2IV8A

Beta appendage in complex with b-arrestin peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
233
Chain Sequence
b'GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 COMPLEX SUBUNIT BETA-1
molecule tags Endocytosis/regulator
source organism Homo sapiens
publication title Role of the Ap2 Beta-Appendage Hub in Recruiting Partners for Clathrin-Coated Vesicle Assembly.
pubmed doi rcsb
total genus 59
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2iv8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2iv8A02
1KY7A 1W80A 1NGMA 2IV9A 1KYFA 1VTLE 3VN5A 1NH2A 1KYDA 1TGHA 1JFIC 1RM1A 1QN9A 1QN4A 1B9KA 1QTSA 1QN6A 4RODB 5IYDP 1E42A 1TBAB 1QN8A 3H1ZA 3ASMA 1KY6A 1QN5A 1QNEA 4B0AA 1QN3A 3OCIA 1QNCA 1D3UA 4ROEB 1YTBA 3EIKA 1TBPA 1MP9A 2G30A 1PCZA 1VOKA 2D0AA 1R4XA 2Z8UA 3HS8A 1VTOA 1NVPA 1QNAA 2D0BA 5IYBP 2D0CA 4PY5A 3HS9A 2VJ0A 1KYUA 1QTPA 5IYCP 1QN7A 1PZDA 1C9BB 3OC3C 4WZSD 1CDWA 4ROCB 1QNBA 1YTFA 1VOLB 2MJ7A 2IV8A 1AISA
chains in the Genus database with same CATH superfamily
1JPEA 2DDQL 3QG7L 1D7BA 3MGTB 4MZRA 1W0WB 2ZOKB 5D1ZB 2P9RA 3DPUA 4YX2H 1UD3A 4HIIB 2Z35A 4LEEA 1GGBH 5FB8B 5TE6L 3ZZSA 5CILH 3IS1X 4N0RA 2MCPH 2I69A 4AT6B 1GS8A 5BOZG 1NAKH 3K6NA 4UTAL 1NCNA 1T21A 4TSCH 3MLPA 5E7BA 5HVFB 1U8KA 5EBLB 5E6UB 3WEBA 1CGWA 5E4IA 2PP8A 5H37G 3KJ6H 3C60A 1BOYA 1FL6B 4J3OF 3ZXAC 4TVSa 1EZSA 4N1HB 4QLRA 4ZNCD 4IL8A 2J2ZA 3WEXA 2ORBL 4CU8A 4XRCB 1CDIA 1GZQA 4BRJA 1RK1A 3L7FB 5D7JB 4RGND 5KSBE 1UADC 3IFOB 5GS1A 4IM8A 2AQ3A 3K7UA 1F6AA 3NFSL 4XODA 1KBVA 1PKQE 2ICWI 3HI1A 3J8F7 4XC1H 4I3SH 2JI3A 3LZPA 3N5AA 1A8ZA 1MWAB 2VUYA 3D5OF 2COVD 3PXHA 4AX3A 4DGIH 3MRDA 5GGSY 4DO4A 4LRNH 4LARL 4P3DB 3S36L 5KANI 5FGBA 4HJJL 2AGJL 2D0HA 3T5WA 4E9WA 2FSEB 3C5ZB 5FOBA 2ZCHL 1ZXKA 4UQEA 2VUKA 5G4MA 5C07B 3IDMB 2C1PA 1E28A 4MD4A 1OP9A 1KWGA 1MSPA 3C6LB 2FKMX 3ATBA 4Y2OB 2J8UB 3GBEA 4FULA 1MWAA 4JFUA 3H3PL 4N9GB 4ZTPH 3U0TB 3HI1B 1HDMA 4UM9D 2HTKC 4BZ1A 3RFZC 3AQYA 3IFOA 1UD4A 2G4EA 4I0CC 5IROC 5FHBL 2GK0B 4XN2A 1FI8C 4JDZB 5D7JA 3EH5B 5D7JD 2C5DC 2B3RA 3ZDXE 5ABZA 1UWFA 3PDGA 5M95B 2V9UA 1WWWX 2JLPA 3WY4A 1NCDH 2BLFA 3OR6A 7FABH 1C5CH 4AQZA 2EE6A 5AZUA 4Y9GA 2ZWSA 4PBDA 2A6KB 3QDJD 3VFTB 3D0VA 5LQBH 5TF1H 1UT9A 3G5YB 4O2CB 2J6EL 5J6GB 2IVFC 2MZ8A 1CF8L 2AJZA 5DWUL 4KMTH 3SQOH 1H6UA 4ONOA 1UD8A 4HJUA 1P5DX 4YSEA 3FYIB 4OCXH 3NSCA 3DROB 1A4KB 3ZR5A 3QDAA 2JKWA 3FKUS 3QI9A 5A2FA 4NPJA 5HYJB 4WTZG 3FB7A 3DX9A 3D69B 3IBEA 1ZLVH 5JORA 3O41A 2N56A 1QFPA 5JDSA 4TTDD 3V9CA 3GHBL 3HCVB 2IH8A 1HSAB 1I9JL 1E7UA 2DQFA 1O75A 1UYWH 1IRAY 5HHNA 3WS3B 5I1DA 3CQFA 3FUMA 3HMWH 3U30C 4LLWB 1LO4H 2LVCA 5IYCP 5HGGS 1BD2A 4LL9A 4P4KD 4W1TA 5FO9A 1GW0A 4KJWD 2WO2B 3U1PA 1RZ7H 3T2PA 1U8LA 4DP8X 2YD5A 3PNWA 4IU2A 4R0LA 3SDAA 1TIUA 4QDGA 4YSRA 4OGXH 2WZ6A 5EU4B 3K71B 1YYLL 5DZOA 4OF0A 2YJQA 3C8HA 1I7RA 4KX9A 2BOBB 5CGYC 5KSUA 4BSWA 3QIBA 3OX8B 3SDDB 3ARQA 4RBPH 4CA4A 4JO4L 3CVHH 1NAMH 4KKLC 2XPZA 1WV7T 2R1XB 2WWNA 5ADPH 4HHAB 1F4WL 4WW2A 4BQ6A 1MG2C 1AD9B 5JW3L 4R7VA 4EEEA 4EIUA 1YN6A 5ISZB 3CK0H 4JG0L 1MCSA 4U1MA 1HZKA 1XIWB 5JIKA 3EGXB 3AADB 4U7SA 1SOXA 1NANI 1ZIAA 1OAYH 1SVCP 4YBQD 3LRSB 5I82A 2BS71 1YY8A 2I7SA 5EIQA 1GYCA 2JHJA 1AHKA 1I8KB 2ZT9C 5HJBA 1JS4A 3VSQA 3V4PH 4TTGA 5EULV 3VXSB 4B50A 5A6IA 1XBRA 4FMKA 5KS9F 1TQTA 1RZQA 2AAAA 4FXKA 1U3YA 3DXAA 4B95C 3QQ4A 1OVZA 4F7TB 2ZE0A 5GZOC 3RIFF 3VTTA 2WXRA 4G70B 1SJEB 2HN7A 5DHVB 1IAOB 4GUPB 4AKQA 4L4VA 3EGXA 4KTDH 4WWPA 4H8HA 3SCMC 3E6HB 2AQRA 4MQXC 1F1AA 5ISZA 5I6XC 1G4RA 2NY4B 5ISZD 2DEWX 1MPAL 2KL6A 3GI9L 4NKDB 1LWWA 1F4HA 1UXMA 4JRXD 2RH0A 1DQVA 3OG6B 1TQSA 4ICWA 1IGFH 3K5SA 2WQRA 3P0VH 1XDTT 2YFOA 2FECI 2NTFA 2XBTA 4G5ZL 4WKXA 3UTSE 4E41E 4UTCA 1JGUL 1JXDA 4WFFE 2H9GA 5DFVC 1XCXA 1VIWA 2QQLL 5HYQA 5EUOF 4PRAB 3DNKA 2D7NA 3MJWA 4Q6IA 4PW4A 2B8OT 3NGBC 2YRPA 4P2QD 1ZJBA 2HPOA 3MFGB 2VOTA 5FYLE 3CXDH 3L48A 4OCWL 2CPUA 1PY0A 2ITCB 4P07A 2Y2WA 3M17B 1JGIA 3H85A 1NL0H 4TSAH 2QADD 3ZZLA 5I5MA 3GXTA 4EIBA 5EZIH 4LAQH 3J27A 3FHQA 3TE5A 4POUB 3UADA 4AVJA 3OLPA 2ZCLH 1FNSL 3CC5B 2UYLA 5L2JA 4HJTA 2XSKA 3WEMA 2NPLX 1YA5A 3FULA 3DV6A 4ZNEA 3HAEG 1LQSR 1YPZA 2EO9A 5TK4A 1P2CA 2OSYA 4J2QA 4LLYB 4DF9A 2VDQL 4QAWA 3H6JA 5E23A 4QRUA 4WU5B 1CK0L 3JWOL 2FGTA 3MOBL 1A2YB 2QV2A 1Q9WA 2ZKWA 3BH8A 4MMYB 4WWKD 1HXKA 2A9AA 5F6IB 1MEXL 3FO1A 3HG1D 4M8QA 2ZQKA 5FO8B 1BXUA 4YBQC 1IU1A 1WWCA 3GIVB 3IE9A 4N2OA 5ABAA 3GMRA 4DZBA 1F90L 1TU2A 3MLTA 3SE6A 1MZYA 4LLWA 5KVEL 1H8SA 3AWGA 1E7VA 1QRND 4NRXA 1FL3B 5F9DC 4ONFH 1N6QH 2F8OA 1OP3K 1XGPB 1U8CB 5IP4A 1E8WA 1JF6A 2FE0A 2EIJB 2LW3A 1AISA 1BOGB 2WQWA 5CKGA 1UD2A 5IEKB 3V9FA 4N9GA 2GI7A 4X7CC 4PJ9C 3DIDA 3EOYG 5DZ9A 1QUNB 2DM4A 2M8XA 4AYMC 5D7LA 4BCXA 2GI0A 4OFYA 4HFUH 5A3IC 3MRJA 3GDBA 3RX7A 2QPUA 3GB7B 4XP9H 2YKLH 2E0PA 1GKEA 4MAYD 1SHXA 3DA0A 1CFVL 1QWHA 1R47A 3MRJB 1CMOA 5DUPL 1J86A 2EXSA 1XWVA 1GZHA 2NYYD 3VFTA 2BERA 3SDCB 3S3JA 5ADPL 3KH3A 1HEJC 2UY6B 2YQGA 3M46A 1KGCE 4P99A 3QUYD 1RI8A 5FGCB 3TJHC 1A66A 1GYUA 1NIFA 1Z7JA 4KKZA 1KTRL 5LGJA 5GGTL 1I8LA 1NUNB 1NA8A 3ATFA 2VZUA 4I18B 2DWXA 4WV1C 4F7KA 5D5ME 4OD2B 3UYPB 5DLML 1CICA 4PN6A 2RAMA 2K3TA 1SYVB 4J12A 3W57A 4L8CA 4G8GA 1L9MA 2C9XA 2EIMB 1LK3L 3QO0A 1OK8A 4Q9BA 4U1JB 4ZW7A 5JR1H 4YHPA 4H26B 1BBDH 1BJ8A 3AQDA 2A7BA 4LSDA 3H9SA 3SPHA 4POYA 2OOYA 3OXRA 1UQSA 4P2OA 1WGVA 3UP1A 3I6SA 4UV7L 3MLSL 2GIYA 3LMJL 3RB5A 2YD1A 5A16B 1F6FB 3FT0A 2AV1A 2I60H 2XIDA 3OLIA 5FYLD 4FX5A 2ZP8A 3DOSB 1Q8MA 1OAYL 1YEDB 1BVNT 4RMSA 3VXRA 1MRCH 1QOKA 3PQYA 4EXKA 1OM9A 2V0AA 4RWYH 3T1FB 3L3OA 4MDIB 5BO1L 4ZFOA 4X6DA 2ICEC 2VISA 1TITA 1FDLH 3IDJA 1DDHA 4H40A 5L6YH 1QR1B 2GUYA 2J56A 4J3OC 1GKOA 1VFAB 4ZK8A 1AGEA 8FABA 2D31A 4ZUTA 4WUKL 1AYRA 4I3SL 3HS0A 4Y19D 3L4CA 3BSZH 1DQKA 3FL7A 1IILE 3QPQD 2AV7B 3J2PA 3DSNB 4JM2F 4Y2DA 5EU6A 3NA4A 1KCKA 4W68A 4ABVA 4QLWA 1XSJA 4FI7A 3T77B 3IVKA 4PYGA 4F7CA 5HVWA 3IFLH 2Z35B 4HZLA 3QJFB 4DZ8B 4ZTOH 2Y7OA 1QPKA 4JFEE 1RIVL 3TBSB 1PCSA 3D25A 4OAWB 2UY7A 4YHYB 2DMBA 1KDIA 3RWCB 1QATA 4RGNC 4P5KB 1INDH 4F2EA 1I85A 4ESKA 2Y36H 1ZA6B 4GUOA 4BWTA 3LNIA 3H4HA 3S3DB 3WL9B 1L4IA 1YZZA 5F7DA 1P5UC 2PW2B 4HKBA 1ORSA 2Z92A 4BFRA 1U2HA 4FCHA 5I8EA 1RMFL 4XPHL 4FFZH 3X1GA 3V6OC 1IQDA 3NRQA 2ADIA 2H8PA 4JDEB 4UF7C 1F00I 2CXGA 1P7BA 3IDIB 4GIPD 1L9QA 1HJCA 2QDVA 3IU3B 3BGMA 3L3DB 3MNVB 4NNPL 5DJDA 4PVBA 4I18C 4WV1B 2QQQA 5I6NA 1A0QH 1FO0B 3BPOC 1E6OL 2DOCA 4OCLC 4FTDA 5EO9B 2HVJB 2QTEA 2EIDA 4XPFL 4X4YA 5IUSA 1II4E 4Y1AE 4NPYA 3OF6D 1ZVSA 2GIMA 5ESQB 4BXSV 4FKHA 4M1DH 5DJ6B 1VGKA 2D7TL 1KJVB 2DJMA 5GRYA 3MLYL 3M45A 4YFEA 4K4KA 5DHYA 3CDZB 1QX1A 1LDPL 2AJ3B 3EIFA 5C2UB 4QRAA 1DQDH 5CWSA 1ZVYA 3GM8A 4IGBB 3WNKA 2QV4A 4D0CB 1RUMH 4IJ3C 1QW8A 3WO3B 1QN6A 3T0EA 1HINH 4ZJ9A 2OR7A 3BEVB 3NABH 4WI4A 4GRLB 4AG4H 2HWZL 3QNZB 1E9OA 4N1EA 4RMWA 1UEYA 1NGPL 3EFDH 1VLXA 2ZWZA 3RKDD 1MHPL 4AL8H 3TLRA 5K9OA 1CE6A 1SNRA 1E9PA 1W8OA 3LEYL 4XC3H 3HBPA 3VYPA 1N2RB 3VXNA 5TFSH 5KJRL 5L7XL 3RWIB 2OPCA 4NCC2 1H3WM 2LGNA 3CH1B 2YO3A 1F1DA 1TR7A 3L3IB 4UILH 4S1DD 5A2KH 1BAFL 1LP9A 3IJ7A 2EIEA 1WAEA 4A2HA 2QGDA 2XZAL 1WH0A 2PCPB 2XTJB 3ES6B 3GC3A 1YN7B 4C83B 2VDLB 3FW6A 5LBSA 3GMOA 4QRQB 1SXAA 3WU1A 1KN2L 2LT9A 5EU6D 3OJDB 4JVPA 3LKOB 5DC2A 1K8IB 3WE6A 2OQJB 3I9IA 4NHCH 5JMOC 3FH8A 3VACA 3M8OL 1HYSC 1AQKH 3H42H 2LLNA 4KJQC 4B97A 1P1VA 4TUKL 2A74C 4YAQA 3WNNA 3C08H 3RL1B 3MA7A 2EXWD 3KLLA 6FABL 3CSPA 1ET7A 32C2B 4JCWA 2ROYA 1ZCRA 3DTUB 1JHTB 1V05A 3INOA 4CBZA 3G5YA 1BQUA 2K45A 5EOTA 3B3BA 4K15A 3VGDA 1D6VL 2CO6B 5F7KC 2XPGB 1U6AH 5CIPH 1HE8A 3IFPB 7TAAA 1T6AA 1JZHA 1BIIB 2CUAA 3DSFH 3IDJB 4NDMA 3PNRB 4PLKD 5JUEH 4AEFA 3SZ6A 1XZWA 4PVLA 3BLKA 1K8DA 2YRBA 1K2DB 1KBKA 4D8PB 1HOCB 1V3JA 4W4NA 2OMUB 3QFJA 5B39B 4R9HA 4Z7VA 2ZAHA 2PO6A 1IQWL 1YHPA 4OR1A 3P40A 3UCQA 2FT8A 3DUSA 5GRXG 1ACCA 2EVFA 5ANME 1A14H 3AZUA 4QXUL 1R19A 8CGTA 3WEOA 1Q72L 4HBCL 4A7GA 1B4JL 2CHNA 4PY7B 1IC5L 5JXAH 3T65B 4G8FB 2GSMB 5TDPA 5D1ZI 3O6LL 2GQHA 3W39A 2AJUL 4AG4L 3L1GA 4OI7A 3MRDB 3BFWA 3NCCB 2QBWA 2ZF8A 2FO1A 4IIQC 4QXTA 3P9WB 4WSKA 2VIRA 5CEZL 2QR0A 1Q0XH 2IPUK 1F6LL 3V79C 2GSIB 4ZZKA 4U7MA 4OZIB 4I18A 5CLYA 4LNRA 4PS4L 5HGDB 1MCBA 2X0WA 1UH3A 5LGJB 2DEXX 1JSYA 3FDWA 2X7LB 4TL5A 2G75B 1CBVL 3K2UL 3GRBA 4E9SA 3FZUC 4H1LH 1Q94A 1A7BA 1OCWH 3WKMH 5E1AB 5BVPL 2VUOA 5JPMA 2YGPA 1EFXA 2Z8WC 2BSRA 3IK2A 43C9A 1OQXA 1RZKL 1I8LC 1JTOA 2OR9L 3P9LA 1FVCB 2BP8B 4IK6A 4MYPA 3S48A 3X1NA 1BFOB 1CDGA 3QNXB 2CGZA 3KJ4B 4P2AA 5TQ0L 1E50A 2IFFH 3MVSA 1I4FB 1HQRA 3KPMA 3N91A 4ZSOA 2PR4L 4PJ7A 1P2CB 5C7XH 1TJIL 1KPUB 1KBWA 3CXHJ 4WY7H 2J55A 3DHPA 5TE7L 2HLFD 2IDUA 1QG3A 3V2AR 4EI0A 5CJ5A 2HT2D 3MZTA 2BP3A 3ZRSA 3I75A 2VERN 2F7IA 3FBKA 2X0UA 5JXED 3N89A 1ERNA 2B39A 1P0SE 1N4XH 2VM3A 4R4BB 1M6OA 2CGRH 3O8XA 2DKUA 4H25B 1FHGA 2VXSH 1N2RA 3HKFA 5E08H 4QJ5B 2WYIA 2DY2A 1YSOA 4CADA 3TPUB 2VE6A 3D4YA 1MHEA 1KFGA 3CTTA 1KLUA 4EIGB 4Z3GA 1VADA 3ECUA 5B8CA 1LYQA 3FTYA 5EU3B 3U30B 1WT5C 5HYIA 5KTEH 3ESMA 1F1GA 4J4PD 5AW1B 5IVXE 1MWOA 1ET5A 3EO1A 3VD0A 2OTWB 4PWJA 2FX7L 1Z9MA 3IMRA 3IJEB 1IC4L 5HI5C 3V5DA 2BSSA 2VDKL 2GSIA 2OP4H 3JZ7A 1RXLA 3PGFH 1R3LA 4FOMA 4LZKA 4A6YA 4XOCA 1SN2A 1OAKL 4CNIB 1E8ZA 2G2RB 2W9DL 5EA0L 2O5XL 4OI8A 2QMKA 3B9VA 2H1LM 3IKCB 3K8KA 1T3FB 3KS0J 4H4NA 2QGBA 2MNJB 2WINB 2FUVA 5HY9A 1KIRB 3B7UX 2FIKA 2KLSA 3GT6A 4P2OD 1M05A 2E5EA 2P48B 5DD1H 2FBOJ 2BIIA 3FT4A 1BBDL 3ARZA 3BAYA 4DKEH 2DMCA 3N42F 1IAIM 1SEBA 4QRRB 4S0TD 4OLVL 1BVNP 2FNBA 5HPMB 2D0AA 1PBYA 3OZLA 2EDRA 4HKZB 3FQ4A 3WNMA 5HY9B 2ZXAA 1G0YR 4FZ8L 1T1YB 2APFA 2D7OA 2LU3A 4MNHB 3FS9A 5DVMA 1NCGA 2V2XA 4IOSA 2BFVL 4V33A 1BF5A 3MRGB 1NCJA 4AOFA 4Z5RB 1OGPA 4MDJA 4E9QA 5EOTB 4ELMA 5ELIA 1EHAA 2W9LA 2UY7B 4CGUB 2V2XB 3MV9A 5DWUH 4ZMVA 1JD9A 1ONQB 1IAOA 2C3XA 5ID1A 5KZCD 2FX8H 4FQ1H 3CBJB 4WW1A 4S0HA 1F4XH 2R56L 1QSFA 5L6YL 5HPMA 2B1HL 3V0JA 2GUOB 5AEAA 1SUHA 2R1YA 2IPTL 4DAGH 1V5JA 1OLZA 1W16A 1OTUD 2A1WL 2Y7QB 4GAAA 4MBRA 4Z95L 5KBPA 5D7HA 5K59F 1HH9B 1G9NH 1J12A 1DL7L 1QSZA 1PIGA 5CCKH 3QG6A 2JQAA 3LIZA 3U1SH 1VZIA 3KPOB 1ZLWH 5EOQH 4M43L 1HCYA 1VPOL 4GG8B 4HSCX 3OPZH 3CMOL 5T1DH 1TTFA 2WCSA 3CH1A 1WJWA 1GPOH 2CJUH 3EDEA 4URTB 3A4DA 4UNIA 2CO1A 3QA3B 4G7VH 2BW4A 4LBAA 2FWSA 4NYLB 1KB5H 1LO0L 3O2VH 2D0CA 1A6AA 1GCYA 1YO4A 1AXSB 3QQXA 1ADWA 1SLWA 2IWEA 3NN8A 3TC9A 2XG5A 2AJUH 3KPSA 5AZEL 3D69A 4HUNB 1G6RA 3HR5B 5EIVA 1Y07A 1JXKA 2BP0B 3VG0L 1B2WH 4NN6B 1U30A 4IGBA 1OAQH 2BOBA 3LNHA 3MAWA 4KHTL 1GAFL 2F74A 3HJEA 3GSOA 1RLBA 1J05B 5DMIH 4FNLL 4IRSA 1WFTA 1ZHBB 3ET9F 4P2RB 3ML8A 3P9LB 1NFDB 4MNQD 4F5CE 1BXVA 3QAZB 2NX5D 2BM3A 4KKQA 4FNPA 4PP2B 2FEEI 5K39B 4JRFA 3AG1B 1YY9C 2EDEA 5IEHA 5DQ9A 4OD1L 1AKPA 4UWQB 3WS3A 1B9ZA 2G75A 4HWNA 2NNAB 4XHQA 3OC5A 1OWRM 2XA8L 4LMQI 2XN0A 1KLFB 3TTYA 4JDZA 4F8PA 5D96B 3V0WH 1VENA 1N39A 3QUXB 3D39A 2LU5A 4JDTH 3ROOB 1J11A 3FU6A 2VDRH 4Y4HC 2O3OA 5DT1H 3ALWA 1I1AC 1OARL 4P5TB 5E2WL 2C9SA 5IHUL 4J6RL 3KWVA 4CC1A 3G04B 1KENL 4ZXBA 4GQPH 3PQYD 5DVKA 4ZD3L 1CLYH 2VLRA 4IMLA 1VFBB 5SWZA 3ULXA 1M9WA 3MJ9L 3PWPA 4KK5D 4CSTA 1NC2A 3WKQA 1KACB 3MV9D 4IRJA 4OFKA 1QEWA 4Z95H 5DGQA 3F7VB 3FO0H 5BMFH 2CJSA 2Q86B 3HA0A 3TBSA 2NY6C 1FH2A 3R4RA 3KXFD 1JHKL 2EZ0D 4ODVL 4UZUA 3CVDA 4GP8B 3T09A 3IPBA 2X7LA 1S5IL 3TBBA 1RKRA 3PAVA 4CC0A 1L9SA 3CZLA 4LQ1A 4P9HH 4X98A 4FFWD 1XSZA 3QGVA 4YDIH 4CUCA 1I3GL 2NOFA 4QTIH 4IRSD 2H32B 2W0FB 3BO8A 1J1PH 3VTAA 3L4WA 3O2WH 4XZUA 4OTXH 3HUJA 2P5EB 5EZLB 5FC9A 1YEGL 1CFNA 3GK8H 4G7VL 3TVMD 4NLAA 4L5FE 2I26N 4BGDA 3FFCA 3PWLA 3EDJA 4X4MA 4RRPG 1X5MA 2XZQH 4JG5A 2VISB 3BWZA 3US1A 5A43C 1EGJH 1WTLA 3GBNH 1UUSA 2VR3A 4PY7A 1OSEA 3IBOA 4FZEH 4KTEL 5ENWB 4R3SA 2ZKYA 2CR3A 3E2HC 2X2YA 3UTQA 3F8UB 3VX1A 1U93A 3EYUL 3U4EB 4HIIA 1R3HA 4KRPB 2NXYC 3O2DH 3HE7A 4MXWL 3KPSE 5HYFA 3WN5B 2G2PA 3P3TA 1MY7A 2VZ3A 3EH2A 1QTSA 4OGQC 4FXGA 2ATPB 3F04A 3L2MA 4WWKA 5LAXB 2N0KA 4JFFB 3IN0A 4I3RH 3HVDA 3P3UA 4IOIA 2GJRA 4B9PA 3J07A 2J2ZB 4Z8FH 4JRXA 3KEHA 4TQIA 4D9RD 1OAXL 2CCLA 5DD3H 2B59B 3FH7A 4I8DA 5E2UL 5C0AA 4BK5A 4JUSA 4YHIB 3V10A 1PQZB 2FLBT 5LNDA 3MTXA 4YHLH 2XXCB 4GS7B 4FABH 3CDCA 5CS7A 3D52A 4P49A 1T04A 1B4JH 1VZHA 2ICEB 1T21B 3C8DA 4LCCC 2DKMA 3OM3B 3V4UL 1VPOH 4HIQA 4HMEA 2R0ZH 2RALA 5T8IA 4JKMA 4U2YA 2X70B 2PETA 1NEZA 1INEL 4WO4A 2Z4TA 4PRPA 5L8KB 1TT6A 2EEFA 2IO5A 2DQHL 5F88B 4RAVA 3WBDA 3BIKB 5AKTA 4N3UA 4R4FH 3U9PL 4F2ME 1YNTB 3DECA 3FFOA 2IPTH 4DAGL 1NOAA 3PG2A 2E6JA 4JE4B 2UV3A 2B9AA 1ZVSB 3RZCD 1CXIA 4XB7A 3RPIA 5GZOA 1KELH 3SQBA 1X5IA 2V6HA 3I6LD 4EAEA 4F7TA 5D7LB 4XOBA 4OCWH 4OF6A 4LXFA 4MD0A 2W91A 3OKLB 2NOYA 4XBGA 3VFMB 2KH2B 2UUDH 3RVTD 3U46B 4DWHA 2BNRA 4WV1A 4PRHE 1CO1A 1A64A 4ZW3A 3BDYH 4HEPG 2VJ0A 5AVQB 3G5XB 3X1FA 3KLHC 5KEZA 3V5KA 4APXB 5SV4A 3U4BL 1QA9B 3GMQB 3M7FB 4GAFB 2YPLE 4G11A 5HDBE 2Q76B 3MLZH 5D71H 4DEUA 5B38B 3QEQA 1ADQH 1IGJB 1YCSA 3EUUA 4PRHD 3JZYA 3QUZA 2CBQA 3RPIB 4CN4A 3B2VH 4XGZA 1CL7L 1ZTXH 4DEPC 4NBXB 5TDOA 4H0GA 3F05A 2O61A 1Y6MR 3SGJA 4WI9A 1LM8V 3I02B 6PCYA 3GSNH 3QYNA 4U33A 2Y06L 4YDNA 5T1MB 3WELA 2DD8H 2QTVA 1H3VA 3SDDC 5JQ6H 4NENB 4QHKI 1UZGA 4FQXD 4PRPB 2JKXA 1IZKA 1T5WA 1N0LB 5FUZL 1KBGL 2PUQT 4HZLB 4YLQT 3FU5A 1H5BB 1A7OH 4S1SL 2WVVA 2C7FA 2CH8A 3GMNB 3A24A 1HCVA 2ICEA 3ZDZE 1KTLB 3FT3A 3SOBL 4KJPC 2K8MA 2R29H 1XF4B 4NRZB 1QRNB 2W59A 2E74C 2DQIL 3ETBJ 4F80A 4F37F 4ZOCA 3ARGC 3QHFH 3ETSA 3I50L 5DO8A 2BDNH 4ZOAA 4A2LA 4OZFB 3NG5A 1T80A 2R0KL 5IREA 3MACL 1MQKL 3W3BA 3C8KA 3VXMB 3VXUA 2XNAB 2G4GA 4FNUA 1U33A 1KGUA 3K2MC 4YS4A 4QHNB 4XMVA 4ODXB 3KVDD 3RWCA 2XN1A 2P8LB 4JREB 3R06A 5AYQA 4LCIH 2YMXH 4PWFA 3L1OH 2F1EA 4Y4KA 4G6ML 4H1LA 3OMIB 4L3CA 1TDQA 2K6YA 1FGNH 4L8SA 1XH1A 4PJ7E 3SYCA 3T77A 1I85C 3QNXA 3IVKB 2HH0L 2C7UB 5BRZB 1ED3B 2QSVA 4XO8A 4P3WA 1M4KA 4A55A 2XOTA 3DO7B 1U8JB 1TXKA 4GRWH 4YHPB 4E9TA 3QRBA 5DMGC 2LAAA 4N26A 2RMNA 1XMEB 3HFML 2HLEB 2HN7B 4TNVF 5HSFA 2OZNA 3B34A 2ZTBA 4RMTA 3BPCB 4Z0XB 3CHXA 3SBPA 2BVOA 5ICYB 3L3OB 3QQ4B 1GGYA 4RNRB 2EVIA 3KPNB 1MF2L 1B90A 1GGIH 1NC4D 1W15A 5D93C 2ZSVA 2CIKA 3JV4A 2QEJA 3Q8EA 5IGXL 1U8NA 3UTTA 4OM1L 3TOPA 1GYAA 3VE0B 3KD4A 4ATWA 2ESVE 1ETA1 1WEJL 4LGRB 1WUZA 4FKEA 5IQ7H 1NAMB 5KBKA 3UROR 1T22B 4X99B 1K85A 4HWZA 3BZ5A 3HR6A 4KKLD 1S78C 5HJ3A 3V4UH 5LHDA 2WVTA 4WWKC 1QR4A 1HS6A 2FQEA 5C1MB 3US9A 3N41B 2H6PB 4N0FA 2F0CA 4BFFA 4KVNH 2ZUTA 3II2A 2R8SH 4PGCB 1SY6L 4L2YA 3MRFB 4XNZB 3H7BA 4QGYA 2PF6A 5B1CA 4X7SH 4M00A 1F02I 3TBTB 3ISWA 4NXSA 4L1TA 5DDHA 4I0KA 4GSXA 1Q0EA 3WFBH 4AGOA 3LHPL 2WBWB 1XGPA 5AVRB 3MXVH 15C8L 4OZHB 4EN3D 2Z6FA 2IAAC 4AJVA 2X3AA 3SZKC 4G8IA 1UH4A 4HT1H 2WUCH 2CCVA 4ORGB 3WENA 4RQQB 3VXUE 4QOKA 2HL9A 1P7QD 4MA8L 1RUML 2F54E 4X4KA 4ODHL 4YVUA 3IJHB 3V6FB 4B9IA 1Y0LB 4PV8A 3IDNA 1BQRA 5KYXA 1LQBC 2P1YA 4B96A 1XR9B 5GS2H 2PN5A 2VM4A 2WQXA 2DTMH 1LWHA 5C0CB 2Z4QB 4AT6A 2OOXA 4WU5A 1UG9A 5KJRH 1DQIA 4BHUI 3V0EA 3TJEH 1CDYA 1OB0A 5KSAC 2DQCL 2YD3A 1YPZB 4TLKA 2CHDA 1JZ5A 3D9AL 1AKJA 1QNEA 1GZPA 2AXGA 4YWGL 1WFNA 3CFKB 5FKAA 4K5OA 1ZLWK 5B3NA 1CWVA 1BWMA 2KYIA 4W9LC 2F9BT 2P80D 2ITDA 2OMXB 3S8GB 5IYBP 4J8RA 4Y5YB 4HLJA 4F8QA 12E8H 4FEIA 3M8OH 3MV9E 5JLZA 3G6DL 3O9WC 3I3WA 4U1HA 1XX9C 1PW3A 2ARJB 2YD9A 2ETWA 1GGIL 1WBZA 2X4TB 3B1UA 3FB8B 3ME0B 5D71L 1E9PB 5J56B 4XX1G 4TUUA 5CKAA 2C9QA 3OBAA 3PWPD 1AACA 1A9BB 3W0WA 3BP7A 4HU8A 5ISZE 5KSVA 1G7IA 3MJ6A 3ZOAA 3F0ZA 5LXGH 1FZOA 2HJKB 4G8EA 4ELKA 1R5IB 2G3ZA 3HMXH 1UFGA 2Y7QA 4ZFZB 1R5WA 1QI4A 5C6TL 3VW3H 4X9BA 1U8HA 1X7TA 2VXVH 4K9EH 3ZKNC 4CGTA 5I1HH 2CMRL 4KK9D 1CQKA 3TFKD 1EFXD 4Y8AA 4IGBD 1P7KB 3CC5A 4Y2OA 1P5UA 1CDWA 2EDJA 5FUCE 3UMTA 2XWXA 4V2BA 1NEUA 1MVUB 1ETZB 4MJ5B 1JFHA 3PRZA 1LTXA 1EAOA 3D1MC 3Q43A 1KCWA 3ZYJA 4BH7A 4FEMA 4RCAA 3RTQC 1A4JA 4PJ7F 2P42B 4X8JA 2HH0H 1RULL 5BZDB 3VGAB 5AQ0A 1UXSA 2CHXA 4PRNB 4HW6A 4PWHA 5IB5A 5D72L 1I7TB 5L8LB 3IN2A 2WXHA 5EOCH 2ATAA 5E2VH 1F3JB 4ANVA 4TM9A 3B9AA 1E4XH 2NY2D 4FMVA 5LGYA 2ADYA 2OMUA 3NK4A 2VXQH 3QFJB 4ZMXA 4HG4K 4PG9B 5B39A 5I1IH 1HQ4B 3TGXA 1QBMH 2GW5A 3GSXA 1RJLA 3N55A 4FFWC 3SE3A 4FYRA 2C4FU 3TIEA 4ECNA 3RJQB 1MIMH 4MJ6B 4NQCE 4C54A 2EDNA 1F58H 4UIKL 2XG4B 4JHBA 4D7BA 1S7WA 3MBEC 4G6MH 4N2LA 2PTTA 3U4KA 5I1AA 2DI8A 1CTMA 1CFTB 5C0CE 1WBXA 1KGXA 3BPNB 3RWJA 3VXQB 5E1QA 5IOPB 1E65A 4PJXE 3E9UA 1JUFB 2VLRE 9PCYA 3GMMA 5FECB 3HPLA 4OCXL 2FRGP 1UZ6E 5CD5D 4KZEL 4S1RH 1I3RB 2NZ9D 4HZ1A 4Q9QL 4E0RA 2GBVA 4I3RL 5CHNA 3QQDA 2B20A 2VTFA 3QJVB 5CBEA 3VWKC 5C6WH 3QIBB 4ALAC 2YQ2A 3EYOB 3DSNA 2H1PL 4G1EB 1AC0A 7FABL 1VADB 2IXQA 3FF8A 2WZPA 1SJMA 5DLLA 1YY8B 5G4NA 4EZJA 4NQSB 4PJ8C 1RY7B 4DGVL 5IW6A 1QFWH 2H4LX 4NUGH 5GGRA 4HA1A 5DUJA 4TQEL 4UV4L 1SFDA 1T1ZB 4MCNA 1INEH 4W9GC 1W6LA 3DGCR 4K5MA 5E1IA 3KYOB 3CFEB 2V17L 1M7DA 5SWQA 2JFCA 3BFOA 1MPAH 3ARGA 1GC1C 1UD5A 5TTRA 3QZPA 3GUTA 1E9OB 1PAZA 4B9CA 5CFAA 3NA9H 3C5JB 1C8PA 1JXFA 3G5VB 5DUBB 3S2CA 3SDXB 4JN2B 4QWWC 1BLNB 4BFEA 2JH2A 3NSDA 3MLXH 3FPYA 3ZKXB 3QUGA 1BGXH 3FSOA 3L13A 4DUVA 5G5DB 4GEJA 3VFRB 3QO0B 2PWGA 1OAUH 1TOXA 4KQ4H 4A6YL 1SN5A 2VH5H 3KWWA 3CFNA 4NZFA 3H1ZA 3MREB 3U4BH 4Q9CA 5KVFH 2XZCH 1TLKA 2FL5B 2W95A 1MDTA 4OZHF 5EUOE 3BUYA 5EF0A 2WXNA 1AD0B 4RVBA 1Z9PA 2VSDA 5CGBA 5CN1A 4F8TA 1O5DT 4TSBH 4MB4A 1QZ1A 3VGEA 5GS0C 2Y8LA 5J12C 4AIZB 3QSKB 4L3EE 1I9IL 5KVEE 3GNML 1KB5A 1X9RA 4WI5A 1X44A 4W81A 3IRCA 1AZCA 1KN4H 3TJHD 4JKNA 2K70A 4JJHA 1GHFL 3MNWB 2CBTA 4ZG1A 1A65A 2D8KA 2HKFL 3B9EA 4NM4L 2K1MA 2EACA 4OZFH 1N12A 2W07A 2YZ1A 3U6RA 3DKHA 4NFBA 4ZAKD 1AR1D 1PZ5B 3EF7A 4FD0A 2VDOL 1E5UI 4M1CC 3S5LB 4XMPH 5I1CL 4QG5A 2IALB 3TIDB 2X70A 5KS9E 1I7UA 3QS3A 1WHOA 1ZTXE 4ZX5A 1EHLL 3ZDZB 1TJXA 2JK5B 4G1MB 2XWTB 1T04B 1TNMA 1H9VA 5JHMA 3C6SB 1TU2B 3BUBA 3FHAA 3Q0HA 2FLRT 4WFEE 1U3NA 2MFNA 2KERA 4O9HH 4WWOA 4XRCA 2B59A 4U6TA 4XOEA 4NC2B 3WEXB 3H6AA 2R7EB 4XPGL 1O6SB 1JZ2A 3D0LB 5FM5O 3QQ9D 4IOIB 2OP4L 1NGZA 3DX7A 3K1DA 3SJVB 5DR5H 5DRNB 2NY0D 3DRQA 2DBLH 3OKYA 4NOBA 4IW4C 4N8CL 1NKRA 4CVUA 3M6DA 3RWHA 1XB6A 4ADIA 1HI6B 4ZUWB 4YFLF 1U92B 2YPLB 2DQEH 1B0GA 2GTWB 5HDBB 3G08A 5DEGA 4YE4H 5F9WB 1NL0L 2R59A 2C9VA 3M1CA 4RMQA 1HC1A 2NOIA 1AOZA 3O8XD 4KJYA 4ZXBD 3NAAL 3ZKXC 4JPKL 1L0YA 3COOA 3K0YA 4RSYA 1IGCL 1PY9A 2XY2A 3CV5A 4M4RA 5DTFB 2Y23A 4KZEH 3ARFB 3TJPA 1INQA 5JW4M 4AV5A 2EDFA 5C92A 1UACL 3ECWA 5HD8D 4QEGA 4C4KT 2R7EA 3BKCL 4I89A 4JO3H 5T1LB 1KGYE 1F90H 2W38A 3QC5X 4ZOBA 2GBTA 4RFNB 3VXNB 3W11D 4N28A 4EZMA 4Z7IA 3N1QC 2H9GB 3WAKA 3BKML 3WXVL 3JWNC 1TEYA 4Z7NE 1LILA 4MB1A 5CJBA 1EDQA 5I1GH 1QFWL 4B9FA 2V9RA 2Q3ZA 5D7SL 1MOEA 5CMAB 3UTZB 4YJZL 2LR4A 2DF3A 4AVIA 2GBUA 1LE5B 1P4LA 3L9YA 3A6CL 4ODUA 2EIBA 3GO1L 5ERWB 4JANA 1HU0A 4NZTH 1JHKH 3KYNB 3S2AA 3O3EB 5A2IH 1G9NL 1BG1A 4X6BB 1F4YH 4WJ5A 3D4CA 3MRCB 2YPVA 2OKMA 3G04A 3O9WD 4P9HL 3VXTA 2VDRL 2Y7SA 4NO5B 4RDQF 5E5LA 1QUPA 25C8H 5IMLB 4WEUD 1QNBA 4OIAA 3QDJA 3QJHA 2W1NA 5I26A 1M7UA 3QZNA 1FNEA 3IU3A 4YXHL 4PJ8D 1DVFD 2K6WA 2ZYIA 4N2DA 5ADOH 1FZMB 1RK0A 3X12B 4HP5A 5TJWK 2R0WH 4PJIE 2XV2A 3O2VL 4LVOB 3T3MB 3UJJL 2R4SL 4U1GB 2EP6A 3EYVB 3GKWL 4GMTH 4AJWA 4AQ1C 4UOQA 2OJEA 4B6ZA 3MLTB 3TVMA 1FP5A 3LN5B 4DW2L 4ZX4A 5J8OA 4P0DA 1YN6B 2E47A 4FP8L 5ITFA 1DBBH 1BFVL 4YDJB 5JHLH 4NKMB 1R17A 1G87A 3CFJB 1E3ZA 4PVMA 4ZUSB 2Y1YA 3ZU8A 1U2YA 3BUQA 2KT6A 1P69B 3UEZA 4X9IA 3P4LA 4G2AA 2WXPA 2F8IA 3AY2A 5GZND 3WLBB 3G6AA 2ALWA 4RGOL 2P5WE 4PJHE 4HQQL 4L1SA 3ECBA 4X6EA 2QSQA 5BV7L 1DJIA 3RVXC 1S5HB 2WWKO 1ES0A 1X7SA 3EGSB 4NT6A 3MV8B 1D3CA 1XQ4A 3NPZB 1G7HB 3UJTL 3CZNA 4JKPH 1OOWA 1MRFH 2R1WB 3RWFB 4JM2A 4DP1X 2NOEA 1AGEB 4OF5A 2GVYA 2C26A 4HHWA 1G0DA 3NH7H 4ZUVB 1ACYL 3CVCA 2F54A 4FHJA 3WI9A 3JTTB 1S78D 5A2AA 1UCTA 2IDCA 1QWNA 3T1FA 1NC4B 3MLYH 4F2FA 3TO4A 4PRAA 4N22A 3HC0B 3BSGA 4PJ8A 4P4KC 3ZYOA 1KYOK 3ULSB 4XMLL 1NVPA 1IKNC 2MMXA 2R1YB 4ZX6A 2J4WH 2X4NA 4N86A 4W9FC 5CBAB 1L6XA 1AY1L 5CR8A 4P9HC 5GGVY 2YGNA 3TH2T 1T7WA 4NUMA 3PGDB 2YD0A 2VB5A 5HBBA 3MODH 4KK9C 5L2KD 1CLOL 4OIIH 1A3LH 4R96A 2NNRA 4X7TB 4BH8B 2OMWB 4ZYKB 2WY3B 4NCDA 4HH9B 1MQ8A 1RZFL 5HJDA 2Q3XA 3OHXA 5F9AC 2FZ3A 1P7HL 1RVFL 1UM4H 2SEBB 2QSCH 1I1FA 2VSMB 3NCMA 1YEJH 3UABA 3LQZA 4NUPA 4DP2X 4K7PY 4PGDA 1BSIA 3T0DA 4JZNA 3RZWA 2Y36L 4NN7C 2XV3A 2X6VA 4Q4IA 1SQ2N 1IGML 5JOFB 3C6LA 3N85H 5EC1B 1KG0A 3OD3A 1L9TA 3BXNA 1TJGH 2ZG1A 3ENEA 3QUMH 2X6CA 4GPVA 2V7HA 5FKPB 2WIIB 2VXUL 3JTTA 5DJXB 2V8MA 3L2NA 5FO7B 2R23A 2VQTA 5I5RA 2XWJB 2ZXCA 5JOPE 1RPKA 2IC2A 4V11A 1XCTB 2G2RA 1ETZA 5CZKA 3TO4D 4F7EB 5I6XB 1U3HB 1A7OL 3CZSA 4CKVX 3U82B 5CEXB 4XMWA 43CAA 1M7XA 5C8JA 4G6KL 5IEKA 1E90A 5FYKH 3CXFA 1PLGH 4AJ0A 5K9JH 1BZ7A 1UB6A 2AW2A 3ABKB 4JGUA 2YN5A 4BWWA 1KBPA 3FT2B 3T6QC 2C4XA 3O3AA 2C9UA 2VMFA 4IKKA 4Z3HA 3GSNL 2Q9OA 1GZQB 1HHIA 1I1CA 2ILLA 4PS8A 4ZPTA 2F15A 5ETUB 1H3GA 5DQDL 1QI5A 1M71B 4LGPB 4X5WA 2DL2A 2HKHL 4N8UA 4M1DL 2ARJA 4OGZA 4HS8H 1N67A 4I77L 5L8JB 3TNMB 2B7DT 1U8KB 1R3IL 1U95A 3BD5A 4HULB 3IU4H 5LN4A 2ADGB 1EEYB 1E4KC 1HCFX 4ETQA 3VRIA 5IB4A 3PWNB 4N5ED 4MD5A 1CIUA 1J5OL 2DQFB 2CHWA 4YGVA 3BH9A 3HCVA 4IEFA 4U6YA 2HWZH 1F4YL 3UP6A 4MBOA 4RDQG 3CIQA 3X12A 4BK5C 2KC0A 3MRKA 2D7PA 4EKXA 2VN4A 5HPOA 4H20H 4EDXA 4XMTA 1B3JA 1YPZF 4PJ5A 2ED7A 5FHBH 3QDJB 1JNJA 1DUYA 4N5EC 1UUNA 1M1SA 5DVOA 4KKCD 3L3KA 4N2GA 5C09A 2D03L 5E00A 3T4YA 3OSKA 4BFBD 1CVSC 1VACB 4ZDHB 3VXTB 1Q9KB 1T5KA 3HC2A 2WIMA 4IHBA 5E5MB 3GSNB 4B41A 1QN8A 4UIMB 2FGZA 3PL6D 4JFWA 4FF9A 1G9HA 2X1XR 5TF1L 2EDQA 2XN9B 3QEQE 4HF5H 4U49A 3HFMH 3OR6B 2YXFA 1ADQL 5F7LB 1NDGB 3HLAB 1XH0A 4DN3H 1P4LB 3GIZH 5IHZB 4OZHA 2ITFA 4X80H 5CSZB 1VERA 1T4KB 4NQVB 4TUKH 5F1SA 1VJSA 4NS0A 3PHAA 2J21A 3PAYA 4WF7A 5K1JA 6CGTA 2QDWA 1NAKL 2A9NL 3SE9L 1HKFA 1OXYA 3CXHK 3DSFL 3H7BB 3EG9B 2M1KA 2OTUB 4Y5VC 3RZCC 2OMBA 3STZA 2CIIA 4J2XA 5MEPB 4YO0B 4LEOA 4LCYA 2C1PB 4GSRA 3UG4A 3TZVD 4Q89A 3FN0L 3RWGB 4DFIA 3ULUH 1SFHA 3AJ7A 1ZWIB 4X6CF 1IAKB 4IRZA 5JA9A 3LHPH 1EMTH 2R29L 3AWEA 3O4LB 5JIQA 2YEZB 1H3TA 3RGVC 4NKOB 1N59A 5ILTH 4TLTA 4HGMA 3HG1A 2OCFD 3TT1H 1T5XA 2WLNA 3ZT5A 2J5WA 1XSOA 3FRUA 4QXWA 1KV7A 3QDHA 2AQ1A 3D85D 1JNHA 3EBHA 3ARGD 1FJ1B 1CYWA 1T66D 4F57H 2YH5A 2X6UA 1A6WL 3Q2NA 5EPCA 4H7VA 4NNYB 5C09D 5KS9A 5KVGL 4AQ1B 2CQVA 1HIMH 1JVOA 1SY6H 3PIQA 2IAND 3N0PB 4PJ6A 3QCUH 4HFUL 2YEVB 1XIWD 1J5OH 1F45A 4Z7UF 1XIWA 3JVFC 3KXFB 5IHLB 2FQGA 3QORB 4YUEL 5HHVH 3OSTA 1JYWA 5I1KH 3RDTB 4N2FA 3RY4A 5CP7A 4IBLT 5E1GA 3TASA 1F5WA 3F7LA 4WUUD 5EDSA 1RK7A 4HYTB 1RUAL 3FFCE 4XNDA 3NAAH 4KVPA 2EH7L 3T8MA 3AT0A 4X9GA 3KCPA 1S7UB 4LOEA 1AGCB 2EKSB 5I8OL 1IC1A 3QUHA 5FB8A 1K2YX 5K9KA 1J7VR 1R46A 2OLDA 3B7SA 4HV8B 3VGFA 3ZL4H 5A7BA 1FZJB 2G3NA 1NFAA 2ED6A 4FLOA 3T1WA 3DPTA 5E9DA 4A37A 3FAWA 5I18L 2XTSA 3AAZA 1S7QA 1AOHA 3KM2A 1CLVA 4FFVC 4ROCB 1WRFA 4QJ4B 5I23A 2CDFA 4WO4D 3KLHD 1J0JA 2MJ7A 4JR9L 1PZ5A 3WKNA 3D3VB 2O1AA 4R0LB 2BRRL 3UTTE 3UXFA 3DTXA 5EORH 1LK3H 1G7QB 4U1SB 1CTNA 2AKRA 1E4WH 1X7QA 1YUHB 2DV6A 3BP4B 1NBYA 4R90L 3QJXA 4MKMA 2IGFL 4YZFE 2GB2A 4HIJA 2JXMB 2WXGA 4MRQA 1YNKL 3ARSA 5L4JA 4HKXA 4P23A 5ESVB 3RJDA 1NTDA 4GFXA 4ZO9A 2H45A 3HZYB 3L9RA 5DS8B 3RIAF 1QYGL 4EDXB 5IBLD 5JOEA 4JFPA 2R69H 1HHGB 1OO2A 3F7YA 3NK3A 4JFQA 3ZSSA 5AVSB 4OGYL 5D2LF 4MNQE 4ZQKA 3ENOC 3SCMD 2YD7A 3MRLA 5BXFA 2WPGA 3J7HA 1A7QH 3U9UB 5D1XD 2E75C 4D8OA 4A1RA 1DBAH 1CE1L 4K3JH 2EINB 2GYSA 3GZPA 2NWVA 2NY3B 2IANE 1NFDF 4LL1A 1PD6A 3OJVC 4XCFL 3HG3A 4PJGB 5EU7E 3ARBB 3C6EA 2AS5M 3TBYB 1CD0A 5MP6H 1NICA 1FN7A 1T2QH 1L0PA 4OZFG 3UJJH 5AW8B 5C0AE 2BVUA 4X4ZA 3NUKA 3HBQA 3WFEL 3REVA 4FG2A 2EABA 4M5ZL 3VI3B 1OP4A 1YVLA 3HVNA 3VH8A 1KB5L 1LO0H 2VMEA 5F70A 4OV5A 4FQQB 4O51B 2W65A 1I75A 2N1KA 3QO1B 4UB0H 2HT3C 5B22A 3E6FB 2P80A 2EICA 2OJZH 3T2LA 4NUJB 1XGRB 3SBQA 3DHMA 4QYAA 4I9WD 4V1DB 2AC0A 1ND0B 2HL8A 4NQCA 3WDHA 3LN4B 2QVFB 1XTLA 3GUFA 3SYPA 1GAFH 3ZO0A 5C07A 4IK7A 5C08D 1Q1JL 4HIEB 4OU3A 1G7LA 3A6OA 1UWXH 3VRLF 3WV0A 4ZMOA 4WI6A 5JW4Q 2ZX6A 3HEIB 2VL5B 2JCWA 4G7QB 5F0JB 3W2DL 2CRYA 1HSBA 3BIKA 1PEZA 2VLJB 3QHZL 4KITB 3T6XA 1DEEB 1T4WA 1KEML 2GJJA 4BA8A 3VWKA 2F54D 4HPYH 5EEUA 1KFQA 2XYCA 4UDTA 3MTRA 4G9FB 3U7YL 5CZVL 5C97A 2WXJA 5GZOD 3ZHFA 1RLWA 4QR7A 3CWSA 2WNXA 1BZDA 5AG8A 4R5VA 3VXOB 1ZDQA 2V7NB 4L37A 4JX0A 3KPLA 1I3RA 1OHZA 3U1SL 5ICZA 1NQBA 2KPNA 4ZFFA 1QNZL 2WHVA 4KRNA 5D96C 4AQ8A 4DUWA 1U8OB 1KENH 5EC2B 4PB9L 2BXZA 2YAEA 3QH3B 4FYSA 2Y3AA 4LLVA 3U0PA 3ULUF 1M3HA 3ESUF 2Y9RT 3Q9QA 5EV7A 3MOAL 1QP1A 1T20A 3QZWB 1UL7A 3RVWD 2AP2A 2XWRA 5IJKA 3D4GA 4F33A 2ZF9A 2YBRB 3U6XA 3MUUA 3ZTJH 1F2QA 3BKJH 3TIEB 3B8YA 5AYUL 5H2BA 3OHMB 1R3HB 4OUUA 4PQXA 1NLDL 2XIIA 1SOSA 3APDA 4P57A 4KOBA 1QVOB 5MP6L 2F53E 3CLWA 4M7LH 5E94A 3VYNA 5KVFL 3DVGA 2YMTA 1MRDH 4NP4H 1TO5A 1ROWA 3OPZL 2MIZA 3FQYA 4Y5YC 1PJ9A 5HHOE 1CFQB 3C09B 4Q6KA 3V0IA 2BMKA 3THMH 3TN0B 4G8GB 4QF1B 2GEEA 4YIQA 5E95B 1XB3A 2H47C 2YR3A 2H32A 2OCCB 2W0FA 2TRYA 4BKSC 4OD2A 3UC0L 1EJ6A 1KIUA 4U6XA 1I8MA 3G5WA 3WDIA 4UV7H 1FNGA 4NQEB 2Y07L 3S34H 3L45A 2IBZX 4NO0B 1GOHA 2C3GA 5IHWA 4HJ0D 5KYYB 1D3UA 4J3BA 2WQVA 3LNGA 2DW5A 4XCYA 4PMFA 1BIHA 4QUOA 3NJXA 1X5YA 3JSSA 4AYBA 1HZHL 1OE3A 3MQIA 2JJSC 1P6WA 4GMSH 4GW5B 4OCNC 2HA1A 2MTAA 3MYJB 2BJMH 2GT9B 5C0JB 1T7VA 3D51A 4YHMH 5JZ7C 4E2OA 3CZEA 3VGBA 4IMLB 1BW8A 1S7RA 3B5TA 3GMLA 1NEPA 3GMPB 4AZ8B 3AMLA 5E0QA 3RNKA 4P5TA 4Y19E 1DBAL 1NFIB 2AK4D 2GJPA 3G6JF 2VXQA 4JJ5B 4LHUG 1EXUB 5I0DA 4Z0BH 1RZ8B 2G5UA 4H8WC 2BP5M 4P59L 4B3VA 1N18A 2VSCA 5CM1A 3DIFB 1KLFA 4GLRH 4MZ3A 1YNKH 3OAYH 5IM7B 4XC1L 5F93C 4DN4L 3L5WA 2L7JA 1JWMB 3NPSC 3QDGE 4TVPH 3SPCA 1DJGA 1KIQB 3HZKB 5I76A 5HHPB 2MQCA 4WXAA 4ABQA 5IFHL 1WBYA 3B1TA 2FQDA 3EJUA 5SWSE 1EEYA 1G7MB 5H35A 3IDNB 5KYXB 4I8OA 2HT2C 3BLPX 4YDVB 3ZGIA 1NGQL 3TEUA 2NSMA 1TEGA 2WN2A 4J6IA 4PWGA 4HH8A 4P8QA 4Y9FA 1M71A 3BQUC 3VWJB 5GJSL 1JIBA 3WFHA 1HKLH 5CINL 3WNPA 5F7EL 5IT2L 1JWMA 3TA3A 3HI5H 4LLYA 4NN5C 2YEQA 5IBTH 4FQ2L 4JZJB 3SN6N 5IFAL 5J4MA 1I1AB 3KPQB 2F53A 3I3BA 2GJZA 4X6CA 1OANA 4XBEL 4I48A 3WIIL 1HWGB 1RFDH 3FQRA 3BRDA 1MFDL 5CSBA 1N3AA 3FT2A 1MY5A 4ZTOL 4JREC 3CDGA 5EN2B 1USQA 1E40A 4LSVL 3D06A 5C8JB 4MJIA 1OB1B 3IPFA 5IOKA 1IJNA 2VGLM 5GPRA 5CZVH 3U7YH 1F4WH 5IQNA 4RH4A 3UBGA 4MSWB 1XCTA 1BEYL 1UM5H 4TUJB 2P45B 2UUDK 1IGTA 2OR9H 3MV8E 3FRPA 1YDPA 3HE7D 3KPOA 3LKQA 2CD0A 2ENJA 1XB8A 4PVNA 1QKZL 3NFPA 4L9LA 1BWWA 1OTSC 1IM9B 3SQOL 6TAAA 1KN4L 4U1IB 2DYPA 2P5WB 4PJHB 4GRWB 3STLA 3VFNA 3OC3C 2D7QA 4IKNA 5JOFA 1XGZA 4F3FA 3MBED 5EF3A 4LGSB 5DJ0B 4JZOB 1B2YA 3L4ZA 3EJRA 4OZGE 3O6FD 5FW6A 1UM6H 1T03L 4JO3L 5HHOD 3QFGA 1XGTA 2OAAA 1T83C 3O6KH 4KQ3H 1DO5A 5KVGE 3MJ8B 3RLSA 3T2OA 3TESA 4HBQA 3KW7A 4J1UB 5J13B 1VEMA 2NT1A 3BZFA 4L3AA 4OCRL 3TT3L 2FR4B 3TT1L 3PV7A 4NAQA 4Y2DD 1FIGH 3ZO9A 4YIQB 4APQB 4PTTB 4K0OA 2H2SC 3CLFH 3NT0A 3WEAA 2VQ1A 4TL4A 2GIXA 3UZEA 4DERA 3IXAB 1ZKAA 4APQA 3KE0A 1UH2A 4MNHA 1E27A 3OKKA 3DVGB 5F71A 3N3EA 4IU3A 5KVDH 3KPPB 3NZUA 3GJFA 2QRCA 3UTPD 5BRZA 3RWEB 3SPGA 1CLZL 4M5TA 1QABA 1NLBL 3PAZA 1HINL 4HGWB 1CBJA 1YMMB 4TULL 3UIZA 4AENB 1LEIA 4HWBA 1AI1L 2NY0B 3O11A 1IC4H 3WNIA 1CU4L 2AI0H 3BKQX 5DXWA 4XVUC 4I88A 1RIHL 2E7LC 4MA3B 3SDXF 2HLFC 5FYKD 3ESNA 4ODXA 1A6PA 4UOJA 1JI2A 4L2LA 4FQLH 2HJLB 2AEQH 4L9LB 3CX5K 1RZ7L 2NW3B 1FYTE 3CK0L 3MRRB 3U0PB 2MH4A 5DUMH 4YBLC 5MI0C 3CPLB 4CJ1A 4M6MH 1JFQH 3BGFC 5AVYB 3UX9B 5I6OA 2Y5TA 4WI3A 2QQKH 1D6VH 4PIBA 4RGNB 5FX3A 4XNAA 3SCMB 4WW2B 5J57B 4PW9A 3BPOB 4IS6A 4XH2A 1G7HA 3MRIA 1XF4A 3VFOB 2XXFA 2OW7A 3BWSA 2AEOA 2BRRH 2MKLC 3S5ZA 3VU2A 5BNXD 4MJIE 1OKEA 2J1ZA 3EADA 5IZ7A 3OC8A 1SY6A 4R97B 5DMGD 3SGKA 4WO0A 2WKOF 1H19A 1NBZA 4LAJH 5CILL 1M2VB 4M7ZB 1R3KB 2JQZA 4QOKD 2OMTB 4OGAD 1S9XB 1BZ9B 4N8VA 2JNZA 5AW0B 4X7FC 3GRWA 4AE1A 4BUHA 4AE0A 3I6GB 3VG9C 3RVVD 1A1NB 2AQ2A 2ICWA 4NZDA 3TNNB 1CXEA 4X5QA 3BFQG 3D8MA 4K94H 3LV3A 4I1RA 4P9MH 4YDJA 1SHWA 4HEME 4BEIA 4N0CD 4OM0L 4U05A 3A47A 3CPLA 1RZJC 3VM7A 5I1DB 2DWSA 4PCSA 2PW1B 3MR9A 4NERA 3UBHA 3SO3B 5K69A 2V4LA 1QZNA 2WOBA 3VCLB 3W5NA 4PD4J 3GMQA 2D7MA 5AYTA 4EI6B 3I6LE 3MSPA 5F7MC 1B0WA 2JCCA 4MNGE 1OQOA 1BMZA 3VD1A 3HG2A 4KK6D 3REWA 3NFSH 5I6MA 5GGUA 4AEEA 4Y89A 5IKCA 1NINA 1RUQH 4K55A 4L5FH 4RBPK 5TFSL 5L7XH 1EAPA 2QSCL 4EN3C 2NLJB 1W9XA 2IWFA 4F7PB 1X5KA 3LVTA 3N43B 4GG6F 1RZIB 1ADQA 3QPXH 2BINA 2PYEB 2EVGA 1JPSH 5JIMA 4WW2F 3HNVH 5EOCJ 2X2JA 3UAJA 1QSEB 3T0ED 3WJLC 3GRWH 1GL4B 2NMSA 1WS8A 2Z91B 3FO2B 3FYEB 5EZIL 4DIXA 1TJHL 5IB2A 4KXZI 5EUKB 3VI4F 1UGNA 5SX4H 2EDOA 1KXTA 4QO1A 5EMYA 1Z2KA 3BX7C 4XVSL 3RSMA 1ZHKB 3R1GL 5FIEA 3RHWK 4KAQL 5F9JB 5T3XE 2I24N 3H42L 1EZVX 1BQHA 1J8SA 3DVNB 3MJ8A 1AZRA 3FUHA 4PFEA 1N8ZB 5AN4A 1AMXA 3HS8A 1BQLH 1S7VA 5H94B 2AEPL 5L4IA 4GAYA 4L4TA 1DUZB 4WFFD 5IFAH 4JL1A 5KSAB 4F93B 3CN3A 3BVVA 4PLOB 2O6DA 4RGOH 3SO3C 2JXMA 4BCYA 4IYKA 4C56A 3ZKSD 3VSVA 4F9LA 2CRZA 4JRXB 2DM3A 5D1QC 3IJSA 4OUOA 3G6DH 2CPCA 1WEJH 2OXHB 5HGAA 1JDAA 3VI4A 4GQQA 4AV0A 2QREA 4FYTA 1TJGL 5DTFA 3ZHLA 4UOZA 1BX2A 2G0LA 2CBMA 1V10A 2B0SL 4G82A 4YOKA 3LS5H 5IF0B 5C7XL 1C1EL 5D7IF 1FG2B 1MFBL 3DHUA 4PLJC 4R97C 4MAYB 5IV2B 1KYAA 2D73A 1I8AA 4AC4A 3ZSTA 4LK4A 4WEEA 1MI5E 1BYNA 4JO8A 4F7MA 1MNNA 4ZUWA 2EXTA 3Q1EA 3QEHA 5HGAB 4JE0A 2IMMA 3AMKA 2B4CC 1Z66A 2YKLL 3RA7L 2YAFA 1NGZB 2F18A 3C60B 3DX7B 4HD5A 4WX8A 4R6UA 3R18A 4M7JL 3WXWL 4Y4KC 1ZVNA 4LP4A 1F11B 2QFRA 3ULUE 5LDUA 3M7OA 3O3BB 3Q1SH 4X8GA 3HG5A 1OGTB 4J3VA 1AS8A 2YA2A 3SDXE 2IH1A 4XNYH 1KCRL 1P9MC 3MYZA 3DGGB 4PS4H 2HKHH 4EDWH 4AMKL 5KBNC 3QXUA 5CZXD 1N5YL 5IV2A 3CHSA 3HB3D 1FC2D 3QCVH 2X6MA 3QARA 1K8IA 2YIHA 1IVLA 4XBPA 3LQMA 3TIDA 5I1JH 4X5XB 1JNLL 4YHYC 3QUMB 5K5YA 3F64A 3GRWL 1CLZH 4QCIA 2MWCA 3MNDA 2J12B 3PXLA 3V6OE 1ZGLM 4XVTL 3MRBB 1KMGA 2VL5A 1X5FA 4NZRL 2YJLA 3C5XA 2KBGA 3L3IA 5D2NB 1IAIL 2WN3A 3HZVA 5INCA 3NFNA 3OV6A 4LHQB 3RWIA 2RCSL 4Y9EA 1EO7A 3LN4A 3WHE1 4NN6C 3V0HA 2CIIB 3VGHA 2CO3A 4V1DA 1HXYA 2NY7H 3DX6B 4GQ9H 4HAFA 2F7QA 3NZSA 4RFNC 3MO1B 2V8QA 4CMMB 4G59C 1QHPA 5IESH 5HYSB 4YLCA 3RZCA 4NCC1 1I3UA 3JV6A 4Z7AA 3DX8B 1EX0A 4FQQA 1R6VA 4K3EH 5CJQH 3CC1A 4LP5A 2ZUYA 5C0GA 1Q9LA 2UWEA 3VH8B 2NNAA 1MRCL 1KPVB 4FGMA 3SBWC 5L88L 1R75A 5IW3A 3NTCL 2KQNA 5AD0A 4Y16D 1JWSA 3WHXA 4TOYH 5GQBA 3PLYA 3TBYA 3L3GA 1LK2B 3LEXA 3QEGH 1UJ3A 3QUKA 2DM7A 3TN0A 2FO4B 3LDBC 1NFDA 4Z18A 3MRHB 1VA9A 1DVZA 1MI5B 3LCYA 1ASOA 1RH8A 2VKWA 4FABL 2O30A 1IL1B 1LDPH 5E94B 1KXHA 3UZVA 3CFTA 2YSTA 1R24B 4BSVA 5EIIB 3VM5A 1XXDC 3MRKB 3FUFA 4PRBB 4BHUA 4CC4A 1I1YA 1H5BC 3HI6L 2FB4L 5T3ZD 2QQLH 3H7LA 3GJFK 4IEFB 2EECA 1MCRA 3H55A 2P4AB 4KV5E 4JM4L 1KYFA 4PB0H 1VFMA 4AYFB 5I1EH 1RU9H 1X5ZA 1D5ZA 2DZEA 3MLXL 1PLCA 2NY5L 3DLQR 3QZWA 4Y4HD 4QRPD 5FXCH 1SPDA 3DJRA 4FNLH 3PUUA 2GEQA 1PX8A 5IJDC 1DVYA 4JFYB 5BVJB 2IDTA 2IDSA 4YEFA 5DRWA 1KT2B 3B9KA 5FLUA 2ZYSA 3LKSB 4LBEB 4PHZA 5CFHA 1A1OA 5J6HA 3OZ9L 5L2KB 2ZCLL 2BVQB 5E4EC 1KF9B 3S88L 1I53A 3EO0B 3TBCA 4RGMC 1VHPA 3DUUB 3MGOA 4F9PC 4AW7A 5A7EA 1BXAA 3EYOA 5IR1B 1VGEL 1UM5L 5FUOH 4P2CG 4XXDB 5CBEB 1EUTA 4I4WB 3ZKMC 2BSED 1HL5A 2IH9A 5E9DE 4Z78A 2EH7H 4QD2E 4MZIA 4TSBL 5GJTL 1B3IA 1IEAA 2H6UA 2DLFL 4HXBH 3IXTA 3V55A 4IKIA 5FYLH 5E2WH 2A5UA 1VFAA 4Y4FC 5DVNA 3EF4A 4Y5XB 2R83A 1WC7A 4RA3A 5CZXC 1DDHB 3GSVA 3OXSA 2PR9A 5CUSH 4AK1A 2CLRA 4OLXL 4ZFOB 4YPGA 4K71C 3MU3A 1NCHA 1WS7A 2WYZA 5IB3B 2MJWA 3BAXA 3FHEA 4UYPA 1NDMA 2XZZA 4DQOL 3OAWA 2R2HA 4ONGH 5KYUA 1IEBA 3SE8H 3VU1A 3VSTA 3P54A 1N10A 3D33A 3CN2A 1S7XA 2IGFH 1YQLA 1H15A 1SDDA 5ILTL 4FCAA 1X6NA 2P5WA 4PJHA 3PJSA 4LDLB 3VFNB 3WJJC 3PYCA 5C0BB 2CKBL 2ZOLA 1KCRH 4PHXA 4QRPA 2VDPB 3EJQA 4WAFA 4YHKL 3F84A 4YHZH 5H37H 3VI3A 2J1YA 3H2WA 4Z7WB 2OMNA 1EXGA 4S10A 1BFSA 3M1BA 4NUGL 3T3PE 2VJXA 4M1GH 4R7DA 1PAMA 4WGWB 3KNBA 4D0DB 4NWTH 3MRPB 1V3MA 2DPKA 4UM8B 5DEJA 5KOMC 2B3IA 1ESOA 3CCHB 1JZ3A 1J8HD 3PDKA 2RJMA 3C5SB 1HHHA 3WUWG 1XEDA 5D2LA 4LKXA 2EIZB 4Q56A 1RSFA 2WKLA 4N0UB 4CNIA 1UD6A 5KSAA 4GXVH 1SBBA 4PREA 2OJZL 5FA4B 5E4OA 3SKUD 5EH1A 4J28A 2VQ4A 4NP9A 3GWJA 1UA6L 3F7RA 4E9LA 1K35A 4FZEL 4I48B 4KTEH 1HXMB 5JNYA 1G94A 2HX7A 3VVVA 3Q2VA 4XCFH 5I8CA 3HNSH 4OI9A 5ID0A 3DARA 3TEWA 2JKRM 1G6RH 3FQWA 3O2DL 1CN4A 4K7PL 2RCSH 4RRPM 4YDIL 3SKMA 5JPNA 3CWUA 3WIHA 5B8CB 5KSVB 3BRGC 4U1IA 3QR1A 1HEZA 3JV0A 4LSPL 2VR8A 1RM1A 5E1HB 2M2DA 3ME0A 2HMID 4HPYL 1AQHA 4Z3EA 4UIMA 3AG4B 1G7PB 5JW4R 4KROC 1YY9D 5AW4B 2HVKB 2VSKB 4ADJA 3CFQA 5GRJH 3FU9A 2H2SD 3ECVA 4NPKA 3BKCH 5LCVL 4S1QL 1VKXB 3GNMH 1ES0B 9CGTA 3ZQ9A 4NC0B 1AGFB 2HJFB 2F1BA 2AXHA 3KW8A 4H0IA 3V0WL 4HPHA 3K6SA 3BKMH 3EXLA 3FQRB 5EFIB 4HUUA 3M1OA 3BWAA 2B77A 4G6AD 1AGFA 1T2JA 2H1XA 3Q5TA 5D1XA 1KYDA 4A2DA 2Z8VC 2DMGA 2P24A 2FHCA 4LSQL 1E8XA 2QSTA 5I1LB 4YGVB 4B3EA 1AGCA 2EKSA 4PR5B 1IIIA 3PWNA 1YTBA 1OGTA 4M7KH 4JUTA 4M8QB 1F11A 2AERT 4I1PA 2YD2A 2ALAA 4XMUA 3QCTH 3QIWC 5GS1C 1A2YA 1NBCA 5BRZE 1P5VB 3JT0A 2EH8H 2NNXA 2BS8A 1O7VA 5I76B 4QRUB 4MA7L 5IVOA 1L9PA 3A3YB 1NPJA 2AJVH 2OM5A 4X42A 3ZPDA 3BLBA 2NY5H 3OKDB 3PWJB 4U1KB 3MA9L 5BRZD 5D7JC 1CFSB 4BFIA 2IJ0C 6PAZA 1CURA 1XAKA 2X3CA 5EPMA 1OY3B 5SWZD 4YEEA 3LPGA 4HFWB 4KDVA 1DVFC 4CC4C 4XHJC 2ZP9A 5E8PA 4XP6H 3BAKA 3EDKA 1PD1A 3SKJL 3OWRA 2EEAA 3QDGD 1FFRA 1NCUA 1DCLA 3AY4C 2X05A 2NY2B 1FIEA 2C1OB 4UTBL 3QIUC 4XPTL 1C47A 1QN9A 1QN4A 1NAML 4MQ7B 3R8QA 5JOPD 4PJXF 4L48A 3WS6A 2Y2TA 5BZWB 2PTUA 1WT5A 2G30A 2A6DA 1UJTA 4P4KB 3T2QA 4QHUB 1S9YB 5A2BA 2O5YH 3DBXA 1FFPA 3HS9A 4M29A 4ATTA 4FLRA 2ED9A 1JNNH 1KCSL 4KXZH 4DGWC 3GXFA 1JPGB 3KLAA 3BW9B 2E9GA 3ZE0E 2YQBA 5D2LB 5SWSB 3T6VA 1WC7B 2J6EH 1A3QA 3FZUD 12E8L 2YLHA 4CDHA 5AB2A 3E6HA 2XN9A 3RI5F 2CGRL 4JVUA 1QSEA 4XCCL 2JKJA 2NQ3A 2D7TH 3QDGB 3F12B 3BCFA 2PYFB 3OSVA 3PWVB 2NW2B 4HXBL 2MQGA 3RE0A 3FQXA 4U6VH 3MV7A 1CR9H 5IVZA 1N7ML 3JXAA 4AW4A 1C9SA 1K5WA 1ZEAL 4WFGD 3EAYA 2AQTA 1A5FH 3MLVL 1I9EA 4N9OB 3TYGL 4H1LB 2APWA 5H2BB 1EO5A 4UNUA 2MHAA 4EOWH 5AW2B 3ISYA 1LXTA 1L9RA 3IFNL 3N1MC 2X5PA 4XN4A 2E8YA 4EF3A 3LPPA 3E7JA 2I32A 5F0MB 2HRPL 2CLRB 3WJJA 3QRFM 5I6KA 2O5XH 3UC2A 1IV8A 1I8IA 2BNRD 3A67L 4L4TE 4N0YH 4NLHA 1DFBL 3HC3H 4WGVB 4L9DA 4XPAH 1P4IL 3DETD 1D5ZB 3MACH 1C16A 5DK2B 2K0RA 4MVBC 3RYMA 3IMWA 4NIKB 1MPGA 4CRPA 2ZXQA 2WP3O 1A1NA 2ICWB 2IG2L 4P05A 5HVHC 1ZE3C 3TV3L 1JGDB 3BKYL 1SOKA 3P4MB 2YGOA 1KTLA 3QEQD 4LO9A 2F8XC 5GGSB 1BFTA 1IKFL 3SPJA 5SX5K 1PZBA 2JLLA 4J4PC 4HAKA 4F37K 3KG5A 2FGWL 1WWBX 1XSIA 5HSHA 1UCBL 3ABGA 1TBPA 1AO7D 3AFLA 1O9VA 3C9NB 4JRWA 4KC3B 5CEZE 1X5XA 4X8CA 4JFHE 3S96A 2AQQA 3L5HA 3O4OC 2IBGA 4TN9A 2G5RA 4LNVA 3PHOA 4A7QA 1I31A 2YA0A 4KY1H 1C16B 1ASQA 3V9EA 1U6AL 1NH2A 2YOAA 1KFIA 4C47A 2NUTA 4FFYL 5FF6A 3ZE2E 4LKCB 2JKLA 5CLXA 5D6CA 3DX8A 3D3VD 4KVCL 2IPKA 5JHBA 4X6DF 4YL9A 5T3ZE 3LXUX 4R4NC 2P8MB 4LU5L 5K9JL 1WZ1H 1TSRA 3V4VH 1NMCB 3W81A 2OK0L 1V3LA 4PBVC 1Z32X 1EA9C 4QRTB 3AT9A 2EDHA 2AJSL 3IDIA 3BPLC 4M61B 5ALBL 1RJYA 4L23A 3SD2A 1R1CA 2WBJC 4PGDB 1JPTL 3VDCA 3L3JA 3ILEA 1IFHH 1JZDC 3IGKA 1MCDA 1N9PA 3H9HA 4QTFA 1OP5K 1S7RB 3GMLB 5JXAL 1ACYH 1JGVH 2SEBA 1AY1H 3KYNA 4KI5E 2WM0A 4JPWH 4MCZB 5T33H 3ZTDC 1JPFB 3G6JE 4PRDA 1AI1H 3QR0A 4ETYA 4JPVL 4PTTA 3V4VB 3IU4L 2J3SA 2WBXA 3CSGA 4XCNA 4DTGH 1N64H 1D5XA 2VW7A 3NIDE 2PYEE 2ZICA 3LQAC 3FCTA 4XBPB 2BIPA 4EVNA 2FECL 2P5ED 1DN0A 1WTGT 4ZQKB 1ZT4B 3IDYB 2IQAA 1XGTB 5J5EA 2Z3FA 4M7ZC 5F7YC 1XD1A 5A6MA 4HUVA 1HHGA 5JHDD 1HKLL 5CINH 4OZIF 1CBVH 2D9CA 1CLOH 1CGYA 1JF5A 5TF0A 4Y2DC 1TETL 5BZWA 2OZ4A 2QGEA 4ZFQA 1KZQA 4X7EC 3NFNB 1FL5A 4U1NA 2UZXB 5LWYL 3D7QA 5FOBB 3CLEL 2N1TE 1CFQA 2BW5A 5DJCA 4M6ML 2D0BA 3FRPB 2FEDC 2RGSA 2ZP0T 4BELD 1C08A 1HL9A 2DQ6A 4TUJA 1IKFH 4LESA 3AY4A 4JZJC 3UOAB 3U2SA 1PMYA 4HEPA 2X2IA 4D9RE 7PAZA 4H13C 2NSXA 3NCJH 3H2PA 1E5BA 1FFOB 4LOUD 3GLZA 4W6YB 2VXUH 1FG2A 4RGMB 4WEMB 3UFIA 3WN5A 1UFUA 2AQPA 4JHWL 4XAKE 4GINA 5DUML 4KNUA 5JR1L 1FFOA 4HETA 2YPLA 1IBDA 5D7IA 4PLNC 5EIIG 2PCXA 4P48A 4KI5F 5JQIB 1XHHA 2YEZA 2YXWA 5D93B 3LKPA 3PS6A 3NJIA 3TA3B 4DCQA 1DQLH 3KEDA 5DU7A 3LYRA 4P2RE 4PS7A 1DLHB 3EHBC 4JAMA 4ZS7H 1XZ0B 5I0YA 3WLWD 1OWWA 3AXLB 3QXWA 4RGNE 3WFDH 4ZTEA 1N70A 3TH4T 5K1NA 4NI3A 2J72A 4JY5H 4L8CB 3RVWC 1W72H 4X50A 5DQDH 1VSCA 3QW9A 4JFDB 2FEEL 2YARA 4L37B 4UT7L 2VR7A 3OWEA 3SB3A 4UAHA 3MJ7B 5EZJA 2I60L 3U9WA 3L1EA 4Z3TA 3FQ1A 1ZSDA 1DBML 2Y1AA 4A7SA 1CDHA 1UKQA 3P0YH 4M8RA 1HAUA 1TQWA 4EI5A 3IFLL 5T1KB 1N3NB 3MHZA 4TQHA 2OMVA 1CICC 5IB5B 3HG1B 3H3BC 4G42B 1N7MH 4JPWL 5T33L 3K6SB 1YMME 2DMKA 4MB5A 5JIIA 1U8IB 2KKQA 2V2WB 4OTXL 4DP0X 2LABA 4TULH 3F7VA 3SDCA 4BWUA 5F9OH 5CD3A 1R5VA 3FCGA 4QMEA 2WAQA 4S2SB 4XPGH 4NO5A 1RHHA 1J1OL 3D3VE 3BVTA 4O4YH 4RISH 5I73C 3HNSL 3WNOA 2NLVA 4NQDB 5C0ND 5E00B 1RZIA 3T4YB 5DD5H 3P77A 1U8MB 1FVEB 1DUYB 4ZXBB 3FC8A 3QI9D 1AGBA 4ODVH 1AC6A 1OCRB 1NCOA 1RUAH 1TTAA 3ENCA 4GG6A 4DN3L 3REWB 4Z7NF 4XCYB 3ROOA 1P4IH 4HALA 3EYFB 2K8QA 1V54B 3RVUD 5CSZA 1T0NA 4G5AA 1MJ7L 5C0IA 2BSDA 2ITEA 3AS0A 4L4JA 4OZGB 3BUYB 3O2WL 1QW9A 1K5NB 3W1ZA 1Q0YL 4F9LC 3HN8A 3GTTA 4EQ3A 2HFEB 1F8TH 4UQAA 1JPFA 4PRDB 4C56D 1ZAGA 2ZUUA 4D3CH 5D5MF 5JPMC 4UUJB 1J0KA 3VXRD 1I82A 4N2CA 1DDTA 4NBZB 1D5MB 2VLKB 5T3ZH 3SGDH 4KJPD 1S9XA 4R7DB 1J5CA 3BYTA 3HAEB 3KYMB 4L0YA 4KDTC 2B4CL 1QLEH 5LKNA 3QR2A 2HX8A 1L3WA 3K6FA 4Y19A 2GJ6B 5KBMA 3PJSB 2EUXA 4RZCB 1TTCA 4E5XA 4N90E 2IPKB 2OL3L 1NOFA 3F7YB 1KPRB 3JBG7 4JFQB 3VTMA 2DQJH 4KZDL 3EYSH 3SE4A 2B9BA 2R2HB 1MAJA 3JYCA 4JKWA 5FFLA 1VOKA 1U3HA 2WQ8A 2CZNA 3KYOA 2P5WD 1DQDL 1ULVA 2OBGA 3MCYA 3Q5OA 2YD6A 3CDYA 1I8IB 4AV4A 5I0XA 1Y0LA 1TTGA 1YUHA 2AVGA 3BP4A 5DD3L 2ZAGA 2G0KA 1TENA 2BSTA 4KZCA 4F91B 1G7QA 2PTVA 3FSAA 2DQMA 1BAFH 3T71A 2EADA 3L54A 4K9JA 5IW6B 4ZMNA 1NGXA 3KWUA 1O6SA 2H2PD 1TVBB 2E6QA 2XKUA 4LSTL 1T2QL 1TMCB 3MUGB 3K4ZA 2WJ5A 2O5NA 2JIXB 1YMMA 4X7DC 4JB9H 5BUGA 2XWTA 2FJGB 1MFVA 4GG6E 2VRKA 1RIVH 3R0MA 2EILB 3P4MA 4GH7B 1NUFA 3IWUA 4OV6F 1VEOA 2EDWA 1KEGL 4R4FL 3U9PH 2BVQA 3N43F 43CAB 4M5YH 5AVVB 5J3HC 3WFCL 3CSFA 2X9XA 1M6UA 3LIZH 3O0RL 3P3YA 3KDMA 4NGHL 1SLVA 2XWJA 1BFVH 1HYRC 3RDTA 3MRGA 4UT6L 3LN9A 5CJOL 3MXWL 4R96B 3GLAA 2B1AH 3MNWA 3INUL 5D6DA 3PP3H 1JYNA 5LWYH 3PIQB 1IO4C 3DBXB 5ESAA 4CVZB 2BFGA 4XXWA 1OOAA 1J5IA 4XMPL 4HGWA 4ZFGL 3T4AB 3ISRA 3VFGH 1D5BA 4FAAB 5F7AA 2YQ3A 1NKGA 3RWEA 1I7TA 2X9ZA 4PRPD 2GC7C 3K3QA 3NFPB 4R2GD 3CWTA 5BZDA 1YEKH 4O58H 4XAKD 3WJMB 1UT2A 3HE6A 3QDGA 1MRFL 4Q52A 5GRUL 3N9GL 4XAWH 3ZE1B 2BVYA 3ALPA 1ZANL 5KVDE 3NRPA 3B2XA 4K3EL 3RFRA 2BIHA 2JKIS 1QNZH 4OLYL 5DFAA 5DHXB 5E8PB 3JWNE 1WCBA 4H2AA 4HHGA 4HS3A 1U8JA 4KKPA 3WIHH 4F8NA 3NCWA 5HHOB 1O9WA 2ICES 2UWEF 5I71C 3BZFB 2BIMA 2HG0A 1JWSB 1JVKA 1XF2A 1DLFH 1TUOA 4XZ4A 4M5ZH 3NIGF 3SGJC 3QDME 1I9JH 1E30A 4W9JC 4WI2A 5I1CH 1GYVA 4L8SB 2F53B 1S9YA 3A67H 2ZUWA 2APBA 4AMWA 3F58H 3MZGB 5LDSA 1ZT1B 4NNXB 3RPBA 3GUTB 4NKQB 5T5FL 1G7IB 1F0LA 3BIBX 5DJZA 4PJEE 1HXYB 1OAUL 4H8WH 1QO3B 4A6YH 3OZ9H 4JW3A 4IBUA 5CP3A 3BWUC 5HYJD 3VD5A 1AS6A 4CMHC 5I1JL 2P47B 4GI9A 5I74B 4AQ8C 4L9LC 1HWHB 2AXWA 4GIOA 3FUKA 3QNYB 2HFFB 3DETC 3QQNA 3FMGL 2VZ1A 3EYVA 2H7WA 1YYCA 2V2WA 1GVIA 2IOMA 4CVXB 5IFJB 1A7NH 3BWAB 2R69A 2IFFL 4L8DA 1MCPH 4PY8J 1Q1JH 3PDOA 5T1KA 3BN9D 3ZHDA 3DX9B 1YUKB 1AHWC 3BJLA 3K6IA 4H0LC 4AGQA 4F8LA 3MJ7A 3V0VA 2FCBA 4KK5C 1S9WA 3RAJH 1T7YA 3UZEC 1ZSHA 4OIBA 3SDDD 1FVCA 2BP8A 4FS0A 5TK2A 4EKJA 2FKFA 3S5YA 2Q2EB 3AXLA 3SQRA 2HKPA 2ED8A 2R2EB 3ATEA 4YHML 1WBXB 3H2QA 3P02A 1SJXA 1EFXB 5I1AB 4EN2A 5KYYA 2ZIDA 3EGDA 4QKXB 4HJGA 2NY3C 1BECA 3X11A 1NEZG 1W0VA 5I8CB 2ID5A 1TPXB 3D2TA 4AQ1A 3AB0C 1I8MB 2YGVA 3PDDA 1PG7H 4WY7L 5HGDA 1XO8A 4I1NB 1XF2B 4FNQA 4L4VE 3B37A 3QJHB 1MELA 5T5NF 4AWJC 3NP4A 4HUXA 1HH6B 1L7IH 4ODSH 4Y1AA 2QR0B 3WGVB 4IIQA 3Q2CA 2ATKB 2VITB 4PGCA 5HJGA 3VI3E 4ONGL 4EN3B 4GO9A 3BAEL 3QJQB 2NSQA 2WTRA 3KGUA 2UXTA 3ARBC 3EYSL 3NCYS 4GAJL 5HJ3B 2L7QA 5D2NC 3CSBA 3WTTA 1TSHA 4HWZB 3D6GA 4PJGE 5CGTA 1YMMD 2CLVB 1JGUH 4N0CC 4RMUA 4Z7UB 4BKLA 5ACZA 3KZ8A 1EBPA 2IANB 3OKEA 1FFTB 1KZYA 3MUZ1 5C9JB 3T9WA 1OAKH 3VE0A 3LOWA 3L4VA 4GUCA 3JV4B 2MEJB 3DOHA 4FA8A 4Z7VB 2PWHA 1HI6A 1H8NA 2IQ9L 4IKJA 1J8HA 2VDKH 3L5IA 4Y88A 4Z7OF 5BVPH 3FTGB 2O5ZH 4PGEB 3VWJC 1R5IA 4N2AA 4YPGB 2NXZC 4B5EA 3IM1A 5IQ9B 1ZHKA 5F9JA 1NMCC 5TH2A 2OTPA 4KMQA 5LLIC 3QIWB 4YHIA 5C2BH 1X4ZA 5C09E 3C5SA 2X1WL 1PD0A 3ARUA 1QFHA 2Z91A 5GGTA 5HI3C 2NXZD 2DJSA 1DBKH 3ML9A 2BFVH 2Q5BA 3UIYA 4BH8A 1MCKA 2K4WA 3H9HB 3PHQA 4JFFA 4Z6AT 1AMYA 2LFEA 2QRDA 3AC0A 5IB1B 2DQCH 1MREH 5GRVL 1ETJA 1DQMH 1S8DB 2BY0A 4J8RB 5C0BA 1FA4A 4OSUH 4XI5D 5IBUG 3KJ4C 3UBXA 2FK9A 4YDKH 1VFOA 3HMXL 2AXGB 2BHZA 2LTQB 4ZUUA 3UAAA 1NC2D 1X5JA 3RGBA 2J4WL 3WIHL 5KJ7E 1W0WA 3HC0A 4OH2A 5AENA 1V8HA 3CBKB 3TYFA 5B4MD 5TDNB 1DYZA 4YK4C 2AK4E 2BJML 3LIUA 3KGRA 5DYOA 5JMVD 2AFNA 4JFXA 2V5YA 2DWDB 1U2CA 3ZIYA 2D3NA 1F3RB 1ZLUH 4AIZA 3HUJB 4ZFOL 4WCYH 2EEBA 1TEFA 3LQAH 3P4OA 1FORH 4DGUA 4M48L 1ASPA 3KXFE 1G1OA 2ZXEB 3MCKA 4KXDA 5MHSE 1AZZC 5F9OL 1FFQA 2BWDA 3ECBB 5ETUA 3KDPB 3S6CA 3B5GA 4BSVB 4AIOA 3ROLA 4P2OC 4NJAH 4TLSA 1HHIB 4A63A 1T7ZA 3OJMB 4JY4A 4OLUH 2FYYB 1FVDB 3ZK0A 2VWEC 3LS4H 4G9FA 3QRGL 4M56A 1CFVH 2JV6A 1XXFC 1SHMA 4FQCH 3Q48A 5JHDA 1DP0A 5ICXA 1VF5C 4KXCA 3U6RB 1QSED 2FWUA 5D7EA 5T1MA 2WD0A 4H0HB 3TS8A 3LZFH 1SEQL 2JJWA 5DA4A 1IFRA 3VFPB 1KIPA 2NY