H 3FFDB 4AEFA 3HS0B 4S1QH 4EI6A 5MENA 3K71A 4MJIA 5LDUA 4R0LA 4R4ND 1TZGH 2PTTA 5GGSY 3ZE2F 4KX8A 4HJJH 1IGIL 3P4OA 5KBLA 4BCZA 3CQQA 4AL8L 4AIZA 2HKPA 1F1DA 1ULVA 2BH0A 1J0ZA 1J87A 1I9IH 5ESQB 5DUBB 4ZW5A 1ND0B 3ZR6A 1MFDL 4P46D 5JW3L 3H0TA 4GKNB 2R0WH 4HWBA 3SKJL 2EYSB 3LCYA 4JZOB 1EZVX 4CU8A 5J6HB 1EAQA 1ZHLB 2CR0A 3B7SA 1HSAA 3DMMB 3V6FB 1MOEA 5E9DD 2N1TE 4Y4HD 3IB4A 4HZAA 3IJEA 2G30A 1H3TA 3WY3A 5ISZE 1W15A 3PDKA 5INCB 5ADOL 3X12B 1N5YL 3BPCA 5CGBA 1CYWA 2AXHA 1KXVC 4GH7B 1IMHC 3SZ6A 1KPRB 2NUTB 3FTSA 3MBWA 4FXLA 3HFFA 4YPGB 3CPUA 1NCDH 3LSOB 4FLRA 5CD3B 5IMLA 1A66A 1JZEA 4AVJA 5I6NA 3GYRA 4H8WC 1CYGA 3G5XA 1BXXA 1AP2A 1OAUL 1E30A 2LVEA 3QEUA 3VI4F 4DT2A 2NY6D 1MI5E 3SNSA 1M9WA 1BOYA 4HJ1A 3IU3B 3FNKA 3X11B 5JR1H 5EC2B 4JAMA 1ZSDA 1MAMH 1AACA 4XVOA 2DQIH 1UJ3B 4WV1A 4MAZA 2Z8RA 4H8WH 4AGPA 1LILA 4B0AA 2V5TA 2VB5A 3RNKB 2BWDA 4DVRL 4JZNA 3IN2A 3W9DB 4R8WL 3MBEC 3SE6A 3WIHH 2PF6A 4CKQA 2XN1A 1XQ4A 2WKLA 1NIBA 3H6AA 3THMH 2HLEB 4BD4A 2IPKA 1H6FA 4LCCC 2ZT9C 2XN9A 3TF7C 4CN1A 5CZRA 1HTYA 4MX7A 4P4KC 3FBKA 4ZX5A 3K5RA 1BEXA 2YBRB 3HG1D 3HI1B 2JI1A 3B5TA 4K3JL 1PZUB 3U0WL 3EJRA 4O4YH 4YXLH 3MRJB 4UQIM 1B9KA 3MRDA 2NY3B 1CICC 1MCEA 2JKIS 4HD5A 3PWJA 3VVWA 3ZSSA 3SE3A 1VGEL 4A7GA 3MJ9A 4MAYD 4IU2B 2DV6A 2O6CA 1J8RA 3HHSB 4WW1A 3GIZH 3VGHA 3EGDB 5DD0H 4NFBA 4WUKL 3VXQB 3W11C 3S3JA 3NCFB 4PEEA 5LNDA 1MFBH 3SKUD 5ICZA 5MEPA 2DQEL 2DQJL 4NNPH 3TWCL 4B27A 2HUEA 2ZNXA 3G5WA 3I74A 1I31A 5HJBA 4X83A 3TONA 4U7MA 2V2TB 3BW9A 1G7HA 1NCWL 4QT5A 1YN6B 3Q8CA 4AZ8A 2E3VA 3KYKL 3KPQB 3ZKXB 2F19H 4WUUA 4JK0D 3CVSA 2VDOL 1I3RB 5DC0A 3NCXA 2R7EA 4P9MH 3VGDA 4S10A 4WO0A 5CJXC 3TOPA 3I3DA 3MUUA 5SWZD 1NMCB 5FFGA 1A47A 1JK9B 1I4FB 4AUJA 4NAMA 4LAJH 4AT6B 4FFWD 4Q14A 4E9RA 3K6OA 1DEEB 4YFLI 1I1FA 1MHEA 3UGEA 5KSAB 1MCHA 2RHEA 4A6YL 4J8RA 5DWUL 5TE6L 1ZVHA 4QOKB 3WLWD 1I1AC 5D5ME 3BD5A 4JRYD 1VTLE 2X10A 4XN1A 3N5AA 3FOMB 4UWQB 1Z5LB 4NGHH 5DD5H 3KPOA 1GOFA 3P9MB 4MJHA 4XVTL 3BAWA 3EOBB 3VXNA 3JQOB 4J4PC 4WI2A 2EO1A 2G9KA 4XCYB 2P47B 4WHYH 2JB5L 3KYNB 3DO7B 1FL6B 4OVUA 2XV0A 2XTLA 1PSKH 2AEQL 2DYRB 3CFNA 1LDPH 3N41B 2WLZA 4JFOA 1ZA3A 1DL7H 4QXGL 2PKDA 5EUOE 3EBAA 3B2DC 1SY6H 4W70A 2GJPA 4ESKA 2VR7A 4BZ2H 1GPOL 3MLXL 3TFBA 4DZ8A 1EJ8A 4HF5H 2W80C 3OQRA 1MELA 2VDQH 1GRWA 1RZJC 2ZAGA 1D7BA 1SJHA 4IBYA 5DVOA 2AW2A 4XCNA 4PWJA 5D2NA 4BZYA 5FPIA 5L8JB 4G80A 3P3YA 5DJ2B 4J2XA 3RDTA 4H4NA 3FU5A 2YN3A 2OMWB 1P5UC 3UG5A 4DEPC 4XWGL 3QDGD 3U6XA 1TO5A 3RWFB 3ILPB 4OZHE 3SOBH 3R4DA 5F71A 1RZJH 3W1ZA 3WG7B 5I1IL 1IM9A 2HTKD 1GZPB 3B2PA 2G3MA 4W9JC 4XPHH 2CUHA 1WFOA 4ZSOB 3PV6A 4PJ8C 3AZUA 3HAEA 4GAAA 2A74C 4I77H 4FQXA 1C4GA 3MV8B 4AIXA 1LE9A 4HX1A 3UJJH 2C3VB 5IHUL 3S96A 3GK8L 4FD0A 1ORSA 3BUIA 4P4KB 1KYOK 2JXMA 4G5AA 2P5WB 3VX1A 2FE0A 2OX5A 4D0CA 3PABA 3IJHB 3SQRA 3MV7A 3CPLB 3OXSB 1Y0LB 4OB5H 1NTDA 5LHDA 4DN3L 1DUYA 5KVGL 1S9WA 2IMNA 1XT5A 3UERA 1CU4L 5F2FA 4PJ5A 2E9JA 1J8HB 5C0CB 3CNKA 2OI9C 3SDCD 4FA7B 1BZ7A 3IFNL 3PQYD 2PTVA 4PJ7E 2XICA 3FFCD 1A6UL 3DX7B 5E7BA 5CJOL 3MLWH 5HYSB 2MCG1 4FZEH 4RAUB 3LKNB 2FHBA 3D0VB 3WL9B 2ZTBA 2AZAA 5DJ8B 2R4RL 3RPIA 1CD0A 1JWSB 3V0AC 2IAMC 4EIUA 1ZK5A 4L4TD 4P49A 4BWUA 2VW7A 1IE5A 3O6MH 3DC0A 4B9ZA 1CXHA 2H1LM 4NQED 3P9WB 4P2QD 3KPRD 5AKSA 1QBMH 3OF6D 3V0VB 2Q6WA 2O5XH 1R17A 4MNQD 3QCTH 1WITA 4UAOC 4KUCD 2J8UE 4LDCA 4RRPG 1BQLL 2X4NB 3FSZA 4F1ZA 1EAPB 2WXNA 1I1AB 3B9AA 3MTXA 3N44B 5C7XL 1YMMA 1SVCP 1MPAL 5F0MB 2VM4A 4AX3A 4Z7WA 4QRTB 3EO9L 5HHXL 1PDKA 1BD2E 2YAQA 3BUQA 2VDPH 4I88A 4KI1A 4N6RB 5G5DA 3MRKB 5L9DH 5CD5C 2QDVA 4GG8A 1WD9A 1S7QA 2H9GA 2YXWA 3VRLF 1QN6A 4KJPD 4MRBA 3QWOB 5GSRA 1HYSC 2DMGA 1O6SB 3T2LA 4K8RL 4N24A 1JHTB 4NYLB 1CGSH 2H1PL 4K3DH 3X1GA 5JIQA 3I50L 2WWOA 1H6UA 1DBMH 3FSWA 2J2ZB 4ANUA 1NEZB 1U36A 3KLHD 4NLHA 2A4ZA 2NW3A 1JPSL 4JFDD 4HC1A 4RMSA 4R5VA 3GZPA 2I25N 2LLNA 2MOQA 3P0YL 2IG2H 4LIQH 2QPDB 5LCVA 4Y4FC 2WLIB 4DEPB 1VOLB 2VLJE 2C9RA 2OYMA 4ELMB 5JXAH 3F7KA 4G72B 3L1GA 4PWEA 5K9KB 1AGEA 1HHJB 1FAKT 1W8NA 1YNTB 3L5XH 4R0LC 5KN5B 2I60L 4M7LT 3FN0L 5A2IH 4AQ8A 1Z66A 4BKLA 3AB0C 4JM2B 3E0GA 4HXBH 2MQCA 1EHLH 2A74B 2DD8H 4FFZA 5JZ7C 2NOBA 3QISA 4MCYA 2VXTL 3DI2B 3EADA 4MXQD 1YVLA 2C9SA 1N4XL 1QNBA 2XOTA 1RURH 1T1WA 4OLWL 3SPGA 3T0WA 3EHBB 1A6ZA 5AW8B 4YHZL 1DYZA 5C07A 5EDXA 5I8OL 3OR7A 4W9DC 2XPGA 2V8LA 4OIFA 1JZ5A 3TEYA 4S1SH 4ZS7L 4HWBH 3CVCA 3WY4A 3LRSB 3HNTL 4KTYA 2RMNA 5DJZA 5GQBA 1EUVA 15C8H 3CFBB 4P3CL 1QRNA 3T08A 3LQMA 2N0KA 3LN5B 3OLDA 3OAZH 2VDLL 2E9WA 2VN7A 3QQDB 3V7AE 3PWLA 4JO5A 3EOTL 4NCC2 3CVHB 3HUJF 5FO2A 1E90A 4DESA 2KDGA 4Y19D 3OSMA 3VRJA 3FT4A 2AQSA 4L1SA 2E6JA 5D7IB 1CGUA 3ZZ1A 2I9TA 1NCOA 1TR7A 4BM7A 3N43B 1WA1X 3AW5A 3T04D 3WKMH 5JHBA 1JTPA 1WRFA 2IAMB 5IVZB 4ISVA 3SDDD 1TEFA 1MAKA 3L2LA 4FHJA 4WV1C 3EH2A 4JDTH 4WTZA 5LWYH 1PVSA 3CWUA 1QN4A 2F54B 1UWXH 3VXUB 2Y25A 1CXLA 3T8VA 5C0DA 2VDPB 1SRDA 5D7LA 2VLRB 2DY2A 4LBEB 1PD6A 1K5NA 3UABA 3SIKA 2CIKA 2YPKA 4X5RA 2WO2B 3AAZB 3VG0L 5IG7B 2VZ1A 2Z8WC 3T0VA 1W72A 2GJJA 4PJHB 3WFEL 3DX2A 2N0MA 2IF7A 2DWEA 5I16B 3KLAB 4C56D 3LV3B 2Q1EA 2EDDA 3HCVA 3MRPB 2Q2EB 4RNRA 1W0VA 3FQTA 3H1ZA 2X9YA 2G2NA 2H0PA 1QFUH 4N8VG 4NP4H 1TVDA 4TSCH 1GC1C 2PW2B 2Z31D 3D5OF 5T5NF 4TVPL 2B1AL 4M03A 4AITA 4X4XB 4JPWH 4PJDE 4FMFA 4CJ0A 1H3WM 3MRCA 3ECBA 3KLDA 3SE3C 2VQ4A 2LE9A 3S8WA 4MHHG 2P46B 2ZWYA 3RUGA 4B9JA 1GC1H 1A0QH 4O9HH 4DGYL 3B3IA 4GW4A 3L5HA 1CK0L 2ITDA 5DRNB 4HVBA 4MD5A 1OLLA 3RA7H 4LVNC 5BXFA 5FIEA 1MSPA 3W2DL 2AXWA 1CQKA 2KPNA 4HGMA 4Y4FB 5HPMB 4WO4A 3IMVA 4XI5C 1BVKA 1T6BX 3FQ2A 3MJ9H 2IWEA 1QD0A 3Q48A 4OSUH 4EI6B 5MENB 3EDKA 3K71B 4R0LB 2DEXX 2XI9A 4V1DE 3DUHA 4AIZB 1OTUD 3GMNA 1LXTA 1J8KA 1OT2A 2DMHA 6CGTA 2VRAA 4FE9A 1FIGH 3H0TB 2ZCLL 1T5WB 4A2EA 4EAKA 3ELAT 2YQBA 3P1VA 3KJ6H 3NZ8A 4GRLA 4WWPA 5D4HA 4ZPTB 5IMKA 4HCRA 1OAXH 1LEIA 5E2JA 5I82A 1ECZA 3PY9A 4BFFA 3FT0A 4DGVL 4EQ2A 4LNRA 4NFCA 1U8LA 1VGKA 2PR4H 1AIFA 1VIWA 4ZUUA 3TJEL 3F12B 3EGXB 3ABLB 1SOQA 5CINH 3BPCB 1G7PB 3DRTA 1XGYH 3GM0A 2C3WA 2XHNA 3L13A 2FQDA 4U3HA 1RLBA 2FX9H 3S48A 1IC1A 2XQYG 4JFXA 5C8JB 1F42A 5IMLB 1CD1A 1XV8A 3SBWA 1AZVA 3O2DA 2HPTA 4OUUB 5CGYD 3GBMH 2EH7H 3QEUB 1EFXD 3IT8D 4OM1H 2NNCA 4QGTA 4JO3L 2DLFL 4GUQA 2WXLA 3IPEA 5AEAA 3DPDA 3RDTC 5C0BD 4HIQA 5E2VH 3OB0H 1HXMA 3HC3H 5JDSB 1Y18B 4NKMA 3ESUF 3SEPA 4ES8A 2YA0A 2WXRA 4Z3GA 5IFAL 1G7MA 2MPVA 1UD6A 1G94A 2PMZA 5ESAB 4PGEA 3CDZA 1ORQB 1LEKB 3RBSA 4HG4K 3F7YA 1O6TA 3W37A 3A6CH 2KZBA 5CFAA 1JF6A 4QDGA 1IC0A 3L3GB 3K0YA 2BINA 3FH7A 2IPKB 4FQXC 2N1KA 4X4KA 3REWA 4RX4D 1A7OL 5I5RA 4JDEA 4PB9H 4MX7B 4WNQA 5EF0A 5GS0C 4ZO8A 2VLME 3K6DA 4GW5A 2XTJB 2QJDA 1L7TH 1OK0A 1AD0B 3TASA 1KSRA 4ANXA 2H6PA 1J05B 3VB8A 4KKAC 5FKAB 1IJ9A 3HAEH 1AO7A 1SJXA 2CQVA 4QXTA 1F4YL 4AGLA 2X87A 4YDNA 3BI9X 4EXPX 5GS0H 1R3JB 3BEWA 4HPYH 4I3GA 1U42A 1UD3A 2JIXA 4OF0A 2FECI 3KYMA 3V4UL 4PJGE 2O61A 1OO2A 2IIJA 4WW1B 2Q10A 2AJSL 3G6AA 3NJKA 3PE9A 5L8KB 3TBSB 5DHVA 3V8CA 1ZXQA 5HDQL 4NQDE 5AW0B 5MEPB 1RIVH 2DQ6A 4LVNB 1N18A 3WAJA 4KDTA 4MKTA 5EU6D 1FFTB 3QCUH 4P59L 2HMID 4FL4B 4PRNA 2UZYA 4UDTA 3UP1A 3QIWD 2D9CA 1QZNA 2QPFA 5JHLA 1D6EA 5D1QB 3VXSB 1IE4A 1JXDA 1IM3B 3QDMD 5DURB 1JMXA 5E6SB 4PLKC 5B8CA 5HYJD 1EAJA 2APXA 4MZ2A 5KVFE 1T5XA 3G5ZA 3SE4A 4UIKL 1PD0A 4WUUB 2CKBL 4X6EA 2CU9A 4ACPA 3D06A 1WUZA 1CT8A 2R7EB 2XNAB 3CK0H 4Z78A 1L6ZA 5CEXA 2F9BT 3H3BC 4I87A 4ZS6C 3N1MC 1I1FB 1MHEB 4OJFL 1X9QA 2NTFA 3WKNA 3U2IA 4JJ5B 4J8RB 3ULVD 2AV1A 3C2AL 2HVKA 1UC6A 4PBDA 1CFMA 4RGNE 2V5MA 4LP8A 3DWTA 4BQ6A 5IJBC 4K2UH 3MGOA 2OOYA 5LN4A 5I0ZA 4HAGA 2VW4A 4P46A 4UT6L 1BZ9B 3VXNB 5FO7A 4J3SA 2H3NA 5DJCA 1UM4L 1OIOA 2AQ2A 2CHZA 4JO4H 2J1XA 5E9DA 5DR5L 1IO4C 4Y4HA 2GG1A 3GBLA 2YN5A 4HH9A 4QXVA 2CRYA 2NYZA 3JV4A 3CLFL 4JFOB 1ZA3B 2CXGA 2UX7A 5DLML 3L6FA 4PJXB 2XN0A 3L4VA 5F7BA 1V3MA 3SDXA 3RIAF 5IGXL 3KHOA 2NX5A 1OGAD 2KT6A 4DZ8B 5IHZA 2BFVL 2PWFA 4IGBD 1CURA 3L5JA 4JGJA 1SJHB 4JG9A 4PJCE 3JWNG 2Z91A 1CLYL 4XCNB 2W95A 4G80B 4YHLL 1N7MH 1SBBA 2P26A 3RDTB 2NY7L 5D7EA 3ZE0B 4BFGA 5DMYA 3DPTA 5DRZA 4XNAA 4TOYL 1PCXA 2PW1A 1IM9B 2R9HD 1NCDL 1AKJD 4HT1H 4HC1H 4ZAKA 2F53E 3RURA 4AQ8C 3PV6B 1NOLA 3HAEB 4IYKA 1R0AH 3BXNB 4ROCB 5LCVH 2EQDA 4HPOH 4FQXB 5CSZA 5DMGD 3P02A 3CTTA 4A7VA 4DHLA 4YIQA 3EBHA 3F85A 1LE9B 1WGVA 1VFOA 2O5YH 3MRNA 4KOBA 3S96B 3O4LE 3ZUCA 1BVNP 1ORSB 4D7BA 4TTGA 3WXWL 2AKRA 1KGUA 4HGWA 4CA4A 1KFIA 2BP0B 4IRJB 4KHXH 3S88H 2E47A 1M57B 2OX5B 4PJAE 1QI3A 4D0CB 4GG6B 3VU1A 1UXSB 4NRXA 5T1DL 4FFZH 1BFOA 3MV7B 4EJZA 2DTML 3ULUL 1UQSA 4XC3L 1IT9H 3DJTA 1MCRA 1E9PA 1JIBA 4X9BA 1K5WA 1DUYB 2E6QA 5BQ7B 3HG1A 4TL4A 4XNZC 2HTLD 1S9WB 5KYXA 3BDBA 1C5CL 4XPBH 4PJ5B 1XMEB 1F13A 4NI6A 5KSVB 2JELL 4ICXA 1HE8A 4X6CF 1U91A 3VD4A 1VACA 5HHVL 4WI9A 5HDWA 1J7VR 1JTTA 4KI5F 4KOCA 2CBOA 4PUBH 3OZ9L 4XMXA 1OP5H 4EI0A 4XMLH 5E99H 2PWHA 3NA5A 1P7QD 2OW6A 4MAYA 5I5IA 3ZKMD 4ZZKA 3P9LA 5C70A 4QTIL 1F6LL 3SKNB 3A22A 1IGCH 3RPIB 3A4AA 3ILDA 1BEYH 3I2CH 5E2UL 1FAIH 4YC2C 5LO7A 3WEAA 1PF3A 4Z7VF 3GINA 2KUTA 3C6LB 5B4MD 1P6AB 4TF4A 1C16A 2F68X 1A4BA 2Q6WB 4FQLL 4XHJC 2DDQH 3II2A 4OU3A 1DANT 3EYQD 5DA0B 2A4EA 4UV4H 2XG4A 4ZBJA 3UACA 2C3XA 1OKEA 1SYVA 1AANA 3S8FB 2VUKA 5JOPD 4FNSA 2OL3L 5C2BL 4HS6B 4XP9H 1MHHA 4Z7WB 4YNYB 1PDKB 1OSPH 3U79A 5G5DB 4LPXA 4PJ9B 2XV2A 3ERXA 4GG8B 4N9GB 1NBYA 5GSRB 2VDNL 4ONOA 1W72H 2EIEA 2MCAA 1KEGH 2F7OA 1AXTH 3DUUA 3QH3B 1S7SA 4GUPA 4N3TA 1I1YB 1OCWH 5GGUA 5T3ZH 2R29L 3GZKA 4OJEH 4J28A 4WFHD 3ZHNA 5KAQF 3QEHA 4AYMC 2IALA 4GAYA 4XX5A 1E3ZA 2Y6TE 5FO9B 2Z1PA 2VXVL 2P43B 5GHWH 2X7LB 3AT0A 2AVFA 4LZKA 1VPOL 1A9EA 4MDIB 4U3CA 5B7MA 3C5ZB 2JPIA 4DOHB 4AIOA 3WFBH 4WO4C 3BKMH 3QK0A 3U1PA 4ETQA 1I8LA 3IGAB 1EFQA 1TTBA 4RSVA 4MJ4A 3UTPD 2FJHB 1I75A 1AGEB 3RGVA 1RJLA 1RMFL 4FHKA 3OJMB 3BKJL 5EPCA 4ZMLA 1SY6L 2NT1A 3RZCD 4BKLB 4MJ6B 1IC4L 5FA3B 4F7PA 3BP7B 1UA6H 1A3QA 1FPTL 4OIIL 1XBRA 1BWMA 4L1BA 3T65A 4M3HA 4CC1A 2MKWA 5T1KD 1QWNA 4Z5RA 5J1SC 2QBWA 2D7TL 5F8QC 4A67A 5KOVC 1IGTA 1TPXC 2OR9L 2XBDA 1T1WB 4CC0A 4CNIA 4AEIH 4GRLC 2NY1D 4M1CC 5E8PA 3UROR 2G75A 3LN4A 3ARZA 1Q94B 1YEEH 2R56L 2BVQA 5C07B 2J88L 1Q0EA 2EVHA 5C09E 1F6AB 2EIDA 3OR7B 4HKJA 1WAAF 2XPGB 4HHWA 4UQDA 5T5NG 5LN8A 1JN6A 1N59A 4PJEA 3VGAC 1DHKA 2IADA 2B16A 4UU9B 1CGXA 4QHKI 3J8F7 1JDYA 5I0XA 2X4OB 3E7JA 4XNZB 1QRNB 2XWZA 4HCRH 1MNUH 3T3PB 3BCFA 1U93B 3O3EA 1SMOA 5L7XL 2F8IA 2YXVA 3FTWA 3SBWC 3A6BL 5ALCL 5GS3A 4ADJA 4EJYA 2YGQA 3WAKA 3VRJB 3I9PA 3FT4B 4RISL 3GSNA 4N68A 1MQKL 1JF5A 2CXKA 3WEXA 2I9TB 4GXUN 3QSKB 4HUKB 3L3IA 1ZT1A 3QZWA 1LNUA 4HUUA 2GJ6A 4ORGA 3NTCH 3FFCA 4YC2B 2HRPL 2BC4A 1AJ7H 1SOSA 3TF4A 2I5YL 2YD5A 3F0ZA 4DPBX 3O2DH 4UM9D 1FFOA 1XGZA 4HIIB 4PRID 1XF2A 1RAMA 4KTEH 4D7QA 1OP4A 1FNFA 1XIWD 2CRMA 1DE4B 2YKLL 4UT6A 4CMMA 1OALA 4XXWA 5MI0C 5C0DB 1K8DB 1TT6A 1NIFA 5D7LB 4QF1A 1DQLL 2CJ3A 4KU1A 4UYPA 3UFIA 3CZEA 3CWGA 4AG4H 4K71C 3TC9A 3MLWL 4L4TA 3OKEB 4K8RC 4FZEL 1W72B 2ICEB 4DK6A 1MIEH 3WN5B 2KYIA 3QUZA 4F2MA 2GC4C 4NQEA 4Y5XA 3KPRA 3HFML 4RNRB 1TJIL 2R1WA 1W0VB 2WMPB 3FQTB 5A43C 5AKVA 1JWUB 4I3SL 4MNQA 4R96B 4M43L 4DP6X 4NQXA 2IGLA 5DD3L 4GAJL 1U41A 3CVHL 3PP4H 2J21A 5D1ZD 4E36A 3LS5H 4R26H 2H6UA 4YDVA 4MJ5B 4I48A 3AADB 2OSLA 5E08L 4O5LL 3VACA 4AWJC 4GT7A 3CXFA 3WFZA 4CAGA 2VERA 4GKOA 4GIAA 3ECBB 2AI0L 2IQ9L 4JO1H 3WE6A 1JMZA 5HHMD 1QN9A 4G6JH 4JDVA 4MA1C 5IYCP 1NCAL 1PIFA 4DFIA 4FLHA 4AYBA 2WQWA 1ZVNA 5TJWK 5C0RH 4JHUA 2ESVD 4G7YH 4XBEL 3QZMA 2KS0A 3FQYA 4HPHA 3B3IB 2ITDB 2XWEA 3HR5A 3PDDA 1RU9L 3BX7C 4MD5B 3CN3A 3ASOB 4UAHA 4A2DA 2YPVL 5BXFB 4ROEB 1RUMH 4KDTC 4Q9QH 2WLNA 3D8MA 4N2MA 4WO4B 2AGJL 1BVKB 3N9GH 4V2CB 2IQAB 4NOFA 5B8CC 2ZUTA 3B5HA 4JFDA 1CGSL 5HGAA 3W39A 3M45A 4G71B 3MREA 4N90E 5DHVH 3SE4C 2NNRA 1DQQA 3QFJE 4P57A 4AOFA 2BVUA 4NJAL 3GMNB 3MR9A 1NM4A 1GZQB 4L5FH 4WTQA 1JGVH 4J3OC 4ZUWB 2B39A 1Q72H 4PI0A 3M6DA 1NDGA 3ZHDA 3KRMA 1U8OA 1KENL 3CD4A 5JHLH 4R4NC 5I0YA 5I23A 1MCLA 2YD1A 4B7IA 3NA9L 3F04A 3QJXA 1JGIA 1BF5A 4O02L 3NZ8B 4GRLB 4ZFZA 2EDTA 1LEIB 1GAFH 4ZX4A 3EF4A 5LNGA 2VOTA 3NIGF 1E42A 1HYRC 4JCLA 2HT3C 3UBXA 4OZIF 4FERA 4LNRB 1U6AH 1U8LB 1AIFB 1BFTA 1MXGA 3IXAA 4P46C 4JS7A 4F57L 5FK9A 2UWEF 3HHRB 3DRTB 4TRPH 3G5YA 2WW8A 4W1TA 2QPUA 4Z7UF 4LOUC 3FULA 3GDCA 4Y4HC 5BRZA 2CK0H 4NO0A 4AV5A 2ODIA 5J56B 1A6TA 2LFEA 5FHBH 3UL4A 4OCXH 1MDTA 1GGCL 2OKMA 1CD1B 4AE1A 4QLWA 2GUOA 5BVJA 2X6AA 4F7EA 1NGMA 4MA8H 2BIMA 5I1DB 2NQCA 1CE1H 3QUML 3NZUA 3UC0H 3W9EB 5HYQB 3WNKA 2PXYB 2IH9A 1VFAA 2MIZA 5D7HA 2ALAA 4FP8H 1J5CA 1R1CA 3NEXA 3QA3A 4M48H 4Y19A 1FIEA 4UQ9A 4WSJA 5MI0B 4NC0B 3OKNA 2EEAA 4W9IC 4YSAA 2Q8AH 3CDZB 4Q58C 1AMXA 1M3JA 2AJZA 3HC4L 4ZAKC 3F7YB 4HKBB 1KY6A 1SYSA 4JHVA 3DHUA 4JPIA 2BHFA 3SDDA 4HLEA 5ISZD 3REWB 2HFFA 3VNZA 2IH8A 1UT1A 1BAFL 4G8EA 3WKML 4GW5B 1UCTA 4F92B 1HEZB 2GYSA 3CV5A 3NJNA 2GTWB 4JDTL 4HS8H 5A16A 5LLIC 2HZHA 1TJHH 1CDJA 4MQ7A 4QXTB 4RZCA 5DRXB 1QFPA 4C56A 1M6OA 1B3JA 1MWOA 2DQGH 1CFVH 4IBWA 4LSRL 4ICWA 2CDEA 1A4JB 2EDXA 4UV7H 3UTTD 1MI5D 4MA1B 1WC7B 3BEWB 5K5YA 1X5KA 2JIXB 3KYMB 1DVYA 2HJLA 1OK8A 5MHSD 5DK3A 1NCGA 2E27L 3AWFA 1ZD6A 2IWFA 1TKWA 3S36H 5J8OA 1RFDH 3SGDH 2IEPA 1TQCC 5CP3A 5DHVB 2GT9B 4IBLT 3T2PA 5J12C 4ODBD 2OJEA 2XQBL 4F7TA 3GXTA 3X14A 3US9A 4JL1A 4AEHL 4IBQA 2UZYB 4MAYC 3B9EA 4ABVA 2LABA 1D6EB 2YAFA 3L5IA 4YFEA 4PJFA 3PG2A 2C3GA 1CO1A 4JQXA 5IFHH 2V7NA 4IBTA 4JHAH 5JOEA 2CO3A 3G5ZB 2YUXA 4OQTA 1CFNA 1ZA6A 2QMJA 1WLHA 4JFFD 5LB1A 4QR7A 1CT8B 2MNUA 4E5XG 2A0LC 5HPOA 3IFOB 2WLJA 2G4GA 3MXVH 3SB3A 5CEXB 1JPTH 3S4SA 3V0FA 1BMWA 1HHKA 1XCQB 5B22A 4GAGL 2NTFB 4OW6A 5IIEB 3T9WA 3BT2L 2KLSA 2AV1B 2HVKB 4ZMAT 2VC2H 5FWQA 1RJZB 3G6JA 2X2JA 4POZD 2KKQA 5IEHA 1IKFH 3SGDI 4BUGA 3MGOB 3PHQA 4NERA 4P46B 4XPGL 5E51A 1J9SA 1ZAGA 4JKWA 2VMJA 3FRPG 5FO7B 3IDMB 5DJCB 2WVVA 2DQHL 4BFIA 5E9DB 3WLWC 4Y4HB 3LRLA 1LHZA 3FO0H 5DHXB 3JV4B 2AC0A 4N2NA 1XR9A 3HA0A 4C4KT 3L6FB 2QQQA 5G4MA 3ZW3A 5L0QC 3SDXB 1I8KB 1RUAH 1BF2A 1JGLH 4YSDA 1ED3A 1A4CA 5IHZB 1KB5A 2B2XH 4FI7A 5L88L 1S7TA 4FA8A 5BQDA 5GPRA 2HT4D 2Z91B 3BKYH 3E8UH 2F5BH 5C86A 1B2WL 1G7LA 1YEGH 4Q4EA 4P5TD 5F9CA 5A6IA 5DQJA 1QN5A 2ZG3A 4L0PB 4IL8A 3WFCH 4H44C 1I8LC 2APVA 1T83A 1FQ9C 5CJBA 2NY6B 1U30A 2PW1B 3SY0A 4NQVA 4FTDA 4K5PA 2Y22A 3RGVC 5HY9B 4L3FA 4CRPA 4HJHA 5EF2A 1YCSA 3UTSE 1IZJA 3CZJA 5DC9B 3Q2CA 4TNGA 3CVDA 2L4OA 5DK0A 3ZGIA 3ISRA 4H0GA 5CSZB 1QN7A 3SJVD 3CC1A 4OM1L 4YIQB 4XTRD 3GMRB 3MRNB 4Y2OA 1NFDB 5I8KH 5IMMB 3B9DA 3CSYB 3MQIA 3Q7JA 3D25A 2FECL 3KBPA 3HC3L 1CF1A 2F5AH 4NM4L 3CX5K 5L2KD 2QSQA 2VMCA 3ARXA 4HAKA 1UD5A 4NRXB 4PRPE 1BFOB 4YX2H 3S9DB 4QRPD 1YJDC 3ABKB 4FCHA 2WQXA 4TPRH 3JVGA 3DJRA 3HRZB 1E9PB 4JE0A 4AYSA 4R9HA 4Z3EA 3HG1B 1HQRA 2PCXA 5KYXB 2ARJA 1ZLVK 2L7EA 1FVEA 1RZ7H 2AJVH 3MODL 1EBAA 3VGFA 1P5VA 5EZIL 5JHDE 2BRQA 3DX6A 4U1LB 5FCSH 5KAQG 1VACB 3I6GA 2C26A 4X5XB 3RIFK 2D7NA 3D18A 3DUSA 3GSXB 2EXWD 4MAYB 2FZ3B 2DIBA 1D3UA 4NRYA 4KC3B 2FWUA 4IRSD 3DX9A 4XMKH 2QSCL 5KSUA 4WLCA 2D0BA 5CGTA 5F9DC 1N3CA 2VM3A 1I7TA 4K7FA 1U3JA 2XXGA 3P11L 4B50A 4HWEH 5IKCA 2VC2B 1JRHH 2HCZX 5CSGA 4HQQL 1UACL 3IDGA 5IVNA 3QIBD 3R8BB 1K2YX 1H8SA 3QIWA 3BSZL 3WENA 4XXWC 4OLUL 1ADQA 2DEWX 3GSNH 1URLA 1E3XA 3QDMA 5HYJA 4LCVA 1T2XA 4YFDB 1ASOA 2FUQA 4GO6B 4IK6A 5JIIA 3EDJA 5J1AA 1MREL 4B41A 3QUZC 1RUQL 2VITA 4GRMA 4Y5XC 4YXKH 5SWZB 4QG5A 3L1EA 5HVFB 4P99A 1Q1JL 2CJTA 3NIDB 1L6XA 2HWZH 4LXFA 5ANME 3GXUB 3TPUA 1NBYB 4KZEL 3QEQD 1OAQH 1TJGL 1RK1A 1EEQA 4PD4K 5C6PB 5GGTH 1O9ZA 1OEZW 5IB5A 2NXZC 1QOKA 1S7SB 1MW3A 4PB0L 3SSGA 5KYYA 2GBVA 4HEME 1YPZA 2OMNA 1AC6A 5HXMA 4HUWB 3I6LD 4L4VE 5AB1A 5TDPA 1PY4A 1B6DA 4MVBC 4ENEC 1JVOA 1LP9A 4L8BB 2A5UA 4WWKA 4YHOH 4PRDA 5A2FA 2R0ZH 2TSBA 3ROOA 2VNCA 1TSHA 5TH2B 2VXUL 3EYSH 1I8MB 5EEUA 5KYUA 1WZ1H 4JRXA 2X1PA 1T21A 1I3GH 3S35L 4IGBA 1MJ7H 1LDSA 3BC9A 3KLHC 3GSRA 1V3LA 1RJLB 4KMTH 3BDYH 4UNUA 4F37K 5CZXD 5MP6L 4QHNB 2OSXA 5FYKU 4N2AA 3HE6D 4BUHA 3ZDYB 3QDGB 2F58H 3TGXA 4ORZC 3MUGA 2YD8A 1YQRA 2EC8A 3EG9B 3F83A 1JSYA 4RMQA 1IGTB 3TT1L 3QO0B 5E7FA 2IDUA 4X8JA 5E8PB 2G75B 1QQDB 1Z1WA 2ZAHA 1SMAA 3KVPA 2V17L 5FV1L 3WHXA 3FU9A 4PJBE 4HKJB 4NX0A 1KXHA 3O45B 1T89A 3TCLB</