2IV8A

Beta appendage in complex with b-arrestin peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
233
structure length
233
Chain Sequence
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/regulator
molecule keywords AP-2 COMPLEX SUBUNIT BETA-1
publication title Role of the Ap2 Beta-Appendage Hub in Recruiting Partners for Clathrin-Coated Vesicle Assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 233
sequence length 233
ec nomenclature
pdb deposition date 2006-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1150 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2iv8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2iv8A02
3OCIA 1RM1A 1KYDA 5IYCP 1QN3A 1MP9A 4B0AA 3ASMA 1AISA 2IV9A 2VJ0A 3OC3C 2D0BA 1NVPA 3HS9A 1VTOA 1KY7A 2D0AA 1VTLE 1QN6A 1QN8A 4RODB 2Z8UA 4WZSD 1TBAB 1TGHA 1KY6A 1R4XA 1NGMA 1TBPA 4ROEB 1QTPA 1QN9A 1QN4A 1B9KA 5IYBP 1VOKA 1CDWA 1D3UA 2G30A 1JFIC 1QNEA 1PCZA 1KYFA 2IV8A 1QN7A 1QNBA 2D0CA 2MJ7A 1C9BB 5IYDP 1QN5A 4PY5A 1E42A 1KYUA 1PZDA 1W80A 1QTSA 3HS8A 3H1ZA 4ROCB 1NH2A 1QNAA 1QNCA 1YTBA 1VOLB 3EIKA 1YTFA 3VN5A
chains in the Genus database with same CATH superfamily
3O6KL 2CDGA 4G9FE 3HZMA 4DJMA 5CD3B 4IGBD 2W9LA 3H4FA 1CYXA 2ARJA 1I3GH 3VTTA 1KWGA 2I27N 4BD4A 4QAWA 4KI5F 3RVXC 5E2JA 1KPRA 3L3IA 4P2OC 2C4XA 5F88A 1K5NB 1H3UA 5HGBB 5F72S 4G8EB 2HJFB 1IGYB 1ERNA 3IPEA 3G9AB 1CGWA 1CFTB 3CZGA 3MGOB 2EUVA 1IT9H 4MHHI 5HHXL 4R7VA 4XN2A 1ZLVH 1EGJL 3OKOB 2JCCE 3J2PA 4GLRH 4P5MB 3OR6B 1RZ8A 1SXNA 3DUHA 3QNZA 3MJ8B 4PJHE 2F7QA 4XO3A 4LOEA 2E5EA 3SGEI 3JV4B 4QTFA 4G1EB 5KSAC 1MW1A 4WU7B 2MNWA 4LSTL 4U1GC 3IKKA 1A7NL 2DQIH 3GSXB 4MDJA 1DVFA 4ABVA 1WRFA 2P80A 1F02I 1ORSB 1SLUA 4I1NB 5TE6L 1D9KA 2ZNWA 4PV8B 5E7BA 2ZP9A 4N3TA 4MLIA 4KZDL 4WY7L 1YECL 3GSWA 3UC0H 2KPWA 3F83A 4UIKH 2VLKA 4JDZA 4JREC 3CDGA 4MDIA 4JPWH 1QSFB 4LPWA 3L4CA 5FECB 5MI0C 4Y2DC 4DULA 3IS1X 3EIKA 1JWSA 3VSQA 3F7LA 3TVMC 1N6VA 3C5ZC 3WTVA 3QBTB 3BGFB 3BSHA 1NPUA 4OM1H 3AT9A 1YMHA 4PU2A 5FA3A 2FSDA 2JPIA 3RILA 3KGTA 2DQ6A 1XGUB 3AAZA 2WXPA 3EXLA 3NSJA 2H6OA 3NAAL 4MA8H 4NQSB 5A43C 3EDJA 2G2NA 4FQ2L 3QDMA 4BFNA 3OJVC 5EBWA 3BT2L 3WFHA 3VD5A 2WO3B 4PWFA 2DM3A 3F7YA 5BW7C 1J1PH 4UT9A 2M8XA 1FNGB 1E9QA 5FO7B 3O41A 1Q9WB 4XO8A 5BRPA 4HXAL 4WI2A 4GOSA 4NSKA 5HXMA 2X42A 5EU7C 4EE2A 1AANA 1KBWA 4FA7B 1AG6A 3DX8B 1RZFH 4WSKA 5L88H 2BP8B 3GMLB 2WKOF 4B50A 2FGTA 2EYSA 4G6FD 1S5HA 2WYZA 1Z1WA 5CZRA 3ZZSA 4ZNEE 2Z7YA 3BMWA 2EDOA 3AY4C 1KNOA 3C6LB 4UTBH 3C60A 2XPGB 5DUPH 1SYVB 3EF7A 5F6HJ 3SBWC 3L48A 3PGCB 5A3ID 1F4XL 3GSNB 2A9NH 2AQPA 5CBAB 3FRPG 5B8CB 3PP3K 4JO4L 1G7HB 2FBJH 3MOBH 2XY1A 3O2WL 4RGNE 4HZLA 1XCTB 5B38B 1AQKH 3QQ9C 4WCYH 2BP3A 1TEFA 3PWLB 3G6JB 2XWTA 4X9FA 3ZKMD 5HSHA 4ANUA 1Q9KB 5HYFA 2AQRA 4EBQH 4UT7L 5KBNC 1BXVA 4H4NA 4JGJA 5F7MC 3OXRA 2AEOA 3QRBA 1TDQA 4OQTA 3WEXA 4ZPVA 3LNEA 2Z8UA 2HG5A 1G9ML 3LRMA 4AL8L 2NTFB 5BUAA 3GRWL 1JDDA 3H4HA 2IGLA 1FC1A 5B22A 1HQ4A 4G8GB 3WY1A 4P2QA 4X5WB 2ATPB 4Q0XH 1S7WA 1U92B 3K4DA 5I8EA 5ALBL 1OARL 4MSWA 4BKLB 4P4RB 4JNXA 2ICWJ 3GF8A 4YSOA 3ZO9A 1XDTT 1YN6B 1GYVA 4P2RA 5C70A 2PYFA 2UY7A 5I74C 3OKEA 3TA3B 4FEMA 4U1NA 4XO5A 3VXME 2E8ZA 5AW1B 2NLJB 4CAGA 4D8PA 2IWFA 3G3LA 5DUML 1U2YA 3MRDB 3L3OA 5IFJA 1DBAL 4TSBL 3UTTE 3WCYA 1OAQL 2Y1YA 4QO1B 3MMEA 4M8VA 5CO1A 4AJYV 2ZJSH 5LCVA 1YG9A 1DJXA 2QADD 2X44D 2NOHA 4I3SH 4K3GA 5L2KE 3WHXA 4JZJC 4ZI8A 1UKTA 1O6VA 4YO0B 1U3YA 5HGAB 1S7VB 4RMUA 3ZO0A 5KW9H 3NYKA 4XWGL 2WJ5A 1M7IB 3RPBA 3OQRA 2WQUA 3ESOA 1BD2D 1MAMH 2QHLA 4X4MA 3BT0A 4PW9A 2J72A 4LP8A 1MWAH 4R7NB 2GSGA 3FW6A 3AB0C 1HEHC 3U4EB 2IF7A 4PJ8B 4CVUA 2C1PA 3DSNA 2EO1A 3ZDZE 1X7QB 2WCSA 2EDYA 2VABA 4HC1A 4WEBH 3UBHA 3MLSL 5C0JA 1ZIBA 2PO6B 3IJ9A 2CKBA 2HN7B 4XVUD 3UAAA 4FG0A 4R4FL 4PJAE 4KVCH 1BWWA 3ZQXA 5IQLA 4MQ7A 1EAPB 1HHGA 4EQ2A 2LHAA 1DLFH 2BIHA 3KYKL 4JAMB 4K7PX 5B1JC 2MPAH 4M29A 2NSXA 2CDGB 1TJHH 1BQRA 1MDTA 3HZMB 3DMMA 4KC3B 4XPGL 3UMNA 5ID1A 1LE9A 1Q9LB 3QUMA 2ARJB 5DEFB 4Q9RH 3IJSA 5FYLE 3EYVB 1T83C 5L4FA 2CRYA 4WFGE 5BPPA 3PDGA 3L3IB 4OLWL 2EXWC 8FABA 5F88B 4NFCA 4Q9QH 4ZMYA 4G6AD 5FYLL 1OAKH 5T1LA 4YHNA 2ZUWA 2ZOKA 5DZOA 4QTIH 3D4GA 2F53D 5CCGE 1RU9H 3F7KA 1F6FB 1NMCC 3EFOA 4TUJA 3RGHA 1MAJA 4B9JA 4OZIB 2E27H 4D9LL 1G9NL 1NCHA 2V8MA 2GUYA 2YWZA 5KG9B 5F9AC 3QIWB 6PCYA 1AS7A 5F7AA 1XMWA 1H5BC 4MDJB 5IT2L 3ASNB 1DVFB 2Q5BA 1W6WA 3MNVA 5FO9A 2VL4A 5C0BD 3U0TB 4ODXB 1R3IH 4HYTB 1NDTA 1D9KB 4NBXB 3MSPA 3HI1A 3MV9B 4XH2A 1BV8A 3MXWL 1RZJL 1EMTH 1PZDA 3HS8A 5I71B 3MOQA 3BKCH 1F2QA 3EBGA 3WAKA 2EE6A 1FZJA 1PZAA 1I9JH 4G7VL 1TVHA 4JVUA 3H9ZA 4HJJL 3T0EA 3P77A 2WYHA 2BS9A 4MDIB 5LKNA 1I9RH 5IEKA 2BNQA 3ASOB 5LG1A 1P5VA 1JWSB 1ETJA 2WKGA 4F91B 1P5DX 1RZQA 4KI5C 4HAFA 1HOEA 3FQYA 3IDGA 1I1FB 1YMHB 1ZS8A 3B6SA 1I3GL 4H8VA 2KUTA 5FA3B 5GISH 3T3ME 1IVTA 3P02A 4WZSD 2YPKA 2WO4A 3BISA 2FYYA 5AZUA 3O4OB 3AAZB 4PJCE 2BVPB 2GJ6B 5DVPA 4QPEA 1NUDA 2FATH 3U9WA 4DP1X 2D3VA 3QDMB 2XV3A 3DTXA 4F92B 1TU2B 5BMPA 1CZ8H 2FH6A 2NZ9D 4YNYA 1IT9L 3F7YB 4YPJA 3GPEA 4G6FB 3LQZA 1Q38A 2X2HA 1XBDA 2ZYIA 3O41B 3ZY7A 4JO3H 2BXYA 4WU5A 3TEWA 4IOSD 4GNKB 2ZUTA 3X1EA 2EDTA 2NSQA 5IEHA 4FD0A 1BXUA 2BDNL 1NBZA 4YHIA 1MI5A 2J43A 4B9CA 2DQIL 2DI9A 2EEFA 1TBAB 3VI4E 1FO0A 2MH4A 3VFMA 1UCBH 3US9A 1HXMA 4NQEA 3TLRA 4ZMXA 1NGXB 3WGVB 1BJ1J 1CE6A 3WXVH 5HDOA 5C09A 3UTOA 4GO8A 1KNOB 3PWPD 1GOHA 5EIIA 2J2ZA 4PJ9D 4NZ8A 2DQHH 4KJYA 4KDWA 2ATKA 3UC0L 1ACZA 1K2YX 1CWVA 1QQDA 2ERJB 4UIKL 1RUMH 1FL3A 4BEIA 2DH3A 1NOFA 3D4CA 4JPWL 4DQAA 1YPZB 4PJEF 2NY0B 3VGAB 4U1JA 1THAA 4JE4B 3KLHC 1H6EA 3ZT6A 4OM1L 2XWTB 2J56A 2WXHA 3MJ9H 5IK3A 1C47A 4L1SA 1W0WB 4PGCA 1F1GA 2FTAA 3WHE0 3OXRB 4HDIB 3WEXB 2O93L 4ZPVB 4LT7A 2HG5B 1A1NA 3MRCB 4YR6A 2B4CH 1BQLH 2XPZA 4OCSH 4GT0A 3UROR 1HQ4B 3QE5A 3AY2A 1J1PL 4TPRH 4EZLA 1U3NA 3IFOA 4WFHE 5EUOF 2XBTA 4WW1A 3RDTC 4E41A 1XD0A 1T6AA 1KELH 4XNZB 1XF2A 5C7XH 1J9TA 1AISA 5AL8A 4QRPA 1MELA 3VXRE 1EZSA 1XB6A 2J21A 1FVDA 2QADB 2X1OA 3QSKB 4H0GA 3HHMA 3OKEB 2YFOA 3DOHA 3K6IA 4AQZA 4D9RE 3QJZA 5JHLH 5L88L 3KWVA 4MMXC 4OKVB 1LQSR 3CWSA 4D8PB 1E5AA 2W65A 3L3OB 5IFJB 2P42B 3MMEB 4UTBL 1CGVA 3A47A 2X6UA 4H20H 4PJFF 3OJ2C 3WHXB 3CCHA 4Y1SA 1EZUA 5B8CC 4L4VD 2CM5A 3IRCA 2A9NL 3CFKA 2BSRA 4NKOA 3T3PB 2FBJL 3MOBL 4X6DF 4XE0A 1DVUA 1VACA 4GO6B 4K8RC 1DZ0A 4ZFQA 5C0AE 4FG6C 1D5ZA 2VC2H 2VDNB 2QKIB 1B4LA 2A73A 2AJ3A 1X9QA 4EBQL 2GSGB 3QUXD 4J3SA 2KYIA 4Q2ZA 2D31A 4AJWA 3S5YA 4QG5A 3KZ8A 4KGJA 3SIKA 1A7QH 2V4LA 3DSNB 1A3RL 4RMWA 4URTB 1PY4A 4E5XG 5J3HD 4PVNA 2VABB 4Q0XL 3II1A 1EFXA 4X4ZA 3UABA 3OF6A 5C0JB 2W80C 2CKBB 4IBVA 1KCRH 2HVBA 3X1NA 3TE5A 3FCGA 1LWWA 4N0UA 4XPAL 2XXGA 5DVNA 3UAEA 2APSA 2WSPA 1E6JH 2MIZA 2VT0A 3BAIA 1QN8A 4KZCA 3QIBA 4OCNC 3N1PC 4G8IA 3W9EA 1TTGA 1PG7X 5ESVA 5EO0A 3GT6A 5ID1B 4ADGA 1LE9B 3ECVA 2JKJA 2F53B 3N89A 1XAKA 3QB7C 4UQ3B 2ZJSL 2JIXA 2P5WA 5J1SC 2DAVA 3NOIA 4H26B 4I3SL 2UZYA 1E4JA 5BNXD 5TJWK 8FABB 2BNRD 3VFNB 2R29A 5KW9L 2KZ1B 5T1LB 2ODHA 2PWFA 2Z91A 1RHFA 4YHNB 3OR7A 3OAZK 2ZX6A 2GABA 4TRPH 1ACYH 1MAML 3DURA 1AHMA 3GHEH 5I9QC 1FRGH 1HZLA 1KLUA 1MWAL 3DK2A 5JPMC 3NTCH 1OSPH 4PGJA 1AZRA 3VFPB 3P40A 4HGMA 1PQZB 2ZQKA 5K9JL 5DMGD 3BW9A 3PPEA 1M71B 4QLRA 3MNVB 5FO9B 1IM9B 1DBBH 3V6OA 2XN9D 5EIQA 1CLOH 4IKIA 4RX4D 4XH2B 4R4BA 1BPVA 1S4IA 3QEHA 3VU1A 3VXSD 3S36H 1A25A 4CBPA 1FZJB 2ZXWB 1TVHB 2QQLH 1IE5A 5FCSH 3T0EB 2MTAA 1DLFL 3CVBA 4QOKD 1SOXA 5IEKB 2FBRA 2BNQB 2YAHA 1MPAH 3A22A 4HCGA 1MQ8A 1TJHL 1LDSA 3IDGB 5JDJA 4LBEA 4CC4C 1THCA 4J3OH 5AVVB 4Z76A 1ZS8B 3B6SB 5F3BB 2OV0A 3PNWA 2X1XR 2YPKB 2YN5A 2FYYB 3QEQE 3FQRA 1ZJBA 5D7JA 5JLZA 1XX9C 2H2SC 1QNIA 1A6UH 2V2TA 2V8QA 3MUHL 3NJNA 3H85A 3D7QA 4Q9QL 1JTOA 1P7BA 3W11D 3HG1E 3DXAE 3M1BA 1OAKL 5CKAA 4BFKA 3NIDF 1QD0A 3FONA 4QTIL 4YNYB 1AD9A 1V5JA 1VENA 1RU9L 2DICA 2PNDA 3L5IA 1A64A 3RI5F 4X5QA 5FR3A 3FHQA 4WU5B 2E27L 1C12A 3LVTA 4ZUWA 5IEHB 1GPOH 5DMJB 1A2YA 4KGLA 4KVPA 4KRPB 1X5LA 1MI5B 4N28A 4PWIA 2B7DT 1ET8A 3BC9A 1QHQA 3IDNA 4JX0A 5MHSE 1DO5A 2CO4A 3B2UD 3MYZA 3VFMB 1D9KC 4W9EC 1HXMB 1R3IL 5C1MB 3FNKA 5ADOL 1CE6B 4XMWA 3ZHNA 4BGDA 1EMTL 4XXWC 4F7TB 4DP5X 2J2ZB 1W15A 3BKCL 3DPTA 4KJYB 2X38A 3I84A 3QFJA 3ULSA 2ATKB 1I9JL 3VH8A 3IETA 1QQDB 2XIDA 1FL3B 3CJJA 1ADWA 1K2DA 1I9RL 4L5FE 4BFGA 1WS8A 1PVHA 4U1JB 5GRXG 3LN4B 4YZWA 1OF0A 2JI2A 1RV6X 5GISL 3EDEA 1N39A 2DN7A 4A04A 2LR4A 4KMTL 5FGCB 1U3HA 1HL9A 4PGCB 4UB0L 3Q5OA 4ZX6A 4KX7A 1UOVA 3FHAA 4HV8B 1XB8A 1W8OA 1OZTG 2FATL 1A1NB 1KJMA 4YR6B 1QFOA 3CSFA 1NCOA 1QWHA 4I5BA 2P5EB 3IJHA 3GSUB 4U1KA 1T04B 2QVFB 5I6PA 4E41B 4WW1B 4JR9L 4ZX4A 4JO3L 1JPST 1XF2B 3S4SG 4JHBA 1VKLA 5IOPA 4QRPB 3OKNB 4HIQA 3TV3H 4K23L 3NRQA 3UBXI 4Z8FH 5EIVA 3VGEA 4I48A 3KNBA 3U79A 1F0LA 5DR5H 3CG8A 4LLQA 3NDYE 1UCBL 3TYFA 4PJGF 2W0LA 2W65B 3QWQB 4OLEA 3C60C 3WXVL 5JZ7C 4Y16A 3VI3A 3ULUH 1WZAA 5JTWA 2DQHL 1KZYA 2AQNA 3CCHB 1XB3A 2A1WH 1RUML 2AABL 2NY0C 3CFKB 2F7PA 3D4YA 3FXIC 1EGJA 3H9SA 3QR2A 4LSUH 5D1QC 2P47B 3FRPB 3O6MH 5C07A 2Y69B 1N18A 1IFGA 1NJ9A 5EU4A 3BIKB 4XXDA 1I9IH 1FL6B 2GPZA 2YLHA 4QHNB 3MJ9L 2IWEA 3SDXF 2AJ3B 3MKKA 1EK3A 1AXSA 4L3EE 4RSYA 4HIPA 2D31B 1KLFA 3RG1C 1Z0MA 3NJLA 1NAKL 2MCAA 4QDGA 3WELA 4EXPX 1VCBC 2B4CL 1BQLL 4NIYE 4OCSL 5BMFH 1CR9H 2PPEA 4HUWA 2VXUL 4LCYA 4OR1A 4TPRL 4K3HA 4XNZC 5AW8B 1IZKA 5AYQA 2XN2A 1KELL 5AVTB 3TPUA 4FYSA 4KKBD 5C7XL 1TFPA 3G5YA 5CFAA 5E2VH 1MH5A 1HJCA 2AF2A 5JHLL 3DJRA 3QIBB 3QXWA 2MQ0A 2VDQB 2F68X 5GRZA 1H3TA 1BPLB 2XBZA 5ESVB 3UPCA 4YXHH 1PZUB 5AKSA 2GKIA 5EO0B 1OF2A 3GSRA 2X2YA 4OGYH 2Q20A 1SHXA 3QUYB 2XFGB 3EJQA 1A6ZA 2JIXB 4EXKA 5JUEH 3Q5TA 3T0BA 4H20L 2UZYB 5EOCJ 3OHXC 2GJJA 1ZPUA 2D3LA 3C8HA 5F0JB 4W81A 5IMMB 3FO9A 1HH6A 3SD2A 2LT9A 3MYJA 3OR7B 4YBLC 1ZDSA 2WWKO 1CL7I 2ZCZA 2VC2L 2CIKA 4PWJA 3ZL2A 2NX5A 5D5MB 1VOKA 1ZLDA 4WO0A 1YYLH 2X5PA 3FUIA 3MLYH 1T20B 1R3KA 1WEJH 1BA9A 1EV2E 1OB0A 5FUZH 1A7QL 1XF4A 4NRYA 2B9AA 5E1IA 4JFHE 3GMMA 1IBDA 2X4UB 3BW9B 3UTQA 4D8OA 1K5WA 4MBOA 5DWUH 4E5XA 5JORA 1S8DA 3TO2A 2B1HH 1IAIM 2VDOH 3FFCE 2FECI 5HI5C 1GA2A 4I87A 2X4PA 1E6JL 1E4HA 4YDNA 5D7HA 2EADA 4K71C 2QLVA 2BIQA 4BRJA 4LVOC 1A8JH 3MRPB 2WLIB 3GUTA 2MWCA 3DMMC 3ZE1B 3KS0J 5GGTH 1YZZA 3AQYA 1PEZA 1SBBA 2XWJA 2YJQA 3PNWB 3F10A 2KHAA 2QPEB 5FA4B 1T6VN 2EIDA 4FQXD 3FQRB 3AABA 4ZD3H 3HG0A 1WVZA 1DEEA 3SYOA 5KS9A 1INEH 2V2TB 4Y9GA 1UWXK 3L95B 3Q8EA 3M1BB 4QHKI 4RGND 5ISZD 5FUCE 1JZFA 2BS71 3FONB 4KK9C 4XNQA 1AD9B 4NZUL 4PLNC 3BPNB 1UT7A 3QPXL 1PYWB 2XFXA 4FNUA 1ACYL 4TRPL 1XH3A 4PRIE 2M26A 5AKTA 2A9CA 3WNMA 1I8IA 3GHEL 3SDDA 1C12B 4ZUWB 3NTCL 1SHSA 1JDYA 1OSPL 4BZ1A 2DKSA 2J7LA 3IDNB 4LHUD 5ANME 1FYTA 4DGYL 4EKXA 1DBBL 4DP4X 4AYBA 3I6LE 1CLOL 5EO1B 3ILDA 3UAFA 5DHYA 4HCRA 2ZOUA 5EBMA 3S36L 3LB6D 3OPZH 3QFJB 3ULSB 2QQLL 4FE9A 4G6MH 4NZRH 4OFDA 1F6AA 3VXMD 4F57H 1NMBL 1CLZH 1J8SA 4H40A 4M62H 1MPAL 3MI6A 1BEXA 1BF8A 3L9RA 3B9DA 5KTEL 1JF5A 1P4BH 4PRHA 3UTTD 3D85A 2VQ4A 4BSWB 3BP4A 2A0LC 1RFDH 2IOOA 3EW3B 5L2KD 2DY2A 1A6UL 3H3BC 3EDDA 1YN7B 5LGYA 1KJMB 2Y5EA 1NDMA 3TFKC 2J5WA 4Z77A 4I5BB 5G4OA 3C12A 3NH7L 4AJVA 2W91A 4NUJB 5SWZA 4HAGA 1TBPA 2FZ3A 1WUNT 2YQ3A 4OGAD 2B3IA 2YMXH 3TJHC 3BN9D 4KRPC 4J3VA 3VUAA 5DJ8A 1E3ZA 1GPOL 2I9TA 1K4CA 3UG3A 1I7TA 4JUSA 5DD3H 4I48B 3TZVC 4LLQB 3RX5A 4X7SL 4IBZA 3GYRA 3TYFB 3VFVA 3NIFB 1MP9A 2WBJA 1OCZB 4APQB 4ELMF 2EXSA 4Y16B 4G9FB 2EUZA 3DTUB 2P8LA 2TSAA 3VI3B 1A47A 4XMLL 1A22B 1AY1H 3WSQH 3QYMA 2IH3A 2ZWYA 3BRDA 2FT7A 2OP4L 3MRLA 4XZ4A 2VN7A 3CGTA 5I1GH 2GI0A 3H9SB 2WNWA 2LLNA 5C07B 4UQEA 1NJ9B 3VRIB 2BINA 4JFFA 4E9RA 1Z9LA 5FYLD 1AXSB 3Q01A 4WFGD 2ED9A 3WNLA 1KLFB 1L0XA 2NY3D 1GS6X 3NA5A 2OMUA 3MRNA 5C0GA 5CIPH 3K0WA 2PCFA 4M8QA 1EZVX 2GBTA 3TPUB 1Q1JH 1A21A 5I6MA 3IGLA 3BMVA 3Q7JA 3L5HA 4Z8FL 1WIOA 1MH5B 1J9QA 5DR5L 1HL8A 1UOWA 4I3RH 1UB6B 5I26A 4ODWB 5KSVA 4OJEH 1J9CT 4DP0X 5BUPA 5BVPH 4JGUA 1OF2B 3OAYH 3GSRB 1G94A 2WXGA 3QORD 1WT5C 1A6ZB 5DVLA 2CRIA 3Q9PA 3ULUL 3BAKA 2BS8A 1PLGH 2E86A 4PJDE 3MJGX 3RA7H 2A9MH 4G43A 3FO9B 4RMBA 4LSUL 5DVOA 5GRUL 3WS6C 4GRWF 1JP5A 3AS1A 4IHOB 4JCMA 1MJUL 1NFIB 2BSDA 2PWDA 2CIKB 1I9IL 3C2AH 3MBXH 4P4KA 2NX5B 4JKNA 5IROA 1A6PA 3HG4A 4ZUSA 1JV5A 5CN1A 3RL1A 2Z34A 1R3KB 4EF3A 3O0RH 2ROYA 2NXYD 4DP9X 4IKLA 3PJLA 1ETZA 1XF4B 4NRYB 4QJ4B 5MENE 1E3FA 5GGQH 5BMFL 1CR9L 1EXUA 5CMAA 3CZJA 4LCWE 4YDIH 1ZA6B 4E5XB 1KV7A 4LXFA 1UM5H 3VMOA 1CS6A 1S8DB 2F54E 4MNGE 1FLTX 3WI9A 2YD5A 3FT4A 3QDGE 4PLJC 1BZ8A 4YE4H 3VGFA 1FGNL 2G60H 4YLCA 1BECA 3NCYS 1OB1A 4LKCA 5E2VL 2X4PB 3QIBC 4BJUA 2J6WA 2QLVB 1V3KA 4UTCA 4PVMA 4TF4A 4I9XA 2PWGA 5DRXA 3DHJA 4JPKH 4GKSB 1NCGA 3BDBA 2OW7A 4IU2A 4YXHL 1FZOB 4FA8A 5B3JE 5FV2A 4OGYL 2FNWA 5TDPB 3QI9D 2WC7A 3FQTA 4UILH 5JUEL 1PCMX 3SDYH 1EQWA 5E8NB 4I0PB 4B97A 3H53A 5KS9B 4EQ3A 4OJAA 3H9YA 2P48B 5K93A 5BVJB 3ZUNC 3FT9A 4NIKB 4AYSA 4MNQA 4GMTH 1OALA 3KWUA 1AI1L 2XFXB 5ANHA 1XH3B 3VWKA 1OWRM 2W0KA 1I8IB 4UM9D 3MTRA 3I9GH 3SDDB 2QPFA 2A6DA 2NY2D 5F9WB 4ZW6A 2LFGA 3KLAB 1TKWA 1ZDQA 1I8KA 5FUZL 4YSEA 1N8ZA 2X0VA 1N8OE 2DM4A 4ZUTA 3V6OC 4PJXA 1CXFA 1FYTB 4NUGH 5DWUL 2H4LX 2ZCKH 3L5XH 4CU7A 3LH8A 1IC7L 2B1HL 1Y6NR 3KLDA 1RJZB 5AW9B 4H44C 5EBMB 1PU0A 2Y5QA 4JS7A 4NLHA 4ZS6C 2V2WA 3VXRD 3VDCA 1PCZA 4XWOD 1LMIA 5L2KB 1WIPA 5EWIH 4D9RD 1OV8A 4XCFH 3RIFK 1CE1H 1OAUH 3FUFA 2EACA 3L9RB 1GMEA 2CK0L 3D85B 2EABA 2P24A 3BP4B 3FBQA 5D7JC 3CX5K 1URIA 2CH8A 1INEL 2H26A 4L0YA 4NCC2 1ID2A 1NDMB 3E6FA 4Z77B 5DO2D 5ABZA 5C0AD 2EIKB 5SWZB 5KANI 1UQSB 2FO8A 3BJ91 3K1KC 3DLQR 5D1XA 3L17A 4KRNA 5BQ7A 2G0LA 5JNYA 3QZWA 5T8IA 1MRCH 5DJ8B 4KWUA 3U46B 4PWEA 1K4CB 2EEBA 4IDLA 1I7TB 1NGPH 5A6LA 5AVRB 2ITFA 3ZT5A 2CMRH 3MODH 1MW0A 3LXUX 4AMWA 4QXUH 1JFQH 1T1WA 2V5TA 3CXDL 4NQCE 2P8LB 2QGBA 1JXJA 4DUVA 4XOCA 1L7TL 1OGPA 2OJEA 3MRLB 3MRGB 4G6ML 4NZRL 5FW8A 1OCCB 4OF0A 4M62L 1JAEA 1P4BL 3JYCA 4S0HA 1MWAA 3CVHH 4JFFB 3L4WA 1U3HC 1J0KA 3PL6D 4HKBB 1HX0A 4GUCA 4WI8A 2H2PC 4Z7VA 5BZWA 1AP2A 1XZ0A 1J8HA 2OMUB 2VLRE 3B9KC 3MRNB 3PG2A 4M6AA 3T5WA 2XA3A 1W0VA 3HC3H 2PCFB 5JQIB 1OPOA 4M8QB 5HYSA 4QXGH 2ADGA 4MD5A 2VH5H 4ZJ9A 4HJUA 5EEVA 2YMXL 3S4SB 2BWDA 4PJIE 5CZXD 1PMYA 3SKJH 1HHJB 3BH8A 3FU5A 1JYNA 3QUZD 5BRZA 1AKPA 5DD3L 4HJIA 4J3OG 2CHWA 4XNXL 4KJPC 3T0XA 5LLIC 3AG3B 1ZE3C 5KSVB 3SPHA 5SWSE 3HG2A 3K74B 1OHZA 4B41A 1MUJA 2EDQA 4LCUA 1F5WA 5TK2A 2OKMA 1O6SB 3N40P 3RWDA 4H1LA 4I0CC 1AY1L 3MRFB 4W9HC 3QC6X 3N1FC 4G43B 5I1GL 5JHBA 4M61A 1CFSA 4R7DA 5D93C 3BD3A 4YMPA 4N86A 1SHMA 2OMBA 3BDYH 3CHRA 3EJYC 3MU3A 4AW4A 4QAMB 3VM5A 3F84A 3U2JA 1UXWA 2I9LA 4ZUSB 3RGVD 1JV5B 3NCYP 3QEQD 3RL1B 1VPOH 3LZPA 3F7PC 3RFZA 3U4AA 4PWGA 3D2UD 3MREA 4AEFA 4KQ0A 4P06A 3T08A 1ETZB 2N01B 4DKEH 2LFEA 3HG1D 3DXAD 7PCYA 3LNGA 1EXUB 5CMAB 5JIIA 3VI4B 2ADFH 1KB5L 3GB7A 3KBEA 5ILTH 1JFIC 4XP4H 1NCIA 4WEUD 3FK3A 2KS0A 1IJNA 3FT4B 2HFFA 1Q1JL 3H7BA 3GKWH 3G5XA 5EZOH 3FTGB 3IJYA 1UD8A 5LNEA 2GC7C 1OB1B 1S9XB 4LKCB 1PVSA 3OLEA 1N5AB 3TOPA 2VR5A 2KERA 4UWQB 3QZBA 4I3RL 4N0RA 5DRXB 5F89B 5J6SA 1MFDL 1RZ7H 5MHSD 2VDMH 5GRVL 4XHQA 5BVPL 4YXKH 3BVVA 3W9DA 4IKJA 3IU4H 3V5HA 5B7EA 3FQTB 3SKUD 4W9IC 3L4UA 3CFBA 3OX8A 3TT1L 2CKNA 1PLGL 4GRLD 2NY2B 4OJYA 3RA7L 1XBRA 2DV6A 2A9ML 3F6LA 5F71A 4BV1A 1AGFA 3S8GB 4MNQB 5E4EC 1T0NA 2PXYA 3C2AL 3MV8A 3VWKB 2K78A 5LHDA 3K2IA 4LU5L 4TSCH 3NJHA 3STLA 2WMPA 3PUCA 4JRLA 1A1MA 3OGDA 3D4VA 4UQIM 2A6DB 4X0KB 4WWKB 3HE6A 2H8PA 2K6YA 2FX7H 2P8PA 4K5LA 5CSZB 5TF1H 1M7DB 1I8KB 1X5KA 4IRZH 1N8ZB 3HNVH 3TO4D 2HLFC 4JKPH 2HKPA 3ZK0A 5GGQL 1A66A 4YDIL 4QXTA 3T1FB 1IAOA 4U1HA 5EOQL 4R4NC 3QJFB 1UM5L 1OGTA 4Y1AE 5I6NA 1Z32X 1E50A 1S7QB 1BZ9A 2E9GA 4KQ4H 1UEMA 4LEXL 2XTLA 4YE4L 4CBZA 3BRFA 4AM0Q 2G60L 4WJG3 2V2WB 5DLMH 1KWKA 4UAHA 5E1HB 3GQFA 3WLBA 5GGUA 4JPKL 1SDAB 1FZMA 3LY6A 4YZFE 1FNLA 5FM8A 1YQVH 2WB1A 3MJ9A 1BFOA 2P52A 2J1WA 3FU9A 5IV2B 4CMMB 2WKLA 1WDAA 2IVFC 3DX2A 1S7TA 3FYEB 3EF4A 4UILL 1QSEE 1IO4C 4DW2H 3HUJA 2R9HD 3SDYL 3RX7A 2BIPA 3CSPA 3MV01 1IAII 4Y4KA 4W9LC 4P5TC 3NPSB 1O7VA 2P3YA 1J0IA 4ZUVA 3E6FB 4IRSD 5I5IA 5ERWA 3H2PA 4GMTL 2DMGA 1EH9A 1ESOA 1RP8A 1G0DA 3CMOH 4YBHA 3SDDC 4EJZA 3RGBA 1ZPLA 4A7GA 3I9GL 3DIFA 4TXVB 5CGTA 5D1XB 5B1AB 4FULA 5BQ7B 5JNYB 2CBTA 3D9AH 2BVOA 4L3ED 3T2OA 3K6SA 1VTLE 1BOGA 3AWFA 3CIAA 4S1RH 4YH6A 2KC0A 3IE9A 4HIEB 4OF7A 1HN1A 4JKMA 4NUGL 1EFQA 4OJCA 3TTSA 3L5XL 4QY8A 1JXDA 4IGBA 1TQCC 4LHJB 3ABGA 1MNNA 2TRHA 2DWEA 2E56A 2YEZA 1U8CA 5DZNA 4JKLA 4Y2LA 5EWIL 2FEEL 2OJEB 5CWSA 4DTGH 1CE1L 2CXKA 1TEGA 3SB3A 2DJ4A 2WBWB 1QZNA 1MWAB 5LO7A 1GGCH 1SVZA 3LIZA 1UOLA 4PIRF 3SCMD 4P5SA 5TQ0H 4FL4C 2YXFA 1X5FA 2CPCA 5E1QA 5EF2A 1QWNA 4TV3A 1AP2B 4KNTA 1XZ0B 1FFPB 1KFGA 2EILB 2C3GA 2IDQA 4Z7VF 4J3WA 4QF1A 3A23A 3VMNA 1JZ7A 3ZE2B 3VW3H 1W0VB 3PQYE 3IN2A 3KYAA 2ADGB 4MD5B 1JF1A 4MJIA 3KPTA 4CNIB 3SO3C 4Y8DC 2FWOA 3BH8B 5BRZB 2CLZB 1NGPL 1LEIB 1CICA 3B3BA 1QW8A 2CMRL 4FQLH 1D5MA 2WBJC 3MODL 4N0FB 1B0GA 2BMKA 2J5LC 1KENL 1LO2L 3Q3GA 4QXUL 3G04A 1JFQL 4X7DC 2ZE0A 1CDWA 1I85A 1MUJB 4FFZA 1JK9A 4LAJH 4LCUB 4LSVL 3ZTEA 3BESR 3FFCD 4JFWA 3N3EA 3L3HB 3K1DA 4H1LB 3RGVB 3BPOB 3W57A 4A6YH 3D2UB 5JW3H 1OLLA 4M61B 4V11A 1QABA 2BCKB 3TP4A 1M3IA 4IS6B 4R7DB 4AI7A 4ZSOE 5DJ2A 3ECQA 4WHCA 4N5ED 1CCZA 1L3NA 3CVHL 3JBG7 1T2XA 4AYFA 1PNCA 5F7WC 4KROD 2VDKH 4P3DA 2JCWA 2I9LB 4KZ0A 3WYRA 4OZGE 1R5VB 2ZOWA 3RFZB 3MREB 3NJKA 1M2OA 5FWRA 4TN9A 4B7IA 3TH4T 3LXCA 5GGSA 1TNNA 5IF0A 5J4MA 2YOCA 1Z5HA 3HC3L 2FGWH 4XAWH 2VWEC 4QXGL 3SGEH 2VH5L 4MXWH 3ZDYE 2XY2A 3D50A 3H7BB 4HEMA 3RNKA 4U1IA 5DQDH 3SKJL 3T2PA 4YHMH 1VADA 5K9QI 2HFEB 2AXFA 1BVLB 4PSRA 1AQDA 5DFVC 1U8IB 4FQQB 1COBA 4HJ0C 4DKFH 2MPVA 4MAYA 5HJGA 2XX1A 3W9DB 3I6LD 1MN4A 1ZEAL 3PHOA 3FCSA 4WEMB 4TQIA 3E1ZA 3T6XA 4ZTOH 3Q6FB 4IKKA 1NC2D 5L4IA 3CFBB 2K1MA 3OMNB 5D1ZA 1HC1A 3L7FA 5F70A 1JPFB 5HHOA 4J3OD 5JOFA 4YHZH 2A4ZA 5K9KA 1OQXA 2R8SH 1AGFB 4P4KC 1IC5H 5IROC 1T0NB 5JW4M 2PXYB 2IANE 3BDYL 3GINA 3MV8B 2GYSA 3G6JF 3UFIA 3STLB 2WMPB 2AFNA 2YA2A 3AM8A 4NC1C 1NEZG 5HVFB 3QJVB 5MERA 3FUMA 1W6LA 4JANA 4DKEL 3H55A 2YGPA 4KZEH 5BCAA 2ADFL 5B21A 4KNSA 3H3PH 5ILTL 2F8XC 3T8VA 4XP4L 4LLVA 3A24A 1BZ9B 4MTMA 3M88A 1NGQH 3WEBA 2OR7A 1O7DE 3GKWL 3D07A 4B7LA 1KTCA 5EZOL 1ZHNA 5I66A 1YQKA 5DD5H 1CBVH 1N9PA 2YGNA 4PD4K 3GM0A 3WLBB 5GGUB 2ZXDA 4GY4A 1RZ7L 2AZUA 2VDML 1BFOB 4YXKL 4HD9A 3OC5A 4GW4B 3DBSA 1BD2A 3IU4L 2R4RH 3SE3A 5DMYA 1S7TB 3OPUA 1ZVNA 2W9EH 1OLZA 3GMNA 4XTRD 2DJSA 2AW2A 1HJBC 4ROCB 1KZQA 1B6UA 4FADA 2ZF9A 4Y4KB 3U36B 1DBMH 3HUJF 4ZUVB 1TITA 4WWNA 4EN3A 3BH4A 2YPVH 3GMOB 3QVAA 2DLTA 4N2IA 3APNA 4PREB 1KIPB 5CR1A 1C5DA 5KVGH 4TSCL 3DIFB 3FKUS 2WVSA 4F1SA 1SN2A 1NLDH 2BVOB 2FX7L 4LLWA 5TF1L 1E65A 4M93B 3VD3A 4A7GF 1BOGB 3GEWB 1QP1A 2YKKA 4GUQA 3FZUD 3HNVL 4U1SA 2DIBA 2N0KA 1QLEH 4JKPL 1VGEH 4JQVA 4BH7A 3EG9B 2K6WA 2WQWA 2PF6A 3GJFH 4QY8B 4TKWA 1TUPA 1C5CH 1HWWA 5C86A 3WEMA 3EH5B 3RUGE 3FL7A 3H6AA 5H4ZA 1F18A 2CR3A 3KPRA 2V0AA 4FQPA 3ARGC 2DWEB 4QEGA 1P1VA 5DLML 1KC5H 2X4SA 3SKNA 4JM2D 2UWEA 5C0RH 2VC2B 4OCWH 4POZC 1WAAE 2E0PA 1YQVL 5FUOH 2IH1B 2Y2YA 3ARUA 5TTRA 3MRQB 4W4OA 43CAA 2W60A 3DETD 3IEAA 5IQ9A 3R0NA 5FX3A 4WTZA 2QR1A 2FO4B 3WTWA 3NPSC 3NIGF 4ZXBA 2WZPA 1KXQA 4X8JA 3FO2B 4O5LH 3C75A 4QF1B 1C9SA 2HKFH 5LGKA 4KBPA 2EH7L 1QSVA 4Q9CA 3CMOL 3ZE0E 1B9ZA 1KBGH 3N1MC 5D1XC 5E5MB 5ES4B 3D0AA 4MJIB 3VD2A 2OYPA 3EYQD 1AGEA 5ENWA 2WXIA 3D9AL 2O6CA 4PJ6A 1NIAA 2FWOB 4UUJA 4S1RL 1CICB 3JV5A 2C9QA 1D5MB 5MEND 2ZF8A 1B0GB 4LRNH 2WWKT 2BMKB 4XPTH 4LCWD 5LBSH 1H3VA 3Q3GB 3WHE1 2E7MA 3MO1A 4EAEA 1JK9B 3QDGD 2GY7B 5EPMB 2FQGA 3S48A 2V6HA 1HWGB 2A7BA 1LWYA 3BPCA 5LXGH 1ZLVK 2ZYRA 1P4UA 3BKYH 4DTGL 1YC7A 4JDVA 1ORQA 2WAHA 3EFFB 2EJ1A 2AKRA 4X4KA 3RWFA 1AZZC 1QHOA 3BWUF 1GGCL 2LU3A 1MCCA 1TZGL 3CU1A 4AYFB 4Z3JA 1A3QA 3SE8L 5TQ0L 3VU2A 4PRIB 4NO3A 5HI4D 1S9VB 2WYTA 1RUAH 2H1LM 3D6GA 4Z7QE 4HOXA 1ODAA 3CQPA 1M2VA 4N24A 2R2EB 2D9QB 2JB5H 5GGSB 2PW2A 1S7RA 2FJGB 5IF0B 1E4XH 3VW3L 4ZFZB 5FHBH 4ZS7H 1J1OL 3U4BL 1NLBH 4MQTB 5DHVA 3U7WH 2OPCA 2X4RB 1UB5B 3PWPA 4PD4J 4JRWA 3OHMB 1EPFA 3RNKB 5GPRA 1OD7A 1UXMA 4M1DH 1NC2B 4DOHB 1HYSC 4L37B 4G80B 5D7LA 1VADB 2JNZA 1T1XB 3GZQA 4C4KT 1AQDB 1F3DJ 1RUPL 5GGTA 2XC8A 5I1HH 4D0CB 4MAYB 1AOZA 2FR4A 3F04A 1OP5H 1U2HA 1NFDA 2Z0UA 4WFEE 1DUZA 2IBZY 4OCLC 3HIZA 2HT4C 3SKOA 3K7UA 4JB9H 2AK4A 1Q94B 2OMVB 1J05A 5EN3A 5JOFB 4HUXA 4A6YL 2IDSA 2JE8A 5JW3L 5K9KB 4XVSH 4PV9A 3R4DA 4K9EC 2ZKMX 4F3FA 1CN4A 3FB5A 2VLJA 3ARXA 1ES0A 2VDKL 3IBEA 2KMWA 5JIQA 2ZKYA 1NBVL 3DARA 4XMPL 3ULVE 4A39A 4ABQA 4JANB 4EDWH 1OTSD 1TQTA 4UT6A 2Q9OA 4W9GC 4TTGA 2P8MA 4TOYH 1MZZA 1SLXA 2AJVH 4LCCA 3VFOA 3ULVL 3SDAD 2FGWL 2QRDA 4XAWL 4LLVB 4KFMA 1P4LA 3E8VA 4MXWL 4P9HH 3SN6N 5KZCB 3T65A 1N0LB 4WVRA 5HYEA 3TBSA 1ZHNB 1ROCA 5DQDL 1K8IA 1T89C 3J8F7 5I66B 1R34A 4W6WB 3HRPA 4NZJA 5EZLA 4YHML 2RBLA 1N68A 4AQEB 4M6OH 4XMZA 4JFDA 2JKLA 1E5UI 1KTLA 4BM7A 4UIMB 4DGVH 2FDBP 4JG0L 2FB4L 4NQCD 4ZTOL 1WCBA 5KAQF 1YEGL 4E9QA 3QUXA 1HCFX 2AJUH 4X5PA 2JJVA 4FN0A 5AW6B 4DCQA 2JLLA 1OCRB 4YHZL 4HJGA 5DEGA 3A0OA 4EN3B 2R8SL 1X6NA 2PTTA 4PI2A 3AQZA 4I7ZC 4WW2A 4FS0A 4PG2C 1MCBA 2NXZB 1C5DB 3HE6C 1BBJA 3N0AA 3FYIB 4XX1G 3PWJA 4LLWB 4MA3A 1LK3H 3NK4A 4C4BA 1T4KA 2ZUQB 4OUUB 2E6QA 4U1SB 1SHWA 2VLRD 4KZEL 5F8RC 3H3PL 3BE1H 3AWGA 3FMGH 1NGQL 1JI1A 4Q74A 2ZCLH 4Q52A 1AGBA 3KPRB 4AH2A 5IVZA 3C6SA 1YMME 5CJOH 5DD5L 4X83A 3D69A 1CBVL 1WS7A 2X4SB 3OGCA 5DEZA 4F58L 3SKNB 3GZPA 1NWOA 2EIMB 3L5WA 3NCWA 4XR8C 1TZIA 1LWJA 4PGDB 3OJDA 3ABLB 1RK1A 1BF5A 2UWEF 1F4WH 5SWSD 3UTSE 4RIRA 3V0HA 1QNCA 43CAB 5IQ9B 3L3JA 3B1UA 2W9EL 1HKLH 3MBED 2X89D 2O6DA 4Y4KC 1DBKH 2XXMB 3HPLA 4G7SB 1AMYA 3PREA 4GO9A 5CIPA 2YA3A 4ZXBB 1L7IH 4X8JB 1RL1A 2AP2A 1OAYH 2Y22A 1AKJA 5I18H 1VFOA 1TVBA 5MENB 2RGSA 2XN9A 4LCWB 4OFQA 5AAMA 2DWYA 4R5XA 3H2WA 5D6CA 3V0FA 1AGEB 2F54B 4M93C 2VMFA 1CDCA 5ENWB 1NLDL 5E4IA 4UUJB 5I6OA 5GS1C 1NCWL 5AAPA 3BQUD 1I7UA 4R9HA 4QOKA 1ONQB 1QLEL 4N85A 4R0LA 4PVBA 2HL8A 4M5YH 4HH8A 1VGEL 4N1CA 1NGZA 4IGBC 4HUUA 5D4JA 3X14A 5IFAH 2YAEA 4B0MB 4F8QA 3UEQA 4N2EA 4JJ5A 2HAZA 1XFPA 3LQMA 5CNHA 3WAJA 2FEDD 2OXHA 1MOEA 4NM4H 1B3JA 3BPCB 3N04A 4KKLD 4PJBA 3D39A 1KC5L 3DX9A 3HN3A 1IILE 1K6QH 3CDFA 5HDQL 5C0RL 2VCOA 3BO8A 1KOAA 4JDVB 4OCWL 4ZBJA 2FJSA 1ORQB 5FUOL 5HDBF 1WUZA 2UYLA 2AKRB 4LP4A 2DYPD 3RWFB 1KBPA 3H8NA 4KDTC 1QATA 2E76C 3CH8A 5J13C 1JGEA 2XRAH 4WWOA 2CGRL 2XA8L 4GG8B 3UC2A 1XGZA 2D9CA 3LMJH 5HHPB 4G70B 4B9FA 3FSVA 1UG9A 4NT6B 5EU6E 1M2VB 1PFCA 4O5LL 3G5ZA 1L0PA 2PW2B 1K9TA 1A6TA 2HKFL 2VW6A 2VDOB 3B9EA 4IMKA 2VKXA 4NN5B 5AZ2H 1KBGL 1XL6A 1M7UA 3LS4H 3T0WA 2FL5A 4WKZA 4NP9A 5IJVB 3U6RB 2Z65C 3M6DA 1CICC 3TNMA 2XHNA 1YEFH 5D7LB 3SPJA 5EFIA 4ZAKA 2JELL 2Z8VC 2BRRH 4XPTL 4LRNL 1KB9K 2BFVH 4Y1AD 1J0YA 1U95A 3ETBF 2FR4B 1BW8A 3CVSA 2PYEE 1NFDB 4NQQA 5J12B 2FHBA 3ZUCA 2J44A 1ZLUH 3NJVA 1DUZB 4AYEC 4Z7UA 4CW1B 5LXGL 2VJ8A 1CDIA 3BWUC 3BKYL 1ILUA 2CJUH 4HUXB 3UO8B 3DYPA 4Z78A 4PV9B 1UM4L 3RPIA 3GXMA 5IJKC 2F5BH 4F3FB 1JNHA 1NTDA 3FB5B 3D4ZA 1E9PB 2CO1A 2VLJB 3CPLA 4DKAA 4BUHA 1QSED 4Y2OA 1CUOA 4UBDD 3CU7A 3CW7A 5I76A 1NBYA 2IPTL 5ITBL 1XGRA 1RUAL 3HOGA 2DQMA 5EEYA 5HJBA 2Z9TA 2IXQA 2P8MB 3SZ6A 1E4XL 2R69H 2QSTA 5FHBL 4ZS7L 3DUUA 4W9DC 2BHFA 1TG8A 4A2FA 1PZCA 1NLBL 1P4LB 5IZ7A 3U7WL 4NXSA 5DD0H 2VMEA 4Y4HD 4MRCA 1MCDA 1KCBA 4M1DL 3Q9QA 1YNTF 5I30H 2DQUL 2J8OA 4K5OA 5EZLB 5J06A 3C09C 4BCXA 4MAYC 1EJFA 3Q2WA 4FQHA 5C0CE 3SQRA 5I1HL 5IW1A 1AH1A 4TVPE 2HUEA 5AWNH 2I5YH 2KLTA 4XOBA 1PAMA 2X41A 4YHPA 4UQDA 5D1ZC 1WCBB 1L9MA 5E0QA 3ML9A 3QNXB 3QQ4A 4JB9L 2ZYHA 4NN6B 4Q4EA 3AXLA 3G5WA 3ARRA 4DCQB 3IDYC 2JKSA 2OMYA 3F0ZA 5DEGB 4XVSL 4E9VA 3IYLW 4CJ1A 3V0GA 4KY2A 4NX0A 3LKSA 2WVVA 2K4WA 2VLRB 1F4YH 3RJOA 1J1XH 3MZTA 4WW2B 2MEJB 1L5GA 2LAEA 3WU1A 4TLSA 4FKHA 4OF8A 4AVKA 2Y8QA 4AK2A 1TYJA 1NM9A 2D8KA 3HRZA 1BZEA 3S0PA 4MA3B 5E03A 5EBGA 3B43A 4JQIH 1F3RB 1QUNA 4XCYA 1NEZB 5JHMA 3ZR6A 1URLA 1T4KB 4PJIB 4JFOA 4PVLA 2DBJA 4U05A 5FGBC 2DMHA 4EDWL 3B3IA 4TOYL 2AJVL 4CA4A 1T7WA 2DIAA 3PQYD 5SV4A 4P9HL 2BVYA 3ARDD 3ES6A 1AGBB 2B16A 1WZKA 1AXIB 3MA9H 4N25A 4LOUC 1MW3A 2DD8H 3QWRA 5T1KD 5IQOA 2E7LA 2NNRA 3C6SB 2NRDA 3D69B 3OGCB 4AK1A 2ETWA 3KPSA 4M6OL 4P59L 1DR9A 4YDVB 5D7IA 5TH2A 3L5WB 4LCVA 1ZANH 3TPKA 1TIUA 3SE3C 1RK1B 2OMXA 4DGVL 1QR1A 4MHHG 2F19H 3ATDA 3L3JB 1JZ6A 3VXUE 3GRBA 2OULB 1B0IA 1F4AA 3NDZE 2AJUL 3T4NA 1NEPA 5CIPB 1OE2A 2GCYA 1U41A 2RQ8A 2YUWA 4EN3C 5K9OA 4WSJA 4HIXH 1OXYA 4YFLF 3GXDA 3S97C 1T7XA 4XVUC 1TVBB 2BVTA 1UD3A 2XQBH 3I50H 3LPGA 1A3ZA 4YK4C 5D2NE 3ARBD 3CZSA 4R3SB 1CGYA 4K7FB 3QIUA 3LOWA 2XZQH 5D5MF 5D6CB 3U2IA 2EE2A 1CLVA 4OW6A 1LK3L 1X5XA 2VR6A 4N1HB 1KB9J 4ZG1A 4NQDA 5LG6A 2GG1A 4JQVC 4FNQA 4QHLA 4OD3H 1BZ7A 4R0LB 2YZ8A 1HH9B 1NGZB 3L9EA 2Y06H 3MFFA 4HUUB 5HYJE 3X14B 5C2UB 1JRHI 1B88A 1F58L 3BE1L 3FMGL 2XZAH 2ZSWA 3QNYA 5KSBF 1DQJB 4ZMLA 2ZCLL 3W3BA 1G1OA 3WNPA 4N0YH 5AD0B 4JM4H 5CJOL 3D39B 1S7UA 2XTJE 3DX9B 5DDHA 3CPUA 5ISZA 2ZCHH 2UYLB 4W4OC 4ZOBA 1F4WL 4PTUA 4BFOA 5AVZB 3REWA 2ZD0A 5E8PB 3DIDA 2VLLA 4TVUA 1I8LA 3FFOA 1JGEB 4NUQA 1HKLL 2VSCA 1QFUH 4ZXBC 1DSWA 2Z35A 3ESVF 4JO5A 3SHSA 3UGUA 2DLFH 3ML8A 5DRWA 1CL7H 3G5ZB 5I8KL 3CH1B 1B4RA 1A6TB 3S37H 5I18L 2W5PA 1M05A 4KKQA 3GBLA 3CHSA 1GHFH 2IAND 2FL5B 3QK0A 1UWFA 2V33A 4WFFE 2OXGA 2JVUA 2WZAA 2PMZA 1HILA 4ODSH 4XPFL 2QZ5A 4YE0A 3DOSB 3L2LA 4GG6E 5EFIB 3B2VH 4ZAKB 4S0TD 4M5YL 5D2LA 2X2IA 1SF3A 1IKOP 1O9VA 1CURA 5IFAL 4LKXA 2ESVE 1Q8MA 1LHZA 4Z7WA 5I8OH 4HZ1A 4HPYH 1X9UA 4XHJD 4OGZA 1PKQA 4AQ8A 3ALPA 3GFUA 1QSEB 1Z3GH 4WUUA 5E9DA 4GW5B 2DWTA 3S3SA 4Z7UF 4EZJA 1K8DB 1GVIA 4FABH 3WKQA 2AITA 2NYYC 4Z78B 3RPIB 4XB7A 1UKSA 3JZYA 2B3RA 2XIBA 4KO5A 2NWVA 5C7ZA 3CUPA 43C9A 1QR4A 3CPLB 2VUYA 1IAMA 4F37K 2JJWA 2G3NA 1VEPA 3RHWF 2XRAL 1AD0A 1SZNA 5EO9A 5EU5B 4Y2OB 2ZYSA 4IRZA 4PJ7F 3LMJL 1MRDH 5ICZB 5I76B 1NBYB 4Y4HB 3S6CA 3ZDXF 5B1KA 2DH2A 1XGRB 4Q6YA 2A77H 1A5FH 1KJVB 2QL1A 2EIBA 5B39G 2VW7A 4BQ9A 2FUQA 3RWCA 2CUIA 4DN4H 4R96A 3SY0A 2GAZB 5AZ2L 3DGGA 4MJ6A 2EUWA 1EUUA 3LS4L 3DUUB 3MN8A 4F93B 3QZMA 5FS5A 1TVDA 1KTDA 3I75B 1EZVY 1YEFL 5J56B 4BDVA 1NOLA 3OSEA 4FFWC 4ILDA 5DVKA 5T1MB 2BRRL 4FQHB 5FM4A 5IW1B 4BA0A 1H9VA 2ZNXA 2BFVL 1W72H 2R83A 3D12B 3HB3D 3NIFF 4R2GD 5D4HA 4I8DA 2WZ6A 2APTA 4BFEA 4LO9A 1BYPA 4EO5A 2NR6D 5IHBA 2WY3B 3QQ4B 3QDJA 5CGYC 3WTUA 1MHEA 2IOIA 2CJUL 2OMYB 3BSZA 3LKSB 2WVVB 2F5BL 3ZZ1A 1HHHA 3VFGH 5GZND 1L5GB 1JZ8A 2C5DC 1LK2B 2CJTA 4IRJD 3TJEH 4WTXA 5FFLA 2ARWA 3MV7E 2JCCF 3CZLA 4NRXA 1GGUA 1OW0C 4QRRA 1L9PA 3K2UH 4PJHF 4XCYB 1QUNB 4WIQA 2NCEA 3PPSA 5HHNB 4LCCC 3A6CH 4H0IA 4D0DB 2R69L 3F85A 4OBRA 4FNTA 2PP7A 1UD5A 1T66D 3UPAA 4OCXH 2BWQA 1AQMA 4M1GH 3VQLA 2QGDA 3FFDB 4GQZA 4BQBA 5DD0L 1HT6A 1Y6MR 5I30L 3DVFA 3W56A 3KPSB 2COQA 3CVHB 5TH2B 1YA5A 1F86A 1KACB 4K3EH 1JGLH 2R7EB 3FCTA 4U1LA 1PZBA 2OMXB 5D7IF 5AWNL 2VXQA 5H94B 2YLKA 4L3CA 1Z3RA 2DMBA 3QUXC 4NKMA 4EZKA 3P4MA 3V7AE 3VMPA 3T8XA 1CD8A 3NZHH 4PJ5A 4PN6A 5BZDB 1URZA 5T3XH 4YSCA 3L54A 2GCYB 1DQQA 2XN0A 4Y5VA 3KLQA 5D8JH 3ZIYA 4WW2C 2H3KA 3OLDA 3CSYB 3ZQWA 2BHZA 1F4YL 4QRBA 1J1XL 2XQYG 3M17A 4BZ2H 4ZTEA 1B3IA 4HSCX 2HZMA 3QIUB 1DDHA 4RRPG 1BJ8A 2BOCA 1N5YH 1OGSA 2X2UA 4JQIL 3RX9A 3TURA 4LLAA 3GBEA 2R56H 4QHLB 3QXVA 4KVNH 1CGXA 1BZ7B 4AKQA 3QZOA 1KCUL 3RIAK 3BAWA 2KPNA 4CKVX 4YLBA 3MRBA 3VXPA 2WTPA 3C04A 2KLSA 2Z4QA 3QNYB 3HKFA 4QRUA 3FULA 1GIGH 3N85L 5I0DA 3D30A 4A6YA 2DD8L 2EVGA 1N3NB 2EINB 2XWEA 3Q05A 4BWUA 5AVWB 3WUZA 5E24E 5TFSH 5DDHB 2GT9A 1ZANL 4WQOA 5DJ0A 2HX7A 1ZMYA 2Z4TA 1TJIL 4QRQA 4KXAA 3P11H 3O45B 1KGJA 2JWYA 4NO0D 2VLLB 5TGBA 2F19L 3KD4A 3MCG1 4J8RB 4WFED 5E7FA 2MTPA 1YCSA 3NFPA 4KK5C 3QNFA 5EU7E 2Z35B 3QT2A 5DMGC 5I1EL 3CN2A 3N42B 1UH2A 4DO5A 4DUXA 4HIIA 5AAMC 4KXDA 3NJMA 1G84A 1M05B 2XQBL 3I50L 4U31A 3CIQA 5JXEA 1TLKA 1XIWA 2XZQL 2OXGB 5BZXA 1N4XL 1D6EB 5G4MA 4A7UA 3EYFA 4EUPH 2F0CA 4FOMA 2Y5TB 4KV5E 5IHWA 3ULVD 2E74C 3QZPA 2VDMB 4KHXH 4DEPB 4R0LC 1VEOA 4OLXH 5GZOA 1B2YA 4HK3N 3FT1A 3UJTH 1TZAA 1TNMA 2WN2A 3JTBA 1NIDA 5TE4H 5E2WH 2IO5A 2Y06L 4YDJA 5IHUL 2XXCB 4LKXB 4I13B 4L2YA 2XZAL 4UAOB 4Z7WB 4K9JA 3O3DB 4KNUA 2DKMA 3FU0A 4HWBA 2FGZA 1PKQB 4GW1A 1QAWA 2ZKXA 4N0YL 4JM4L 5E9DB 1M3JA 5IVXA 4Y4FA 5GS0C 2K7QA 1FDLH 2YRPA 3D3VA 3BYTA 3OG6B 1A9VA 2VO5A 4G7YH 1WC7A 3CUPB 3KPLA 4PLKC 2O61A 5HI3C 1AD0B 1QFUL 3L7EB 1CO1A 5E6ZA 2V3FA 4G6KL 4RWYH 4YC2B 2IMMA 1G0YR 3V4PL 1P9MC 3ZLQC 3B2UC 1JHTA 5TDOA 1QFWM 4E68A 4LK4A 3U4KA 3VTAA 1JPTH 4BK4A 4IMKC 3RWCB 4LQ1A 1DCLA 3S37L 3ZZQA 4R96B 3U30B 4N8CH 3SY0B 4WNSA 4GB9A 3ZDZF 1XF5B 4MJ6B 1GHFL 3K46A 4N2GA 3QRFM 5L9DH 2EXYD 2ADYA 2IGFH 2FJFA 3F58L 1BYOA 2G9HB 4E42B 1FFNA 1I3RB 1UD4A 1ZSDA 3GI9H 3RUGB 4ODSL 3V9CA 4PJAF 1KXVC 1XF3A 2K3TA 1ZT4A 3B2VL 5LUMA 4Y5YC 5BO1H 2QZQA 3W37A 1X4ZA 3KBPA 1FI8C 4DFIA 1N70A 4APXB 2OW6A 5I8OL 3AADB 3TH3T 4HPYL 4LPYA 3WFZA 4BH8A 3CC5B 3SJVA 1NGWB 2EE9A 3KJ4C 4NPYA 3EYSH 5FGSA 3SQOH 2YPVA 4ZO6A 1YMMD 1A9BB 4PGEA 2E9BA 3QDJB 1YY9D 4PMFA 2XPYA 4FABL 3SE9H 4KDVA 3UZQA 4YSUA 1NPJA 3NZSA 4B9ZA 5F7KC 4AEHH 4JFEE 4N87A 1RK0B 1HHHB 2AMUA 1XHHA 3UTSD 4EN2A 4GEJA 4LLDA 4AZ8A 1RAMA 2VJXA 5HGDA 2CO6A 3OGOE 3T6VA 2K3HA 4NDMA 4J3UA 1OO2A 1MRDL 2NY6D 4NRXB 3UP6A 3QUZA 4FXKA 1IFHH 2A77L 1QRNE 1SJEA 3GJFA 1A5FL 4S11A 1Z9NA 5D71H 4BQCA 1LXTA 3BEVA 5B39A 2YBRB 3MLVH 3DHPA 4DFHA 3LN9A 4MASA 1E8WA 3CFDB 4NRZA 1ZJAA 2RB8A 2QR0A 1W2KT 3BKJH 1ZV2A 5CFHA 4XB3A 4F5CE 3KTUA 1FF5A 4DP2X 1EUVA 4U6XA 1MCPH 4AKOA 4B9IA 3N43B 4JRYA 3FCTB 1W72L 4U1LB 1A7BA 4OVUA 3AG4B 4RDQG 2EP6A 4NKMB 2QTVA 3P4MB 1QMUA 2AEPH 1UTDA 3T8XB 4PY8J 2G4EA 4PJ5B 2VISA 2Z6FA 1YHPA 3O8XD 2RMNA 3T3MF 2C9XA 2W81C 3B7TA 4FCAA 4LAQH 4PJCF 2OTUA 2OSYA 3DXAA 4JFPB 1NUGA 3IPFA 2ZXAA 4W1TA 4MD4A 5D6DA 1IGJA 3VFGL 4KKBC 1ZVSA 3M17B 4XCNA 4PCKA 4LL4A 4N20A 3MGTB 5EA0H 3HRZC 4K15A 3TJEL 2FNBA 5HBBA 4JFQA 3M45A 5F7HA 3EAYA 2DQDL 2BOCB 5GRVK 1QBAA 4YVNA 3UG4A 5KJ7E 3K2UL 3HMWH 2VIRB 2PR9A 3OAYK 5LBSA 3RLSA 5EU6D 3WS3A 4E0RB 5DURB 5IHLB 3A6CL 1SXCA 1LWVA 4J23A 3TN0A 4OB5H 3MRBB 3VXPB 4HH9B 5GSRA 3AS0A 4M1GL 3D8MA 2BY1A 1NA8A 3DYOA 4RFNB 3VG9B 2XV2A 1UYWH 3ARFA 2OJZH 4A6YB 5FDWA 1YEHH 2CHDA 2W9DH 5E9AA 3PRZA 3CWGA 1UJTA 3P3TA 5DJ0B 5KYWA 2W1NA 4K3EL 4N6RB 4KNQA 2VDKB 1P6WA 3SSGA 2JHNA 3B2MA 4QR7A 4QRQB 4ZZFA 2Q6WA 5TGBB 4J7RA 3WY3A 2PYED 1BAFL 2ORBH 4KH9A 4NZDA 3NZHL 4UI2A 3WXWH 3CWUA 4IOIB 4KXBA 2E9IA 5T3XL 1BQHG 3T8MA 3V0DA 3KE0A 4G1MA 1YQ2A 4GAYA 5D8JL 4DHLA 4XI5C 3CWAA 4HIIB 2PKDA 3HLAB 1HXKA 3QJXA 4BZ2L 4WNJA 1P4IH 2XQYA 2PTUA 3TEZA 3OZLA 4L3AA 4QGYA 1XZWA 1R19A 3QFGA 3VWJA 2LAGB 4RRPA 5A7BA 4AG4L 3GS4A 1QSFE 2R56L 1ASOA 2K70A 3DX6A 5BV7H 4J4PD 5FYJH 5MEQA 4LPTA 3BZDA 5IBUG 5F3HB 3FCBA 4X4XA 5J11C 4WDIA 1I7ZA 3FO0L 1WBYA 4LNVA 4QIRA 4UOQA 4Q14A 5CEZH 1VFAA 4P5RA 4WI0B 1H8LA 4MZIA 1GIGL 3WMQA 3NRPA 4GW1B 1XXFC 2DQTH 4KRMB 1CJYA 1KLGA 1ICTA 1SEBB 2Z93A 4EKJA 4NCDA 4Y4FB 5IVXB 4NN7C 5TFSL 1SUHA 2VB5A 5C0CD 2H7WA 3D3VB 3NSFA 1A9EA 1HSAB 4TVPD 1I8LC 1WC7B 4UU9A 3KPLB 1E28A 1LE5A 2O61B 3B8SA 3E2HC 2Y1VA 3V2AR 1M6OB 4DZBA 3LEYH 1TJGL 3P4OA 5CUSH 1N26A 1SJVA 2JTYA 1JHTB 5TDOB 3DYMA 4LSSH 3INUH 2X70B 3EADA 4MRQA 1EAJA 3G6AA 3NEOA 1HESA 4S2SB 2M2DA 1OCWH 1FFNB 5IM7B 1ZSDB 1OTTD 2YGVA 3KEHA 3STBA 1CLCA 4KHXL 3T0VA 1BMGA 4MS6A 1RPUA 2WAQA 4OLXL 4TLTA 1XF3B 2CUMA 1ZT4B 4ODBD 3UJTL 4HWEH 5I0ZA 4Z3TA 2VSKB 5TE4L 1O5DT 5E2WL 1MCSA 4QHMA 5J5EA 3LKRB 3B8YA 3TU6A 2QREA 1H0DA 2KLRA 4ZFGH 3F7QA 3FH7A 3OVUB 3SCMA 4AQ8C 4Z7OB 4BH8B 3R06B 2N7SA 2Z1KA 3T0DA 3V52H 2Y25A 3SJVB 4KTYA 4AV5A 4NPYB 4K8RL 3VRJA 4YUEH 4AMKH 2ZT9C 4UQ9A 4PGEB 3ELAT 3MLXH 4P0DA 1XT5A 3IMWA 1OGAB 2WANA 1L9TA 4FNLH 4XO9A 1B4JH 4OGAC 2X0UA 3BN9C 3V9FA 4IOFD 1IAIH 1MJ7H 5HGDB 2CO6B 3VXUD 3VVWA 4NDMB 4HMEA 1VCAA 3KCPB 3DO7A 3DSFL 4RWYL 1KMGA 1QLEB 3L4TA 4M03A 3KLSA 3O3AA 5C97A 3GJFB 1SJEB 5AVQB 1H8SA 3U30C 1JPTL 2O5ZH 1OM3H 4GAJH 3BEVB 3MLUH 4P5KA 5B39B 3IJEA 4N8CL 3VAEA 4FMKA 4GUOA 2YPLA 5L9DL 2YXVA 2IGFL 3ISWA 5F8QC 4NNXB 3ZKNC 4LGRB 1DN0A 2QR0B 1L0QA 1V7NH 1AMXA 1KIRA 2EXTA 1YEIL 1DQDH 3QUMH 4WUKH 4HPOH 4ZTPL 1OP3H 2DEYX 4U6XB 1VJSA 2V9QA 4RESB 5BO1L 3O2DH 4UNIA 1Q0YH 2QVMA 2X1WL 3SDCA 4QXWA 3ABKB 3JVGC 3KPPB 2MQCA 1AXTH 5HYJD 3KW8A 2VQ1B 3NN8A 4TNWF 3VVVA 2K45A 5I6KA 5AB2A 1TLMA 3RE0A 3MBWB 1RKRA 2VISB 2NY3C 3EYSL 3Q2LA 3SQOL 3I9AA 4M8UA 4ZFOL 2XTJD 1U91A 3Q1EA 1PDKB 2OTUB 3SE9L 4HJEA 1QO3B 2BSEA 3GIVB 4MXQD 4AEHL 3L9YA 1B4TA 3SOTA 3FOLA 4MD4B 4C56A 1UT4A 4E9SA 4OTXH 1ZVSB 3JWNE 4XCNB 1WZLA 3A5VA 4LLMB 3QCTH 2BNUB 3VSUA 3ARED 3UX9B 1REIA 4JFQB 3CZEA 1Z5LA 5GRJH 4JUTA 3V0AC 2GIMA 1QW9A 2NY4C 3T04D 1IFHL 4M9PA 4PW3A 3RAJH 3WS3B 5T33H 1FIEA 2Y6SD 2J55A 1H9DA 5FFOA 1SGKA 3MLVL 1DDTA 3QORC 3TN0B 3TJPA 1TUOA 3MAWA 4RGOH 5GSRB 2X09A 2IAAC 4NKDA 4GBXA 3OMZA 3G6DH 4WFFD 2CCVA 3OZ9H 3PGFL 4P46D 3ARFB 3TTYA 2QDWA 3DO3A 3N44B 1MCPL 1HL5A 3EJTA 1FWXA 3K2KA 5KYWB 5AB9A 3ARSA 4FX5A 2ICEC 5KEZA 2NOEA 2ESVD 2Q6WB 4ZODA 5CF3A 4OZIE 1LEKA 5J6GA 2OYMA 2IFFL 4U6VH 4BFIB 2AEPL 2Q8BH 4IJ3B 2NXYC 1GGIH 1KXTA 3ROOA 4CFFA 4Y5VC 3EGDA 3D05A 5AAWC 1DVZA 2BM3A 4RFOH 2IH8A 4G1MB 4LAQL 1RZKH 5AOKA 3P69A 4GAYB 1R0AL 5E23A 2G2PA 5KBPA 2VN5A 2J6EH 3MV9E 1FO0H 1MQKH 4HKJA 5EA0L 3VFSA 2NZIA 2OMTA 4ATTA 4PUBH 1DE4A 3CV5A 3HFMH 3VWJB 3L08A 4G2AA 3K80A 4GI8A 2VUOA 2VLKE 5F1IA 4LFHG 3HMWL 2FLMA 3VX1A 1BGXH 5MEQB 3EOAA 4L0ZA 4DGIH 3NCBB 4XZUA 3ALXA 1VDGA 2AHIA 4X4XB 4WDIB 4OB5L 1I7ZB 3EH1A 3QI9C 4FQ1H 1RLWA 2IV9A 5C0CB 5MP6H 4U4BA 1UM6H 1VFAB 2B14A 1KEMH 4S1DD 2LU5A 1NOAA 1U8HB 1AYOA 1UENA 4P23D 2OJZL 4EI5D 1EHAA 1PAZA 3FTYA 3Q2CA 1YEHL 3HFFA 2ZWKA 4G9DA 1TPXB 4RSVA 1NQBA 1KLGB 1FL5A 1M6UA 2MQGA 2W9DL 2Z93B 2AI0H 3QDME 4FQCL 4OZHA 2Q87A 4UQ2A 1XGQB 3HE7A 4XNDA 1A9EB 4JHAH 1GOFA 4KJWD 1R3HA 1E28B 2VL5A 2WXKA 2XNAA 1KCKA 1LE5B 3DPUA 2B8OT 3BAYA 4XP5H 4XODA 1W91A 2ORBL 3L1OL 1C16A 4UT9L 3WXWL 1Q72H 2YHGA 3KEDA 5GHWH 1DVQA 3P4OB 3V0WH 2CDFB 4KI1A 4DZBB 2R69A 1JVLA 4AWJC 3RPJA 1KIQA 5LDSA 4HGKC 1A14L 4HEPG 4ISVA 3ZTCC 1OSEA 5HYQA 5JXEC 2EYRA 4LF3A 5DHEA 1JGVH 1XIWC 4WO4A 4XMKH 4N2KA 3VD9A 2NY1D 1P4IL 1IKFH 4XWOC 3FUEA 3SE6A 3VXOA 3T6QC 1SQMA 3MV7D 3T6ZA 1O9WA 1GKOA 3REVA 5GZOC 5C08A 2Z8RA 4X6BA 5FYJL 1WISA 1TF4A 4FG2A 3N1QC 3BUYB 1AJ7H 4QHMB 5DQ9A 1H0DB 1F90H 2X28A 3CX2A 2BPBA 5BOZG 4PFEA 1OD9A 3N50A 3CNKA 2X9XA 4YFLI 1DL7H 35C8H 3B2XA 3MHZA 4Y4FC 2DQTL 3L13A 3VRJB 2AV7A 3RVXD 5GS3A 4G72B 3GEFA 1NKOA 3FQNA 4N0CC 4P2QE 3S36X 1W9XA 5KUKA 2HA1A 3NSCA 4TNGA 3DO4A 1WG3A 1PX3A 2OSWA 4EIUA 3FQ4A 4P2RE 3DO7B 5LGJA 5HJDA 3LEYL 5ID0A 4OF6A 2A4CA 5KSAD 1RI8A 1AYRA 4LSSL 3NFNA 3INUL 4HWUA 3UBXA 1A4JA 2TRYA 3EHBC 3D51A 1MJJA 3IJEB 5J57B 1KFAH 4Y2DA 2YPLB 1FV1A 2LQRA 3QRLA 2CSPA 5KSUA 2V5MA 3RWIB 2QGEA 5EF1A 1DVTA 1DN0B 4ZOEA 3RWEA 3X11A 2N3JA 1RULH 2XETA 4F8LA 3F2LA 1KIRB 1Z9OA 4KTEH 2H47C 3T3PE 1KO9A 1O5PA 2A4EA 1TQWA 3TIDB 2VZOA 3NJXA 3SDCB 3MOAL 2R29H 1KG0A 4X4ME 3VYPA 1NEUA 2XKSA 1CDHA 3O2VH 1QFWI 3PL6C 3TVMD 3I0XA 3D7PA 5BW7A 3MRJA 4TTDD 3H7LA 5BZZA 3V52L 3BUBA 4YUEL 3P3UA 3AU1A 3VFUA 1CD9B 1U91B 3MLXL 4M5SA 4TUKH 4C56B 4FNLL 4EUPG 2FD6H 1B4JL 5E6SB 5F21B 2OYKA 3RWJA 1IAIL 5CZXC 1J12A 1Q90A 3NBNA 3QUZC 4FXKC 3AY4A 4HC1L 1Z5LB 1FVEA 3UAJA 2Y07H 5TQ2L 4ES8A 2B2XH 3ZL1A 4OD1L 4M5ZH 3SBWA 1QOKA 3I02A 1G87A 4XNUH 4GAJL 1OM3L 3KXFA 1RJLB 5CHNA 2ILLA 1JTPA 2I7SA 5EH1A 5DA4A 3F64A 4LVNC 4LNRA 4GBXB 4OLZH 3RB7A 1GZQB 2D4DA 2ESVB 3DTDA 4LL1A 2J71A 4U1MA 3QXDA 2WZ5A 1A3LH 1V7NL 2VQTA 1DLHA 3OM3B 5DK2B 1DQDL 3QUML 4WUKL 4HPOL 2NW2B 1ED3A 4YFEA 2CWRA 1Q0YL 4J3OF 4D7QA 2V9TA 1AXTL 1EEZA 3VGBA 2H1XA 1LEKB 2BC4A 5J6GB 2Y6TE 4X7TA 5I5MA 4CGTA 1F13A 5LXVA 3VDBA 3EGDB 5E6ID 1PBYA 5IMLA 3ZOAA 4GUPA 4AQOA 1GY1A 4Q6IB 5D6DC 3L3DA 4FXGA 5JOEA 1EXGA 1MRFH 5I5RA 2F61A 1GC1H 5LWYH 2R0ZH 5FW6A 3LRGA 2YJLA 4HKJB 3QCTL 3S2AA 1A7OH 3KDMA 4FMFA 3A3YB 4ZOCA 1AO7A 5TDNA 5CZVH 4JQXA 2JB6A 4F37F 4BE6A 4IDJH 1G1KA 1H3XA 5CJXA 3T0EE 4EI5B 4HAKA 2VR8A 3IAGC 3RAJL 2NLVA 1XQ4A 2EECA 2BNQE 3EOAB 4JZJA 3D48R 3MUZ1 4KKRA 2X3CA 2B0SH 4PEEA 4HCIA 3LS5H 2XKUA 4GKLA 2O72A 4RGOL 4WKXA 4LSDA 4A55A 4RBPH 5J9PA 1KFQA 1CGTA 3L3GB 3PDDA 4NQCA 3G6DL 5T5NF 1VAHA 4YIQA 3OZ9L 4G9DB 5H4YA 1II4E 2WCPA 1FL5B 4JRXD 4OZHB 4BZYA 3LIUA 3BZ4A 1C7TA 4UQ2B 4ICWA 4Y9CA 4FI8A 5IKCA 3HE7B 2VERN 4H88H 4LVHB 1HINH 1R3HB 1YAIA 2XNAB 2VL5B 3PABA 4IJ3C 3WEOA 1ZLEA 3BLBA 3N2JA 4U6VL 4YDMA 4HJ1A 5KANG 1C16B 1IBZA 4Y7OC 1MI5E 3TO4C 3F62A 1NGYB 4RFOL 2YS4A 1ZWIA 5C9KA 1BQHB 1KIQB 2JFCA 4BQ6A 5DMIL 4NQEE 3GZOA 4ISVB 3CZFA 4JFED 2J6EL 4LF3B 5C09E 4WO4B 1CFBA 4X9YA 1NC4A 1FO0L 1MQKL 3I9IA 2DOCA 3BKMH 4XPHH 2IPKA 3SOBH 1WV7T 3GLDA 4D3CH 4PUBL 3VXOB 3HFML 2J8UA 3FHEA 5C08B 4F7PB 1T83A 1BGXL 1RURH 1W72A 1QRND 4P57B 4X6BB 4P2OB 4DGIL 3WUWG 2WP3T 4JM2F 5IBUB 4FQ1L 5MP6L 4EJ1C 2OR8A 2A83A 1YSOA 1UM6L 4I18A 1E0OB 4Z5RA 5FGCE 2EDWA 4DETA 4AKPA 3MBEA 3UTPE 4X6CA 5CP7A 1DSFL 3JWOC 3ZTJH 1ZVYA 2AV7B 3CE1A 5C0IB 4EOWH 2AI0L 2EXWD 1IC1A 2K6ZA 2P5EE 4PJDF 2VTFA 2X1QA 3Q1SH 3MACH 4E41E 5CBEB 4UNUA 3S96A 2CO7B 3LRKA 4XP5L 1SLVA 4QRPE 3ULXA 4OKDA 2FEJA 4A38A 5LGJB 2AQSA 3GJFK 4W9ZA 1YEJH 2X0WA 2ZOLB 4NO2B 1V7ML 3NFNB 3IMUA 1EBAA 1A4JB 2J1YA 3BCDA 3MJWA 1MJJB 4HEPA 3GXPA 1JGVL 4JREB 3RY4A 1GMIA 4H8QA 4Y2DB 3BCFA 1K85A 1IKFL 3TVMB 3C5ZB 3PU7A 2FKMX 1D5IH 3RWEB 1JVOA 3X11B 1BZOA 3SYAA 4EPSA 1SLWA 3QFDA 4FXLA 4ONHA 3ETSA 1TZOA 4GMSH 2Z7UA 2C7UA 1MVYA 3RL2B 1AJ7L 5DJDA 2DYPA 1LM8V 1T1ZA 2Z31A 4GRWH 3SCMC 1KG0B 1OAZH 1F90L 5E2TH 3VFTA 4N2HA 2VN6A 3N55A 1MIMH 5B3JF 3MRJB 5C0EA 3FU7B 3CHPA 1UACH 1WTLA 35C8L 4TS6A 5IB4B 2CA3A 2OBGA 3VFUB 2JQZA 5HDLA 1TQUA 4KKAD 3TA4D 3OKMB 3L4YA 4BZ2A 2JKXA 1LO4L 3MQIA 2AGJH 2V5RA 1QN3A 3RWJB 2WWNA 3FRUB 1PGRB 3IVKA 2YAMA 1WCQA 3DJ9A 3KGSA 1OVZA 5FYKE 2Y24A 3ZR5A 5LGHH 5E5RB 1BXAA 2HRLA 1OY3B 2HXAA 5EN2A 5HTSA 2E7DA 1P6FA 3I02B 5D7SH 3UCQA 1DIZA 3KXFB 3WE1A 4F7MA 5CHNB 1IAKB 3KYMB 4XMVA 5FYKL 1KFAL 1N67A 2X88A 3V6ZB 4Y1AA 3NJJA 3UCRA 4OZFH 3ARYA 4LNRB 4HG4J 3WY4A 2P5WE 1RHHB 4GFXA 4ZMNA 4Q8BA 5FPIA 1RY7B 4MCYA 4KTEL 3H9HA 3QG6A 1QSFD 3ZTDC 1LVEA 4J39A 4RQQA 4UOJA 1A4AA 4Z3HA 1ED3B 4WV1C 4N5EC 1DUYA 1FP5A 25C8H 1EDQA 3LRSA 3QHFL 1NCNA 2A6KB 4LSRH 4NKIH 2G3MA 2R29L 1X44A 1EEZB 1R5IB 4KROC 4Y8AA 3O2VL 3RWGB 2QPDB 3DI3B 4XX5A 4X7TB 5JN5A 3SEPA 2QLYA 5F7LB 3A4AA 1OANA 2ZWZA 5CLWA 1KYOK 3HBZA 4MCMA 5IMLB 1QA9A 1XCQA 3EJZC 4GUPB 5FUCC 1MXDA 4YX2H 1NCTA 4TUKL 3QS2A 5D9SB 3L3DB 4W9KC 3T71A 4DVRH 3V6OE 5FKPA 3A4FA 2FD6L 4HSQA 5LAXA 2XQYK 4JJHA 4MMXA 4ECNA 3KLLA 1E8YA 3RDTD 3SGDI 3KDMB 2WN3A 1AO7B 3HZVA 2OK0H 2HKHH 2JB6B 3UG5A 1IMHC 2HSIA 2Y07L 3I3WA 4L1DA 5E95B 4J1UA 4HCRH 4KFZC 2B2XL 3V4LA 2WBXA 1OP5K 4M5ZL 4JZJB 3IRZA 4XNUL 3ZE1E 4Y5XA 3SPIA 3U7YL 2DS4A 3C6LD 2VDRH 4OLZL 4YIQB 3UO1H 4Z7NB 4AGOA 1A3LL 3FB6A 2D0FA 2ZUYA 3K6FA 2XBDA 1K3IA 2H6PA 5EEZA 3BZ4B 2HVKB 3BPLB 2FVNA 4HFUH 3AB0B 2YAQA 4HIHA 4OLVH 1E8ZA 4K8RD 3AW5A 1HZHL 1UVQA 5GS2H 2Q3AA 3PABB 2OSLA 4JFEB 4KK8C 2DKAA 2HZSA 1SOKA 4F20A 2CD0A 2F08A 2P5PA 2I07A 3C5JA 1U93B 5EMYA 2EDLA 4JPQA 4G8GD 4U6TA 1CXKA 3FAXA 5DZJA 4MMYA 1QRNB 2CGZA 5LWYL 2R0ZL 1GH7A 4HPHA 4PBWD 4TNVF 1WAEA 1NC4B 3D25A 3ULAB 1A7OL 3IU3A 4MDRA 5CZVL 1HDMA 2J8UB 1DFXA 2CZNA 3CHQA 2ID5A 3QFJE 4IDJL 4Z3EA 1EX0A 5I6XC 1ZGLA 3TA3D 4ZQKA 4ALAC 2IDFA 2APBA 1W72B 2C9VA 4C47A 5JPNC 2B0SL 4LSPL 5ELIA 3WE6B 2Q76A 5HVWA 4CN4A 2BY0A 1HEZA 2ITDA 4G82A 4W68A 2A83B 3MX0A 5IUCA 4FFYH 4YDLB 4Z5RB 1JWUA 3Q2VA 4TUOB 4XTRC 1KGYE 1SM3H 1D7CA 5E4OA 4GLRI 1J8RA 4X6CB 5CP7B 2GFBA 3VXTA 1NMCB 1DQLH 2QV4A 3HE7C 2AZAA 4DZ8A 2PW1A 2OMZA 3HZYA 4K55A 5KVDH 5E8OB 4LVHC 3BEWB 3OZKA 4NCC1 4ZSOA 2CU9A 2NPLX 2LAAA 3BXNA 4H88L 1HINL 3BH9A 4EVNA 4EIBA 4YL4A 2O1AA 3EYOA 1MAKA 1E7VA 3FZUC 3S88H 4PG9B 1LQBC 3CFEB 4WO4C 2EKSA 4GT7A 2A99A 3LKNB 2PO6D 2IQAA 2ZZUT 1U0QA 2IBBA 1X3DA 1SXZA 4MXVE 3VI3E 4QD2E 3SOBL 3ECBB 3HR6A 5F9CA 4CC4A 1XR9A 4JM2C 4A2DA 1U3JA 1AR1B 4RAHA 1U8KB 2NY5H 3QFDB 3RWHA 4ONHB 3H9SE 1RURL 4FZEH 4EJYA 3NGBC 5C07E 2YMTA 5I0XA 3WY2A 3BI9X 4KH2A 3D87B 5DJDB 3DETC 3WUWA 1VZIA 4M7JH 1KYOJ 3FQWA 4DIXA 5JW5A 5C0EB 5E99H 4YEEA 5F7BA 4FGMA 5GRWA 2YUZA 3RB5A 2ODIA 1AIZA 3N41F 4J6RH 3J07A 2H2SD 2V8LA 2ZKWA 4YSAA 1PZ5B 5E9NA 3LHAA 4GP8B 2JXMA 1PL3A 3Q1SL 3QJOA 1J5DA 3CN4A 3MACL 2GI7A 3EYQC 2IANA 5AB0A 2JJUA 3IVKB 4NBYB 5EIIG 4ABWA 3BWSA 3W82A 4KKZA 3QIWD 2AJXH 1NBCA 4XXWA 3GBNH 4CDHA 4PRPA 1DVFD 2P80D 4XT1C 7PAZA 5K9QG 2HP4A 1I8UA 4F7MB 2A9AA 1D9KD 3MRKB 1B2WH 3CDCA 3MV9D 1W16A 4WNQA 1CDYA 5JDSA 3O6FA 5IHZA 1D5IL 3Q43A 2C1OB 4U3SA 4MCYB 2H45A 3NEXA 3H9HB 3QG6B 4UOW0 1TT6A 3P9WB 4WHDA 1JRHH 3FJTA 4RQQB 4WK0B 3DRTA 4PH8A 3CZNA 5GQBA 3LRSB 1SMAA 3OH6A 1JZGA 3UIZA 3V5DA 5DYFA 2FE0A 1QLFB 2NX5E 4YZFF 5E2TL 4MZRA 1CI5A 1LGVA 5F7YC 2I7OA 3OLGA 1NSNH 5HI4C 1MIML 1QN7A 4W70A 1PTZA 3RDTB 5I5JA 4JZOA 1UACL 2QVIA 2GJ6D 4FHKA 3NCJH 5M7QA 4RZCB 3U0PB 1ADQH 3SKMA 3R8BB 1KTBA 3QDMD 4OIAA 1XCQB 1OPGH 2WXQA 4NC0B 4F24A 1LILA 1JF6A 3B37A 4NPKA 1MKFA 5LAXB 1HNFA 4MMXB 2AGJL 4EUPB 3DV6B 2UVEA 1YEKH 2MOQA 1CFNA 3UAJC 4WENB 1J3MA 2Y2WA 4XGZA 1EEQA 1RJYB 3DRQB 5LGHL 4L18A 4BXSV 2DQFB 1R5WA 4PJEA 1V10A 1EO5A 2OOYA 1IGTA 1XTMA 2A9DA 1T1YA 4Y5XB 5D7SL 1ZLUK 1FH5H 3L81A 5D1QA 3E3QE 1OT1A 2WLLB 1J11A 4ZUUA 5JZ7D 5I1AB 1MCFA 4QT5A 4JPIB 1BF2A 3CD4A 3BX7C </