1QTPA

Crystal structure of the ap-2 clathrin adaptor alpha-appendage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C)
publication title Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 66
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 1999-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1qtpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qtpA02
1VOKA 1QN5A 2Z8UA 1NH2A 1QN9A 1TBPA 2IV8A 1VTLE 1W80A 1QN4A 4PY5A 1TGHA 1R4XA 1KYFA 5IYCP 1QNEA 5IYDP 1YTBA 4RODB 2IV9A 3EIKA 1GYVA 1QTPA 1QNBA 4ROCB 3ZHFA 3ZY7A 1NVPA 1NA8A 4BCXA 1PZDA 3ASMA 2DWYA 1RM1A 1B9KA 1YTFA 4B0AA 3HS8A 2E9GA 5CN2A 1QNAA 1KYDA 1QN7A 3H1ZA 1IU1A 1QN8A 2MJ7A 1GYUA 1KY6A 4WZSD 1CDWA 1QTSA 1GYWA 2D0CA 1JFIC 3MNMA 2D0BA 1OM9A 3VN5A 1KYUA 1VTOA 2G30A 1D3UA 3HS9A 1QNCA 3OC3C 1MP9A 3OCIA 1PCZA 1VOLB 2DWXA 1NGMA 1AISA 2D0AA 1QN6A 2A7BA 2VJ0A 1TBAB 1KY7A 1P4UA 5IYBP 2YMTA 1QN3A 4ROEB 1C9BB 5CN1A 1E42A
chains in the Genus database with same CATH superfamily
4DZBB 4UAOC 3W3BA 1ET7A 5IIEA 4R4BB 1IGML 2F58H 2Y1YA 1C5BH 1VFAB 3FTSA 3BP4B 3JXAA 5HVGB 1HKFA 5D71L 4D94A 5LLIC 3ZL4L 2QGEA 2W07B 1RZ8A 3K6SA 1NCUA 1CI3M 2GTZB 2UY6A 4RISL 4K3DL 5DJAB 1Q0YH 4Y19A 4F33A 4P9MH 5BS0B 5B1JA 3D48R 2FEDC 4BFNA 4X8JA 3KHQA 3SDXA 4E5XG 4NZRL 1CE6A 1T5XB 2CH8A 2R0KL 3LN4B 2YN5A 4FLHA 4FLQA 3IF1B 3BZ4A 2WKGA 3FB7A 2I69A 3EJUA 3HCVB 4PTUA 2YH5A 3F6IA 2BSDA 3BEWB 4H0LC 2WV3A 3MCLH 1SGKA 4H0HB 4JANA 4J3OD 4FQJL 5J1TC 4QRQB 1WD8A 2DIJA 3G08B 4R4ND 3RL2B 1LNUB 2H0FA 1WF5A 4LF3A 1R3HA 1UZ6E 4Q2ZA 1NSNL 2HT2D 1FL5A 2Y07H 4S1SL 5MERA 4R8WH 4MA7L 2G4EA 2X88A 4XPFH 2DKCA 3GJEB 5FYLL 4OJDH 3DUSB 3CNKA 4DUWA 5SWQB 3HZVA 2GB2A 1A6UL 2HB0A 3RWJB 4XHJC 1O9ZA 5FYLE 1NCAH 4TSAH 3LEVH 2WLZA 2FUQA 1ZSDB 4OLUH 4F5CE 5I0WA 4Z8FH 1NCDH 4B5ZA 3CFEB 4ZUSB 5KYYB 1IX2A 1VERA 5F9AC 1GGCH 1D5RA 2BVQB 1CK0H 4W6YB 3QDGE 2GAZB 3RPIB 2Y1VA 5J3HD 3WKPA 3VA6A 1MWOA 5AD0A 2BZ7A 2YSTA 1VCAA 1OARH 1K4DA 3PAZA 1EH9A 1WQAA 3DO4A 1BOGB 2L4OA 4MCZA 5DEFB 3CWSA 4PJFA 3FCBA 4P9HC 5B1AB 4N8VA 4NN5B 1CFVH 2C4FT 3NIGF 4Q74A 2VT0A 4WV1B 4JO2L 3BEVA 4IBUA 4I0PB 4DGWC 1SYVB 4MYPA 3PWVB 1HXYB 1YPZF 3S8GB 2VXVH 4BFJA 1WWAX 3F7LA 2ZWKA 3TBCA 3OLDA 5C6PB 2F5AH 4DN3H 4J4PC 3T2OA 4LIQL 3VACA 4CVWA 3OH6A 2EDFA 2FATH 4KO6A 4TLSA 1RIUL 3EYUL 3JVFC 1MJUH 5D7JC 4MWFB 2BH0A 2VN6A 3MRFB 4M1GL 2PXYD 3FHAA 2QKSA 3PPSA 1PMYA 2P24A 3UBXA 3AW5A 5F9CA 1FVCA 2QRCA 2QSCH 4PI2A 4D0BB 1QMUA 5AVQB 1NMCC 1I7RB 1ZT1A 4HIIA 5BQ7A 3CVCA 2IAND 3NJIA 3EYFB 5E5MB 4CDHA 1OD7A 4NNYA 1ZWIA 4JG9A 3QIWD 3RY4A 5D1ZA 5GGTL 3AACA 5BVPL 2BVPA 1GCYA 4U0RB 3GYRA 4IBQA 3CSBA 3MQIA 4GBXD 3UTPD 4BQ9A 5EFIB 5F0LB 3U46B 5IB4B 1FIEA 5FA4B 4FFZA 1CICD 1EHAA 1NGWB 2B15A 1BX2A 1ZDSA 2PYFB 4RFOL 5G4OA 2XFXB 5IEKB 5IYDP 3CZNA 4L29B 3KYMA 1MWAL 1N7ML 2DWSA 2VLRD 1QAWA 4UQ3A 4TNWF 1DR9A 1S3KH 3D0AA 1SJHA 5HHQA 1G7JA 2E27H 3FBKA 1U2HA 3BT2L 3Q8CA 4JGMA 5T1JA 4HK3J 3X11B 1MN4A 3WEBA 5DRWA 2Q76B 1XGYH 1UEMA 1FYHB 1KJVA 2NY2B 2VAJA 5L6YL 1A3RL 5DVOA 2YARA 5DTFB 1BVKB 3D3VA 3P0VH 4OKDA 1E9QB 2DTMH 4PB9L 5BRZD 2E0PA 3IFLH 1GAFL 1MCNA 2AAVA 2AJZA 4D8OA 4H1LA 4DP6X 2EECA 4XBPA 2X89D 1RUML 4LP5A 1JZ7A 3QYNA 1SJEB 4YJZL 1UZ6F 1MRFH 2NY5H 2WQXA 3OSMA 3FAXA 3Q6FA 5D5MB 5E2VL 3JWNC 4XOEA 1YJDC 1A6WL 4X98A 1WFNA 3ARBC 2AJUH 2XWRA 5C0BD 4R90H 2HUEA 5GGRA 1WIUA 2JB6A 2ZJSL 4B9YA 1FFQA 2QVFB 1PY9A 5B3SB 5F7HA 2FH6A 4DGIL 1N0LA 2YEQA 4TUKH 1T21A 1U8NB 3AITA 4XMKH 3ABGA 3PV6A 4QHLA 2Z91B 1DE4A 1G7HB 1SUJA 4OTXL 3TT1L 1OPOA 2OI9C 2TAAA 3MBXH 2XVKA 3MFFB 4OV5A 3QEGH 5F21B 2I60L 4XN8A 4J28A 3OKKA 3C6SA 5D1ZI 3B37A 2ZONA 4GRWB 4HJGA 4UINL 4E5XA 1BXXA 1YQMA 1DQLH 1FBIH 1GZHA 1RZPA 5DJ6A 2UYLB 5CHNA 5A2BA 1WRFA 1DBAH 3W5MA 4Z6AT 1D5XA 3N85L 4ABQA 2UXGA 4TF4A 4FYTA 5DJXA 4JPWH 2B7DT 4GW4B 2VDPH 4ES8A 5E8PB 1E7UA 1HZLA 4ZO6A 4PJ9A 1QFWL 3BIBX 3BCFA 5SX5H 3DROB 4F7TB 1UCTA 5DK3A 1DUZB 4NKMA 4M1DH 4QAWA 5F1NB 5HI3D 4WQOA 3A4FA 3QUZB 5DZVA 3QWOA 2X2UA 2ZYRA 1H0DA 5T1KA 3V4VL 1YEGL 1H6UA 2ORBH 4Y2OA 3QJOA 4OLWH 4PJAB 3ARVA 4ZZFA 3L4TA 3O6KL 1BSIA 4LB8A 5EU6A 2EEBA 1CL7H 1FZOA 2W60B 3MRLB 1RAMA 2G2RA 3C5JA 3N42F 3N1QC 4JVPA 4PU2A 4UQEA 4RGMB 3ZTDC 2HMIC 4G42A 2H9GB 4Y1AA 4JO3H 2OOYA 2PUQT 1R33A 3O8XD 1I7TB 3RBGA 3P11H 2GUOB 1RZKL 4M93C 4WCYH 3HG4A 1HOCB 2P80A 2XICA 5B7MA 4GRWE 4X4MA 4JM0A 1RK7A 4XNAA 4EI5A 4DFIA 2ZPKL 2PPFA 2UXFA 2YD2A 2LTQC 4HS3B 3T6VA 4LLYA 2YD1A 4G80B 2GEEA 1IEBB 4L8BA 4NQSA 4F7MA 4YSPA 1HT6A 4NFCA 2V5YA 5EOCL 3D2UB 2QGDA 1A9EA 4A6YH 4O2EB 4UZSA 1VB9A 3P3SA 2GT9B 1ILSA 4NCDA 1T0NA 5B1KA 1R3LB 2GY5A 1CFNA 4F7PB 1FAIL 1KPRA 1KTKE 4JREC 5KSVA 5E08H 3O9WA 2HFEB 1RZJC 3VXUE 4MAUL 2GI0A 5ABZA 2MIZA 2E5EA 1KTDA 3AAZB 3D33A 1HHHA 3KYOA 3D50A 4PJAE 4XPHL 4NPJA 1KB5A 3O2DH 4WNSA 2WMPB 2G30A 1J5HA 3UROR 1F86A 1KBKA 2OS7A 3U0WH 2EO9A 1EGJL 4GOSA 4X4YA 1JV5B 4IBZA 4H0IA 3SBQA 4RMQA 5TJWK 4QRTA 2XN0A 3QEQD 1KMGA 2OULB 5C0AD 1A4CA 3MBWB 2GSIA 4QXVA 2IQ9H 2YQ3A 5I66B 2CUIA 4I1RA 4XXCC 2Z4QB 2APVA 4HGMA 4ODHH 2EXWC 5DUPH 5FUZH 2LOEA 1IGFL 5D1QC 4ZFOL 3MUZ1 1NAKH 1SXSA 3BD3A 2XVLA 3M6DA 3P3TA 5E23A 2BW5A 3U7YH 1AJ7L 4POYA 1KY7A 3IGLA 3BVVA 3KWWB 1RHFA 3OXRB 4C56A 2R2HB 4P4KB 4EN3B 3HW7A 2Z31D 4N9OB 1XBRA 4P8QA 1CG9A 3HI1B 4OCSL 2CKNA 2WXQA 4N8PA 4YHNB 2NOYA 3KDMA 2CRMA 4ZJ9A 3SDAC 5TF1H 3GTNA 3BWAB 1P9MA 1OB0A 3T0XA 3OPZL 1IAIH 3GXUB 4WI6A 1XO8A 4QT5B 5GIRB 1Q9WB 4NZTH 2HJLA 2DLFH 3GEFA 4HIHA 4NQEA 5D5MF 1FN4B 3OJ2C 4N2AA 4HGWA 5E8NB 5CGTA 1A7QL 3GZQA 2F53A 4J2XA 4MQ7A 5LGHL 3FFDA 3RWIB 2I07B 3CVHA 2BPBA 3CMGA 4A7GA 2FSEA 3ZIMA 3KPNA 1H9DA 1XF2B 1YEIL 5J5EA 3MV11 4P2OC 1GYVA 4MJ5A 4HP5A 2F54A 2VXSL 1FL3B 2F6AA 4NRYB 3RWHB 1FFNB 1M1SA 5IMKB 2DM3A 1MCWM 1S7XA 2V17H 4NJ9H 4DZ8A 5BNXD 3RTQD 1SLUA 4X6FA 3T3PB 2MWCA 1BQKA 1WFMA 3HAEG 4LFHG 4Y4FC 2ADJA 4Q0XL 2O6EA 5MEPB 4UDUB 5FWQA 1M7IB 3KLHD 4QKTA 3SE8L 4RWYL 2R5XA 4GRWF 4NPYA 4JFTA 3CUPA 3WEOA 5C0IB 2YN3A 4X0KA 3Q44A 3L7EB 2AVGA 2E8YA 2EXSA 2K9UA 2WQUA 3AREA 2NUPB 3DETC 4XBEL 3S3BB 3CQFA 3PS6A 3ZTNH 3CCHB 1IKNA 5I74C 4LHUA 4CSZA 2DQFB 4OZHB 2H3NB 3RA7L 3BOVA 1OKEA 1Q72H 4OUUB 1VFOA 3VSUA 5CGMA 1TTRA 4X6BB 1FPTL 5TE7H 4Y4KC 5J6SA 2QLVA 4GKZB 1RUKH 2FNBA 3OB0K 4C4BA 3ESPA 3LEXA 1GIGL 4ONFH 1DVFD 4YHYB 4BFIB 1VTOA 3GSXB 2C3GA 1NGPL 2HG5A 2ZSWB 5FO9A 5BV7B 4TSCH 1PZ3A 3AVEA 1X3DA 3FQ2A 3O6LL 4D3CH 5IHUL 2DM2A 4OCRH 5HYEA 3BRDA 1AP2B 1GHFL 4LDEB 1NUGA 4PJAF 2DQGL 1UWEL 5I1CH 5I8OL 2OW7A 4MA3B 4UV4H 4WJ5A 5FW7A 5BZWB 5F7FA 4BKLB 2SODB 4XMLL 3WN5C 4YS4A 3CIQA 3MRDA 1R3KB 3LKOB 4GYBA 4X9YA 3ZKXC 2QKIC 3RY5A 4DP2X 3AADB 4JHAL 3W9DA 4HQQL 5GZOA 4GRMB 1NL0L 2FX8L 2NLJB 3FU7A 3KAAA 4XP9L 4F80A 1K6QH 5LNEA 2BXYA 2DW5A 2PPAA 2NW3B 4L8CA 3VXRA 3NJMA 1EXGA 4DP5X 2EC9T 1SLVA 3PAYA 4JO4L 2EINB 4U6XA 2VMCA 4PUBH 5JHMA 4O9HH 4HFWA 4QTHB 5A3IC 1CLYL 4G9FB 5I0XA 4FNLH 1UOKA 1S7SB 3RIKA 3TZVA 2WUCL 1XHHA 3H2QA 3QIBB 4Y5YC 5DZJA 1NUDA 3BVWA 3KPTA 4PRIE 4U1LB 4E42B 1J0IA 2IMNA 5F7DB 4HJSA 4LOUC 1JV2B 3WKNA 1XR8B 1UUNA 1M53A 2DL9A 1TVHB 1NBVH 4U7KA 4DP4X 1EEZB 4GXFA 3FO1A 5DO2C 5DEGB 1AHWA 4TNEA 1I4FA 2N59A 4Z7WB 1FDLL 3HE6A 1JG9A 1N12A 2DQMA 3TCXA 4OH2A 5DK2A 4MDIB 4BUGA 3G5YA 3BQUC 4ROCB 2W59A 2F8IA 1MFUA 5LWYL 5M95B 2GSGA 3O41B 2OTWB 4KGJA 3RFRA 3OKMB 3FQYA 4NOFA 2Z8RA 2PTVA 5K9JH 3STLA 2YD6A 1CO1A 2K7QA 2XY1A 4J2QA 2VDNH 4XN9A 5C3TA 3E1ZA 1OP9A 4PSRA 5T3ZD 5IUCA 1DFBL 4YSRA 3GM8A 3FNKA 2ZUUA 3QFJA 4QYAA 1OOAA 1LE9B 2VW6A 4FQLL 4Y2DB 4FEIA 2HVJB 2X3AA 3DGGA 4UMGA 3FZUD 5IG7B 3JVGA 4F3FB 3ULVD 2AJSH 1KEMH 2WSKA 1NBQA 4N0YL 4OB5H 4ZTPH 1UD4A 3PP3K 1ND0B 3SHSA 4ZAKC 4I1PA 4MBOA 4F27A 3B83A 2YGOA 3V55A 4MAZA 1ERNA 5J56B 3B43A 3UDWC 4GUQA 3QRGL 4NQCD 3WELA 3QJZA 3TPKA 1X5GA 1BZDA 1FGNL 3BSZA 4HUCA 3X3GH 1MP9A 4PCTA 1UYWL 4BXSV 4XCNA 5E1AA 4JHWH 1MFVA 1WUZA 4JQIA 4RNRB 1VIWA 3CU1A 2V7HB 4HWBL 2Y1AA 1CGYA 4PV9A 1SQ2N 1T03H 2Y8LA 5ILTH 1HHKB 1G6RB 3E7JA 5HJGA 4GKSA 1QFUH 1CBJA 1D5MB 2VE6A 1DHKA 2XG5A 4YNYA 5DD3H 5HHMB 4GINA 4H88H 4KX7A 3N6YA 1J0JA 2Z7WA 3H42L 4N25A 5EUKB 3H9YA 2E8ZA 3BW9A 1KN2L 3T3PF 4O2FB 2RCSL 4JRXA 4OD3H 4DTGH 1DP0A 3N1GC 1I8MB 2Z4TA 2KYIA 4FQQB 5E8OA 2AGJL 4QTIL 4P59L 2V3EA 4GRLD 4JE0A 1HTYA 4HSQA 1OE1A 1QABA 4IOFD 4ZMQA 3N9GH 3T08A 1QATA 2X12A 3SQOL 4IRSA 3QDJB 3IGKA 2MQ0A 3O0RH 4ICWA 1RZGB 3V6ZB 1AD0A 3BDYL 5LBSH 4TN9A 4FG4A 3ECBA 1N0XL 5B8CC 3WEXB 4ZOBA 3Q1SH 4E68A 1JK8B 3QJFB 4J23A 5FHBL 2YMOA 2DQCL 5JXAH 2LLNA 2FO1A 1H5BC 2HRGA 5I0DA 3CHRA 3C5ZC 3L4YA 3SPHA 2J55A 4JY6B 4QRSB 5HDOA 4HOXA 4U1HB 4MS8C 2H26B 3TO4D 2VO8A 1SLXA 3UTOA 2P28B 4XXDB 2P42B 4MRQA 3TESA 3F62A 5B39G 4CW1A 2FJGB 4BZ2A 4BA8A 1SDDB 1UZ8B 4JVUA 4YSSA 2ODHA 5JIIA 1BLNA 4PJ5B 1K8IA 1NLDH 2YUZA 1JUFA 3SE4A 3GMNA 5HHME 2ZSVA 3X1GA 3IJ8A 5CKGA 2P49B 2C4XA 4HWNA 4YHKH 4YGAB 5DUMH 2P5EA 5MEQA 1XF5B 2HH0L 1PD1A 4G43A 5T5FL 3FB8B 4LLDB 1GC1H 4BCZA 1PCJX 4NKIH 3KM2A 1JZHA 3V5KA 1H3TA 1HH9A 1E2VA 1MJJA 4NYLB 1JK9A 3L3GA 5AOJA 3SKMB 5CS7A 4C54A 3VXSB 3EGSB 4MRCA 5HGAA 3D69A 3QJQB 1AHMA 3QDJE 3JQOB 4FP8L 2XRAH 4X2UA 4AXWA 1HEJC 2FLRT 5HHVH 2VNCA 32C2B 2AI0H 1AIFB 4K8RC 4PG2C 4D9RD 1HL4A 5JOFB 2G5RA 3R7RA 3ZL2A 2A2QT 4BQ8A 4EUPH 2ZWLT 3GRWH 4WHCA 1RVFH 1TZIA 4NQDA 3NH7L 5EPMA 3ZYIA 1ZY9A 4FJ6A 4XZUA 4JY5H 3ARBB 4K71C 3C09C 3QYCA 3LAFA 4OV6F 2YGVA 5A6MA 1OHQA 4U6HB 2BP8B 3TOPA 1U3HA 1X5MA 3BGAA 2VDMH 2CJUL 3JWOL 4GG6B 2CKBB 3VMOA 4HK0A 4ZS7H 1NPNA 2B2XH 4IHBA 2VSKB 1THAA 3FJTA 3MOQA 5IW1A 3R0NA 4F37K 5DMIH 4OLVL 2OI9B 2WUBL 1U8HB 5AVUB 3QQ3B 1P5VA 3REVB 3H9SA 4NJAL 5I6NA 1Q1JH 3UG4A 5I30L 3RBSA 4C4UA 5CCHE 2GEQA 1KFAL 2EKSB 2F18A 2PCPA 2V33A 4HOZA 6FABH 1ZVSB 3UTZB 5I1GL 4XVJL 2GYSA 1VTLE 1E27B 3B2UC 4F1ZA 3UPCA 4N8CL 4AKQA 4F57L 3P30H 4KK9D 1GKOA 1DZ0A 1JMZA 5AZEL 4L05A 3L9BA 1G9NL 2AMUA 4NFDA 1II4E 4ANUA 2YPLE 3APNA 3DARA 2XZQL 4QRBA 3NAAL 4YIQB 1IB5A 1QBML 5FUCC 1EUTA 4GUCA 2KZKA 1ROCA 2HLAB 3TVMB 4RVBA 1MHEB 2YZ8A 4ODSL 4RBPH 4X9BA 3IBEA 3ARWA 5EOQH 1VF5C 4EN2A 5G5DA 5E6SB 4OZGE 4KUCF 2L8AA 2G75A 4L8SC 4HUXA 1ICTA 2O5XH 5HY9A 3HI6H 3R1GH 2E86A 1DVUA 5DYOA 3BPNC 3ULAB 3SGEH 2KPWA 4GG6E 4AJWA 3RIAF 3VYOA 2OFQA 4HJJL 4AOFA 4EZKA 1E4XH 2RIKA 1ZEAH 1FNSL 1BREA 2PW1B 4JFFE 1IZKA 3IJEB 2QHRL 3KLSA 4OJFL 1IKFL 5EEXA 1TJHH 1W0WA 3ASNB 4M93B 3LCYA 1VADA 1XTLA 4JN1L 5DQDL 5C0DA 2FIRT 1FFPB 1QSVA 3SGDI 3SEPA 4DCQB 3WFHB 4B6ZA 4AKOA 3QZPA 2LTQB 4JM4L 1AOHA 2WXIA 5IJKC 1NFAA 4YN3A 4NIKB 4YXLL 1G4MA 4S0HA 35C8L 3MOAL 3FPYA 4N6RA 5IBUB 1JOIA 1M7DA 1V7ML 3EBIA 1VACB 4MNHB 4IU3B 3EFDH 3P4OB 4BHUA 4MVBD 5DEZA 1NC4A 4OLXL 4ZUUA 1JPFA 4G83A 3P4MB 1BD2A 1Z5LB 4HDIB 3T4AC 4MMXC 4JREB 3TONA 5E8DL 5AW4B 1SBSH 1VPOL 2EDOA 5TPWL 1GMEA 3G6JA 1KCRH 1ZA3A 1XWVA 4KUZL 2ADFH 3RWGB 4DW2H 1FHGA 2QV2A 2BWDA 2QHLA 3G5VB 1E4KC 3F58H 4FLRA 3AQXA 1WZ1H 3RNKB 1TVBA 3LQZB 3WENA 4WUKL 1T1WB 4W4OA 4IIZA 1AO7A 1LO4L 2WSDA 2A83B 4HPYH 4JBSA 4PBWD 4DZBA 3TGXA 3TF7C 4R4BA 5L4IA 4DESA 1WFIA 3D7PA 3HE7C 3NPZB 4KJQD 4N86A 1VFAA 1YNKH 2OSLA 3BP4A 4NM8L 3TV3L 1E6JL 3QQ9D 1AS6A 5D1QB 3LHAA 2W07A 1LK3L 2BP0B 1KGJA 2GTZA 3FCSB 2FT6A 4PRPB 3AWFA 1PLAA 4KO7A 1X5XA 4GSRA 5DJAA 5C0CB 3WUWB 5BS0A 4HYTB 3GEWB 5J13B 1USZA 3OAZK 4TVPD 1T5XA 3LN4A 3MV7B 4KVCH 4CC1A 1NCHA 3IF1A 5SWZB 4CDGC 1IIKA 2J5WA 3HCVA 2EEDA 5EZOH 1F2XK 3BEWA 3SDAB 2HFGL 4XP1L 3C6LC 4ORGB 3SYAA 1DEEB 2Z64C 4QRQA 3G08A 1XSJA 2JE8A 4XTRD 3VFTB 3TT3H 1IE4A 5FUOL 1M3JA 4DEPC 3RL2A 1LNUA 3D3VD 3N04A 1J8KA 1BQUA 2VTFA 4NZUH 2DIBA 2ZWYA 4PGJA 3QCTL 1V7NH 4LQFL 3GJEA 3IK2A 3UMNA 4AGNA 1UWGH 3DUSA 3OB0H 3KTUA 1XIWC 2WW8A 2EEXA 2YKLL 3HNVH 2ZKMX 4PJDE 5SWQA 4ECNA 3RWJA 2X0VA 1HE8A 4OZGF 3T77B 1EQWA 4ZPTB 4L2YA 1ADQH 3WJLC 1KB5H 4TQEH 1ZSDA 1UD2A 1QSEB 1F45A 1RULL 3CFEA 5E6YA 4ZUSA 4P3WA 5KYYA 1NMBH 4P23C 4P2OB 1XL6A 1DQDL 2L0DA 2NY1C 2BVQA 3MJWA 4GG6F 1QYGL 5DR5H 2GAZA 4FG6D 4X4XB 3BAJA 3TBTB 4QDGA 2H3XC 4XNQB 2DMKA 5FPIA 5G4MA 2JK5B 5I8CB 5T5NF 4AMKL 2EVFA 2WXPA 1S78D 1MREH 1HEHC 1BOGA 4PRPE 4LLQB 5DEFA 5E5RB 3KNBB 4C83B 4HIEB 2P26A 2XZAL 4WV1A 3NJJA 1A14L 1BYPA 4RMSA 4I0PA 5GS2D 1B3IA 1SYVA 2R2EB 3IEAA 3VX1A 3ULUC 2YWYA 1HXYA 3PJLA 3PWVA 1Z3GL 4U33A 5SWZE 5I1LB 5LNGA 5LXVA 2YPKB 4Z3GA 3MN8A 3EBHA 4Y8DC 5I74B 3SJVE 1BVZA 2CLVB 4G82A 3VFUB 4IDLA 3MJ6A 3EO9L 4Y4KB 1AQ8A 2MCPH 3U4EB 3MYJB 3MRFA 4GXVL 2FK9A 4GSDH 2TRYA 3BUYB 4O4YH 3MMEB 3QXUA 5JMRA 3MJ9A 2NY7L 4L9LC 2VZSA 3D4YA 3NDZE 1I1RA 4XCFL 5EIVA 1I7RA 1M7UA 4PJ9D 4DPBX 4LARH 1CF8H 5J8OA 2EADA 4Q9BA 3EYFA 4I13B 5E5MA 2D7OA 1CU4L 3V52L 3ASOB 3KGTA 1ASQA 1W8EA 4OU3A 4POUB 2JKIS 2NWVA 1EXHA 4YDKH 3WN5B 5T1KD 3CVHH 5C07B 4OD2B 5DFWH 4YSDA 2MKWA 1DBJL 1KJ3L 3DHUA 4MCNA 5EU6D 4JAMA 2QKIB 5IB4A 3U46A 3X1NA 4DUXA 5FA4A 3H7BB 1NIEA 1T66D 1NGWA 5T1LD 3VGAC 1KBBA 2XQ0A 2PYFA 5JOPE 5IEKA 2XFXA 2UZYB 4WKZB 4L29A 4Y1AD 1NCCH 4NBZB 4POZD 1HJBC 2HZSA 3LZFL 4ADJA 5E1HB 1VGEL 2BY0A 3SOBL 4NUGL 1JGUH 4GI9A 1WA0X 2IOMA 2YOAA 2XWBB 4NWUH 1QLEH 1AI1L 2A6KB 4OAWB 4EI5D 1WT5A 1ZTXL 3NFSH 3X11A 4Y5YB 2OMWB 3IDJB 1XGPB 4AGPA 2AQPA 1DFXA 2D3JA 2Q76A 5FYKH 2OMVB 1H6EA 5GZNC 1ZTXE 1HL5A 4HJHA 1KCUL 2NYYC 1IQWL 1BVKA 4KO9A 4PCSA 2IF7A 1SOQA 2ZKWA 4UQCA 2WKOF 3BZDA 3VTTA 1XD1A 3PP3H 1YTFA 3W57A 4OGQC 3FN0H 1D9KC 1MI5B 5LHDA 3V0WL 3HNSL 5G55A 4TLTA 2B08A 3O9WD 4KKZA 3AGVA 5D5MA 1BWMA 3IDUA 1UJ3C 3FYEB 3BQUB 5C7ZA 1FJ1B 2YFOA 1DQMH 4PJDF 1KYOJ 4IDJL 3ZE2E 2X1PA 3W0WB 1OLZA 1NQBA 1AR1C 3EJCA 1U8MB 3SQRA 3P0YL 3FUJA 5A2LH 4R83A 1NJ9B 2J6EA 4YHML 1B90A 1REIA 4MXWH 1IC0A 1UKSA 2F7QA 1U8NA 4FMVA 4LPUA 1CLVA 3IH7A 1Z0NA 1PKQB 2D4DA 1U4EA 4OF7A 2Z91A 3D9AL 3U36B 4CVXB 1G7HA 1L9MA 4P2QB 2EH7H 4JKPL 1KF9B 3GMPB 2R2CA 2R0LL 4WI5A 3MLZH 3MFFA 4IOSA 2H3KA 43C9A 3CH1B 3KLKA 3QPKA 3GUFA 1TNMA 3L45A 3QJHB 2AJYH 1Y6NR 1ZVHA 1IO4C 4L3EB 1IUZA 2ENSA 1WCQA 4H8UA 4ZAKB 5EEZA 5HD8D 2EDTA 1LJMA 4M6OL 3E8VA 2CQVA 4OLEA 4C56D 3NCJH 2DM7A 1I1YB 3T0VA 3HZYB 4K2UH 2JI3A 3RWEA 1XF4B 5CKAA 4GW4A 5J89A 5E8PA 4PWEA 2V6HA 4J5VA 4DNLA 4UQIM 4DJMA 3KPSB 3SQBB 1KB3A 3DROA 3LZLA 1MF2H 2VLJE 3ECQA 1TJXA 2NNXA 4MKTA 1DUZA 1HKLH 1PFOA 3LYRA 4AIXA 4XX1E 5F1NA 1N2RB 1KBGH 3QUZA 3ZT7A 5HDQL 2FRGP 3MRPB 4NQED 3DBSA 4PJAA 1WPCA 4MXQD 4UV7L 4XB8A 3VD0A 3NRFA 3MRLA 2W60A 1I1AC 5HGBA 3RURA 1OAZH 5I82A 2W0LA 5JNYB 4YSCA 1LHZA 3EOYG 3JT0A 4UTAA 3IMWA 4ODWB 2H9GA 1WFJA 3G6AB 4CN6A 2F54D 4UAHA 3BH8B 2GUOA 4MLSA 3SO5A 5CJOL 3B1TA 3DOHA 4BH8B 4F8QA 5AENA 2XV3A 1JYXA 2KPNA 3STZB 4AYMC 3DIFA 1KYOK 2XHIA 1M3QA 2BERA 3LRSB 3GSNB 4P06A 1OEZW 4QXUH 5DS8B 5F6IC 1LWJA 4G80A 5DJCB 1IEBA 3V5DB 1X6LA 1C1EH 4UT6H 4N4YB 2MNUA 1ZLWK 5B8CB 3Q48A 3G9VA 3IMBA 3BRFA 5KL0A 5FYKD 3ARED 5CEZH 4FQ1L 3Q7JA 5CN2A 3FO0L 4O2EA 5IMLB 3RUGE 2GT9A 1NDTA 4LHUD 1KCKA 4WTQA 2DN7A 4F8LA 1I3RB 3SKOB 3D2TA 1R3LA 2C7UB 3NOIA 5JYMA 4F7PA 3KPSE 4UM9B 2PWEA 3UYRL 4YX2H 2HFEA 3UADA 1E43A 5LKNA 3BSZH 4YQXL 3AAZA 2ZXEB 3KLAB 1KCLA 3SDDC 2V9RA 4V1DB 2A74C 4XPGL 2WMPA 4M7LH 3W1ZA 3G9AB 4HUNB 5CSGA 3FUDA 5D55A 4ZXBC 3ZE2F 4AQ8A 2X6BA 2BHFA 1E6OL 2DEYX 4H44C 3HS9A 1UGNA 1E28B 4MCYB 4AEHL 5CSZB 1J1PH 5ID1B 2DS4A 5I66A 2P4AB 4S1DC 4XVOA 2Z4QA 1EV2E 2X05A 1E67A 1FWXA 4Z95L 2F1BA 5GZOD 4YDVB 2WGXA 4MDRA 3UAAA 1X5LA 3MXWH 3H56A 4O51B 3HHSB 3VXRD 5BMFH 1DVXA 2BK8A 1TCMA 2AEOA 3LQAL 4HKZB 3WMSA 2IFFH 1OCWL 1N4XH 3KWWA 4WNQB 2D7TH 4BRVA 3OXRA 4EN3A 2AW2A 2MRYA 1WH0A 4PH8A 3HI1A 4J3OC 4XO9A 5IREA 3CFQA 4PTTB 4K71B 3TL5A 1NGXB 4HT1H 4R4NC 4YHNA 3TZVD 2X9YA 2G9KA 3NTCH 4LLUB 3TYGH 4BFOA 3VH8G 4LCUA 1GSKA 2WIIA 4OIAA 3PWPB 1CPUA 5BZDB 4ZOCA 1C8PA 3BWAA 1IRAY 2HT2C 4U7SA 2WWMD 4OF0A 1HDMB 4QT5A 4FXKC 2NW2B 5GIRA 4URTB 1K3ZA 2ENYA 5CBAB 2IG2H 1FN4A 1YAIA 3MV9B 5E8NA 1T0OA 5TFSH 2I26N 1JYVA 2JI2A 1RPUA 2HPTA 1ZJAA 5A2JH 4MBRA 3RWIA 4BZ2H 2I07A 3ZZSA 3KYNB 3HE6D 4NWTH 2AJ3B 1KNOB 4K73A 3CSTA 1KN4H 5E03A 3EHBD 4JM2F 1XF2A 3GI9L 5J3HC 3CN0A 3QG7H 2VIRB 1FL3A 4NRYA 2IPKB 3AY4C 5C08D 1FFNA 5IMKA 3RWHA 4BSVB 4IIQC 2J8HA 4CL7A 1B2YA 2O5ZH 3L9EA 3QFDB 4QOKB 2AQSA 3KPRE 4JJ5B 5L2KE 5MEPA 2VSDA 4UDUA 1M7IA 3MPCA 3PMGA 3WFDL 3MRHB 4N20A 1EEUA 1G9MC 1ZV5A 4OGZA 1TNNA 1TJGH 5C0IA 2VDOL 3HMWL 3LN9A 3QFJD 5D7IE 2KS0A 3L7EA 5E94B 1DO6A 4KRLB 4X7DC 2NUPA 3PNWB 4WTZG 3CCHA 5E6IC 2F8OA 1I1FB 1H8SA 2VRQA 2DQFA 4L8SB 4OZHA 5TDNB 2XNAB 5ANMB 3T0EC 3L5XL 3RX8A 4OUUA 2DQEL 4X4KA 1PU0A 3BPNB 4HCRL 4GMSH 4WZSD 4X6BA 3RUGF 1SN5A 4GKZA 3IT8D 2AZAA 1RUAH 4HD9A 2MNWA 4FQ2H 1OAKH 5DLML 4BFIA 4M5YL 2HFFB 4KAQH 2JJSA 2IGFH 2ZSWA 3MRIB 4PCKA 4E9TA 4XX5A 4M7KH 4QXTA 3EDEA 3ZRCC 5C7XH 1KCVH 1F1GA 2X87A 5JW5B 1AP2A 3OJMB 3UC0L 1YMME 2Y7NA 4MA3A 5BZWA 5IT2H 4GBXC 4PMEA 4BKLA 3PWLB 1V54B 1R3KA 1RJCA 3LKOA 2X4TA 5BRPA 2YQBA 3FU5A 2ESVB 3QT2A 2HT3C 2XA8L 1EVUA 3QUXD 4AEEA 4E41E 1W72H 4QOKE 1URLA 3WJJA 4GRMA 2F5BL 1Q8MA 2NLJA 4NRZB 2AABH 4PREB 4IRJC 3RIFK 3S2CA 4GAGH 2WYIA 3T4AB 1NAMH 4WWPA 5F7YC 1KGYE 2NW3A 4MMXB 3FKUS 3OAZH 3ARDC 5I1IL 4JRXD 4YHLH 4DVBB 4ONHB 1JNHB 3BSHA 3VFPB 1U58B 3C04A 4G9FA 1OL0A 1DDHB 4XC1H 5F3HB 1S7SA 4PJXB 4FXLA 4MGXA 2Z8UA 3QIBA 1JNLL 3O3AB 4IRSD 3S8FB 3NT0A 4MNQB 3D7QA 4U1LA 4E42A 4OFDA 5F7DA 1JV2A 1S9XB 1XR8A 3VW3L 2VB5A 2IVFC 3OSKA 4JFDE 4TQHA 1TVHA 1BW8A 3CN4A 3FQNB 5B1BB 3X1EA 4PS3A 4ZPVB 1EEZA 5JORB 5TGBB 3GJFB 1HQRB 4MB5A 5I5RA 2X9WA 2V5TA 5DEGA 4G7QB 1DJIA 3UO8B 5BO0D 2BSTB 2W9DL 4IOIB 3P0GB 4Z7WA 3MLXL 2F9BT 2G3NA 3DK2A 4PJHB 3PIQA 4MDIA 2WAHA 2XV2A 5TD4A 4M5ZL 5T5NG 1JN6B 1S7RB 2VJ8A 3B56A 5A6IA 2Y2WA 3RVVD 4ZQKB 1EUVA 1MAJA 1F90L 2OTWA 3PDGA 3OKMA 4Y88A 3TTYA 4IBTA 2P5ED 1JZ6A 5F1IB 1COBA 3LPPA 1KJ2B 1A6VL 3TNNB 3C6LB 2F1AA 1P0SE 1EXUA 4JFWA 4PS7A 1QN8A 1MFAH 4DEPB 2UZPA 5IHZB 1RUQL 3PRZA 1LE9A 4HJEA 1ECZA 4Y2DA 5MENB 2HVJA 4PJXE 5IG7A 3TN0A 1VEPA 4F3FA 1ZANH 3ZE1B 4MNQE 5D7IF 3GS7A 1KCWA 4U3SB 1XIWB 1JFIC 2V5MA 4XCEB 2FECI 1ND0A 3BDBA 1OTSD 2FYVA 3WYRA 3OJDA 1ZT7B 3BKYL 4OCXH 4YBLC 5ESVB 3V0GA 4NQDD 1JRHH 1FI8C 3CU7A 1UT7A 4OCMC 3UIYA 3UFIA 4F8TA 2G60H 1JCVA 2NY1B 3BUDA 3OZ9L 1IC7L 5F9OL 2GKIA 3PP4H 3C08L 2PP8A 5ADOL 4NC0B 1PG7H 3EFOA 4O02L 4RNRA 1VZIA 4J39A 1M3HA 2KZBA 2V7HA 1A7NL 4M3KB 5TQ0H 4D9QE 1UEYA 1FE8H 5EN3A 1HHKA 1G6RA 5JUEH 2DWXA 1MJ7L 4ANKA 1D5MA 3H9SD 3WFCH 5J6HB 4XVUD 1DQQB 1SRDA 4G6JH 1M1XB 1V55B 2HKAA 4Y89A 4LLWB 5JQIB 5IYBP 2HRPH 4J4PA 3FK3A 4O2FA 5EO1B 4MAYC 2Z8VC 2YEZB 4M62L 4FQQA 3FYIB 2B8OT 3BVXA 3GKWH 3MCYA 4WJG3 3T4YB 4FKHA 4AQ1B 1YC7A 1AGDB 2WLIB 5AYUH 1NFIB 4KI1A 4HC1A 4GO8A 4RRPG 4WTZA 4HETA 4KTEH 3VNYA 4L9LB 3NEEA 1RZGA 3V6ZA 3T04D 3VFWB 3MLSH 1CLZL 3OQRA 3Q2LA 3WEXA 4ABUA 2W94A 2XJKA 3H2WA 3IS0X 3CX2A 3BRGC 3VDBA 2ROYA 1JK8A 1CGWA 3QJFA 4JFXB 1WGOA 4O5LL 4GEIA 3DX6B 5EBMB 4KZEH 2EACA 3ZHNA 2OYMA 4JY6A 4QRSA 1DUYB 1QUNA 2NY5C 2H26A 4LAQH 4U1HA 3A24A 2J1YA 4XXDA 4XB3A 3QUMB 3VGAB 1HILB 1ODAA 2FJGA 3QH3A 2UWEB 1OVZA 1SDDA 1UZ8A 2XZCH 4DO6A 5J57B 4PJ5A 1OM3H 2Q2LA 4LP8A 1P84J 3E0GA 4LSPL 4S0TD 1QNIA 5K9QG 3ULUE 2VM3A 4XMPL 3VD2A 1I9IH 3E3QC 1J8RA 3EJSA 5CU9A 4PJCB 3AXHA 1MCQA 3PXLA 1H3XA 1QKZL 3T5WA 4WI2A 3CWUA 3WUWG 4ZODA 3L6FB 2BNRA 5M7QA 2DI7A 3FB8A 5DZPA 1LP9B 5INCB 3FXIC 3ES6B 1J5DA 4YL4A 1BFOB 4KITB 1B0GB 4ZFZB 4NYLA 5TDPA 3D85B 1NPJA 3BD4A 3SKMA 3VXSA 5IEHB 1D5BA 1IC5L 1YYLL 2EE6A 4PM1A 4Y9CA 4LVOC 1NC4D 2BNQB 5AKSA 3BAYA 1D9KB 3SBWC 1BD2D 2VDQH 1NM4A 32C2A 3OKDB 1AIFA 2PABA 1L7TH 2Z31C 5JOFA 4PJXF 5DWUL 1TF4A 3VGHA 1TYEB 4JPIB 2DYRB 2HFTA 4JCMA 1UJ3B 1LDSA 2WM0A 2Z0UA 3GSOB 3QIUB 1O9WA 7FABL 4YSAA 2PWDA 2BDNH 1AR1B 4CU8A 3B34A 2BP8A 1MNUH 4U6HA 3KWTA 4XOAA 3L48A 3HS0C 4TOYL 4AJVA 3EXLA 1LEIB 1YSOA 2X4SB 2B1AL 2ZKHH 2MZ8A 2YGPA 4GG6A 1AR2A 3NA9H 2CKBA 2GUYA 1MXDA 4GIPD 4OLYH 2ZOOA 3BE1H 2R69A 3GTVA 4I89A 3H9HB 3MX0B 4PJHF 2QTEA 1XXDC 1U8HA 2BX5A 2OR9H 1UACL 3QQ3A 3REVA 1CGSH 2R83A 4KZDH 1WE5A 5FIEA 2CBQA 3L1OL 3LS5L 3VWKC 1VSCA 4NB7A 3HNTL 3I6LE 4ROEB 1C9BB 3U30C 2YUVA 8PAZA 1CR9L 3NJGA 1KV3A 5GGSB 2DLHA 2H7WA 1LP9E 2EKSA 4MNGB 1ZVSA 3UTZA 1NINA 5HPMB 5J1SC 1E27A 5BS0D 5CR1A 1KC5L 5HGGS 4MRBA 2WYTA 3F7PC 3B2DC 1BVLB 3GBEA 3RPJA 2D03L 2BNQE 4HWZB 4W9CC 3MGOB 1TETH 3TE5A 3QJSB 4OIBA 3MRQB 1P84K 4YIQA 3QS2A 3QXTA 4NQUA 4YSQA 4IQHA 1TJIL 5AB0A 2Z0BA 2HLAA 3CFKB 3TVMA 3H54A 1ET8A 1MHEA 2XA3A 4AUUA 2V8QA 4M8VA 3QR0A 5AKTA 4J6RH 4N5ED 5L4FA 3N06B 1IEAB 4L1SA 3BGMB 2DQJH 2OCFD 2A9NL 1NBZB 3DUHA 2AJVL 4LSRL 4X9IA 1L0XA 2R1YB 4NM4L 1UWFA 3FU3A 1B6UA 4GIOA 5FGCB 4XNZB 1I1AB 4L4TE 5TE6H 5KTEL 2JCWA 2W8CA 1ZAGA 2W1NA 2A73A 5DI8B 3VGBA 1P6WA 4QRUB 5FX3A 1P5GX 3B5GA 1YC8A 2PW1A 2J6EH 3ALXA 3IJEA 1JNNL 4P2RE 3L4WA 3W11D 4EKXA 2MSPA 5FO8B 1ZLEA 4QXGH 1A66A 4CAGA 4XMWA 4HPHA 3EYVB 2JNZA 4DCQA 1FFPA 1MJ8H 2CHXA 2PP7A 5LCVA 4MNGE 5GQBA 2R1WB 2VKWA 3ULUF 2GITB 3PXHA 4G8AC 4GT7A 3RVXD 1LE5B 3EADA 5F71A 3HJEA 1JZIA 3FW6A 1UKTA 3GNML 4I0PD 2IOOA 2CRZA 3I9GH 2HTLD 1FO0H 4MNHA 1VACA 1OTTD 4IU3A 3P4OA 4NUMA 2FWOA 5FCUH 3P4MA 1Z5LA 4HDIA 5ICUA 4ZTEA 1X5IA 1EJOL 4RRPA 2F8VA 1FNLA 1RKRA 3HBZA 1A22B 4G9DB 4Z7VE 4Q6IC 3CSYB 4JO1L 1MIMH 3A21A 1TZ8A 4G70B 2CXKA 1HN1A 3NJHA 5HDWA 1YAZA 3SDDB 5HJDA 1ITCA 1DVQA 2A74B 4WEUD 4KVPA 4YBQD 3G5VA 4PRHB 1OGAE 4ZXBB 4HIXL 2VJXA 3H85A 3LQZA 2W0KA 1KULA 4RFNC 1T1WA 4F2MB 3O2VL 2A83A 3JSSA 5F70A 2O1AA 3AMKA 4HWEL 5D6DC 1UT2A 1CFQA 1DL7L 1FH5L 1LO3H 4MJIE 2A4CA 4S2SB 4XXCA 3OMIB 4UTAH 4Z0BL 2ZUTA 4AYFB 4L8DB 1DJSA 1YQLA 5D1QA 5FGSA 1X5ZA 3KCPA 2BP0A 1K85A 3K6IA 3P73A 5I24A 5EIIB 3FCSA 3TA3D 3VGFA 5D7LB 4G6ML 5GRXG 3SE9H 3WUWA 4ELMB 5C0CA 3KYAA 1TLKA 1FORH 1LP9F 5CR8A 3MV7A 5KANG 3F2LA 5SWZA 1JZ2A 3HB3C 3AWGA 2EYSB 5CGYD 4KQ0A 3SDAA 3FRPB 4OJYA 4XMVA 5HI4D 1DEEA 3Q6GL 1DQKA 4EAGA 2NY2D 3S7GA 3VFTA 4A66A 1RK0B 1ZIBA 4ZX3A 4FXKB 1U8JB 3EYSL 4ZW3A 4C8XA 1P7HL 2Y7MA 1X44A 2XUWA 5D7KD 5ACZB 3VJ6B 1F6AB 5HDLA 3VQMA 3E8UH 1NCGA 4EBQH 3T77A 5EPCA 4ZPTA 3T3MB 4X6DE 2HZHA 1QSEA 1DBMH 3K91A 4X42A 5IOPB 4X6CE 4P2OA 2DD8L 3AQYA 4U1MB 3VVWA 2B39A 4N2HA 2XXGA 3QRFM 2XPGB 1EVTC 4X4XA 5D7SL 3TBTA 1KWKA 4M8RA 1CF1A 1TIUA 4G7YH 4IIQB 4XNQA 2Z9TA 4PLNC 2JK5A 3CV5A 4DOHB 4IBWA 4GQRA 5I8CA 1IVTA 5KSAB 1EJ6A 2X6MA 1ACYL 5B4MD 2J4WH 4HCFA 1H3PL 4LLQA 4X5WB 4ELME 3WTSA 1OSPL 3IJSB 3KNBA 2VZUA 4P3DA 4FL4C 4ZW7A 4HIEA 4C83A 5IQ9B 3GRBA 1UM4H 4IOSD 2BOLA 3MRMB 3K1KC 2R2EA 5HHNB 4OGYL 3VTMA 5I1LA 3IRZA 5E6IB 2YPKA 3BWUC 3T0EB 1QRNB 5DUJA 2CLVA 1X9LA 1MRCH 3IDNB 3VFUA 3AS2A 4QNPE 3NA5A 4QI3A 2K3HA 4OSUL 3TU6A 5LXGL 3PABB 4Y4KA 5K9QI 3JWDL 4PJIB 3U4EA 3AB0C 2EDXA 4QJ5B 3A5VA 1MY5A 4OLZL 1FH2A 3BUYA 2CCWA 1PZ5B 3MMEA 5HVFB 4BH7B 2H4EA 4L4VB 3V6OE 5DMKB 2LFEA 4KKCD 4J1UB 4PS4H 1VEOA 3WLWD 2IBZY 2NT1A 3GIVB 5DZOA 3T3ME 3DX9A 3GO1H 4FKKA 1J88A 3AT9A 1AXTH 3N50A 5JZ7D 2QADC 3MLPA 1PFCA 1IBZA 1RJLB 3QUZD 1UOWA 4GBXB 3WN5A 3P2TA 5C07A 4LSSL 3LH2H 3VI4E 4OFKA 1NOAA 4OVVA 5F6HI 1MFMA 4NQTA 3QZBA 2QKIA 1AXIB 4Z3HA 1KBVA 3G6DH 3H7BA 4HUVB 4WW2C 1L7IH 4IRJB 2UZYA 2AZUA 3S37L 1RLWA 4WKZA 4PY5A 3CH8A 3ARDB 4GAYB 3FPXA 2E7BA 2IMMA 1Z2KA 2X2YA 1AKJA 5KBKA 4X7CC 1QNZL 2XWBA 3ZOAA 4OAWA 2A6KA 3L8QA 5BW7C 1IGTB 2YMXH 2IWEA 2OMWA 3IDJA 4Y5YA 3W82A 1XGPA 2KMWA 5J4MA 1NOLA 2OMVA 2XI9A 5ABDE 4XXWC 4JFEB 3ZR6A 4L1BA 1AKPA 3IPEA 4XI5D 2ITCB 1ACCA 4RA3A 4ENED 2IANE 4IM8A 1J3MA 4LSVH 4MD5B 1MI5A 2J7LA 2NDFA 3EDDA 5INDB 3G5ZB 1EEYB 1EZSA 3AM8A 1BVNT 1NFDE 2JOIA 3QORC 1QNAA 1QN7A 4RWHA 5F1SA 5KYXA 4KTDH 3ARZA 3X12A 2Q3XA 3RWFB 1O9VA 3BQUA 3UTPE 1FJ1A 1AE6H 3WFEH 2BVOB 4WLCA 3W0WA 2XSKA 1A9BB 5JMOC 2VXQL 4FI7A 4NN7C 1U8MA 4X6DF 4DKDC 5H4YA 3Q2NA 1NJ9A 1J1XH 4K5OA 1W8NA 3GMLB 3IDMB 4DKFL 4MQXD 1UA6L 4W70A 1XMWA 4X6CF 1UVQB 4X5PA 1VCBC 2QFPA 2VLRE 3WEMA 4AJYV 1Q0YL 4P9ML 4PGEB 5IVZB 2FX9H 1LD9B 2CE6A 2WK2A 1PKQA 4I85A 5SX4I 4CVXA 3TEZA 2HJFB 3U36A 4P2QA 2E74C 2BJMH 4HAFA 3GMPA 2OKMA 1AZCA 1JPSH 4R3SB 5G2NA 4NUQA 2X42A 5LDUA 1YZZA 3MCLL 2FBJH 4ELMF 5ALCL 2DWEB 5ACMA 4F58H 3APMA 3BP5B 3G7TA 2QQKL 3QJHA 5B1JC 4HUWB 5BRZE 4L3EA 4KK9C 4J3OF 4ZMLA 2MCAA 2Y7LA 2WZ5A 2YBRB 4ZAKA 4ZNCD 4PRBB 4QR7A 4U1JA 1F0LA 4PVBA 4YBLB 5DD1H 4EN3D 4Z18A 1ZVNA 1I1YA 4QNPF 3ZDYE 4FMKA 5PCYA 3M7FB 1WBYB 2DYPD 3HZYA 1BF8A 3ZYZA 1XF4A 3OZKA 1NCAL 4TSAL 4WWID 1WAPA 1BA9A 4OLUL 2VERA 4WHYH 2UX6A 4L1TA 3WV0A 3B4NA 4ATWA 4Z8FL 3KPSA 5C0BE 3OKLB 3A67L 1E8WA 1G7MB 1PLCA 1N2RA 3LZNA 3OGCB 1PIFA 3MRPA 3T3MF 3CDCA 3N3EA 1OARL 3GTTA 1HU0A 5F9DC 2OMZB 2W5PA 1MAMH 3ABMB 1GL4B 2BIIA 3VI4F 3ZYOA 5DZNA 1ZLUK 1NANI 5JNYA 4HD5A 5JO5B 4L5FH 4ODWA 3G6AA 3JZ7A 4MAYB 1KXHA 2R7EB 3DDGA 2VXVL 1PJ9A 3BH8A 2OJZH 1UXWB 2APFA 1JSYA 3CBRA 3GWJA 4PGZA 1YEJH 4BH8A 3ZT5A 3QCUL 4DN3L 5FGBA 1NLBL 3STZA 3V9EA 1N3CA 4I77L 2RFXB 4ZMZA 4FFVC 3ATAA 3LRSA 3NSCA 5DS8A 2ZWNA 5DHXB 2K45A 2EDDA 3GGWB 1IQDB 1W91A 3CXHJ 5L4MA 4L4JA 4MQTB 4JDTH 1GOGA 1GC1C 3V5DA 1F11B 3DBXB 2V5RA 1BAFH 4XNMB 5B8CA 4MVBC 5EZLB 5AEAA 3L5HA 4HGKC 4TLUA 2PCFB 4PBXA 4AEIH 1BM7A 1PDKB 5IMLA 5JHBA 3INUH 5CCKL 1I3RA 3SKOA 5A2KH 2C7UA 4XZ4A 1HFUA 4OCYL 4F92B 4KC3B 4PLOB 4UM9A 2L04A 3CQPA 5D8JH 4JG0L 5DUBB 5EOTB 3D52A 3RI5K 3U7WL 2CHDA 2DOCA 1NGYB 4K9EH 4AWJC 3GLDA 4PLJC 4Z77A 4EO5A 3KLAA 3IKKA 4N68A 5ERWB 5KANI 5JTWA 5D4HA 3RGVC 4V1DA 3RGHA 1UL7A 1KENL 1XTMA 5BRQA 4JW3A 2Z3FA 2IH3A 4XNUH 4N22A 1LEGB 3WY1A 4Y7OC 1JXKA 4P9HH 4X5RA 5C0AB 2OXHB 4WI3A 4WDIB 1E28A 4MCYA 5BXFB 2YPVH 5CSZA 5JQ6H 4YSUA 2CRYA 1S3KL 2YS4A 5ID1A 4OM0L 4B0MB 4OGAC 3TLRA 1CFTB 1QSFB 4PIRF 3DLQR 3NZHH 1FYTB 3O81A 3QJXA 4YHOH 4ZSOB 4ZDHB 4LVOB 2XC8A 1Z66A 2RB8A 4XVSL 3WIAA 3RJOA 4MJ2A 4O51A 3HHSA 4PG2A 4OT1H 5J12C 2DTML 3B3IB 5GISH 1ZPUA 3IFLL 4WNQA 2E4TA 4LVNB 3DRQB 5EG6C 3NABH 4G9FD 4PTTA 5TK4A 1NGXA 4JPVH 1T5WB 1PVSA 1HHGB 4XWOD 2OL3L 4LLUA 3LS4H 4S1RH 4M6ML 3PWPA 4G6FD 5CZVH 5D2NC 3TH3T 3ZDYF 5BZDA 4JRWA 3VX0A 4NRXB 1HDMA 2AP2A 3BKMH 2NW2A 2WXKA 4I7ZC 3F6JA 1BFVL 2JKXA 4LSDA 1T2XA 1F8TL 5CBAA 2AQ3A 3CXHK 4KDWA 3MV9A 3LY6A 1BFTA 1BZOA 3E3QE 5D70L 3FT3B 4LSQL 3QEQE 2AJ3A 3VWKB 1KNOA 5AN4A 1JZJA 1LDPH 2Q86A 4Q89A 1D5ZB 2EICA 3ECWA 2VUKA 4YSEA 2ZXQA 2VIRA 2A9DA 1KPVA 1JGEB 1S78C 1KYAA 4BWWA 2FEDD 1DQLL 4CFFA 5FFOA 3GM0A 1U93B 1JXGA 3ROLB 4JJ5A 3S35H 3MRHA 1RH8A 1M2VB 2COQA 5E94A 1JWSB 3VD1A 3OC5A 1GZHC 3PNWA 4Y2DD 3S9DB 4A6YB 2I9TB 3L08A 1I1FA 2MQ3A 3TN0D 2JQZA 3ABLB 4L8SA 5TDNA 2XNAA 5ANMA 2GIMA 4M1DL 3JWNH 4I48B 2EXTA 5KVFH 4MZRA 3DO7B 4XHJD 2RJMA 3GF8A 4W6WB 2F19L 4P49A 4W9LC 2VDKH 5ELIA 5EUOE 4PJ9C 2HFFA 4ABVA 1CL7L 5T3XH 4LZKA 3MRIA 4ODVL 3MLWL 2J3SA 1OM9A 3CAFA 3MKKA 1WAAE 3ETTA 5JW5A 4U05A 2KI6A 4AEFA 2R69H 4FNUA 2K4AA 1N9PA 4FTVD 2F7RA 5IJKA 3J8F7 4UTBA 3U0TB 3PWLA 4JO5A 4F20A 3WIFB 4Q9QL 2ZOTA 3U1QA 4UUJB 1U92A 2ESVA 1J0KA 4DK6A 4RMVA 3FHEA 4I2XA 4WI7A 1U0QA 4L3FA 2R8SH 4NRZA 4DUVA 4PREA 2A38A 3ZLQC 3SDYL 3UYPB 3T4AA 5BCAA 3MV8B 4J4PD 1C8QA 4MMXA 4LOEA 2L7JA 1OAUH 4YHPB 1PCXA 5CNHA 1CT8B 1INEH 1JNHA 4ONHA 1U4FA 3VFPA 2YA0A 1U58A 1AYRA 5F3HA 4M7JH 3WOVA 3A3YB 1WITA 4OCWH 5KYXB 4OZFB 1FUNA 5DD5L 2EDMA 1ILUA 3IFOB 4MNQA 2N7BA 1JFQH 2ZYIA 4XR8C 3L1FA 4XNYH 3FQNA 3RGBA 3R4RA 4RFNB 4F9PC 1SXNA 4YFLF 3UJTL 3K2KA 4ZPVA 5TQ2H 4AW4A 5JORA 4LLVB 3GJFA 1HQRA 2H1PL 2ICWI 3NZSA 3U0WL 4AT6B 1I1CA 4OIIH 3LNHA 3V5HB 1X4YA 1A7PH 3PCYA 4IOIA 1QNEA 1JHTB 5H4ZA 5CZKA 3CZFB 4PJHA 5GRUL 3GLZA 4RODB 1N6UA 1OSEA 1S5IL 3T2NH 1S7RA 2Q8BH 4H26B 5AW8B 3KYKH 2WTPA 3VCLB 5FUZL 5IFAL 4Z1PA 1OCZB 1Q4NX 1NAKL 5LCVH 4B95C 4I8OA 1JHKL 1KTLB 3U7YL 3CLEL 3T8XB 2FO4B 4H25B 1WIPA 1YDPB 4RFEB 1MG2C 4A7SA 2W91A 3TFKD 3HB3B 1PG7X 3TNNA 3UXFA 2BNRD 2NRDA 1S8DB 3C6LA 3NQIA 3WXVH 4B3VA 1E3FA 2F7OA 3GBMH 4XN1A 1O7DC 3RDTA 5J0BA 2X3CA 1ACZA 3GMQB 5C0JB 5IHZA 2XCMC 3VXSD 4PCYA 5MENA 1OV8A 1QHQA 5E4AA 1BYOA 3OLPA 5AWNL 2FL5A 3VA2C 5BUPA 1ZV2A 3H55A 3TBBA 5HD8C 3BCDA 2PR4H 4U3SA 4XCEA 3B9EA 1CBVH 2JLLA 1F5WA 2K4WA 1ID5I 4NNPL 1YY8B 1RU9L 5ESVA 3WJLA 4AITA 5KZCB 3QA3B 2FGTA 4JFUA 5C2BL 1E4WH 9CGTA 1TXKA 3FSOA 2MTPA 3EZ8A 2KQNA 2ZIDA 4IHOB 1JWMB 5I1KL 1MCPL 5EUOF 1JPEA 4KFMA 3OC8A 1CXLA 2BIMA 2EDKA 3CDYA 2R29H 3E6FB 3LKRA 1VFUA 1NEZG 1IAMA 3CFJB 4HHAB 3OSTA 4XT1C 1M6OB 1T7ZA 2V17L 1HEZB 4WK0B 3OSEA 1MCDA 4K15A 2G2PA 4FL4B 5T3ZL 3TEXA 5AVWB 1WWBX 1P6FA 4Y9EA 2X4PB 1IJ9A 1JAEA 4AH2B 5T3ZE 3KJ6H 2OK0L 3DYOA 1DQQA 4HMEA 1M1XA 4J3SA 1MNNA 1E3ZA 4LLWA 1UM5H 3ULVL 5KBDA 3KBEA 2E7DA 5EO1A 1UA3A 2XV0A 2YEZA 5GPRA 3ULVE 1D6VH 1S46A 3AB0B 1FNAA 4UOJA 2JVUA 3T4YA 2WLIA 1AGDA 3X14B 2IAAC 4AQ1A 2CLRB 5MI0C 1NFIA 4QG5A 1D7CA 2WVSA 2YUXA 3KPOB 1FLRL 3NJLA 4QGTA 4FULA 2B9AA 4DGYH 4UIKH 1RUKL 1F3DJ 3I6GB 3AREC 4NQCE 3VFWA 5KS9E 2Q1EA 3O4LB 1IKNC 2NZIA 2F61A 3CBJB 3FT9A 3P3YA 4I9WD 5ITFB 2QADB 4PJ6A 3X3FH 3CD4A 2CLZB 4QKXB 4JFXA 1FGVL 4R4FL 4TYUA 4OCRL 5EBMA 2I5WA 1PY0A 2B5IC 3HC4H 3Q8AA 1YYMH 1YMHB 1DUYA 4EZJA 5DRNB 3HUJE 3CN1A 4B9KC 4LCIH 4YDZA 5BUGA 3QUMA 3F04A 4HAGA 5EZIH 4KQ3H 2HLFC 4WW2B 1HILA 2AV7B 3KWXA 4XP4H 1QLFA 2UWEA 3TP4A 3QR1A 3LXCA 3V7MA 4BYHA 3PWUB 4RAUB 2XJLA 5DHYA 3VMNA 4JNXA 2CJTA 4S1QH 4GQZA 3AJ7A 4AGMA 3JUYA 3KPLB 3OM3B 4YWGL 4PJCA 2VMJA 4U1SB 4QRPE 5C6TL 2DI9A 3L6FA 2I7OA 1UCBL 3HPJA 2VDNB 1CXIA 1XF1A 2PWGA 4PUBL 5AOKA 5GZNA 1LP9A 3C5SB 5INCA 3U2SA 3ES6A 5K69A 1BFOA 2Q3ZA 1B0GA 4J3OG 4UTCA 5D96C 2NX5B 4CGTA 3D85A 4Z7IA 3O3EA 2BIHA 3WIHH 4ALAL 1U3NA 3FRPG 1NCNA 2XTLA 2EUVA 2BNQA 5KJRH 1RZ7H 3FUIA 3U1SL 5F1OB 1TDQA 5E95B 1DJZA 3KE0A 1DSYA 2BVEA 1GZQB 3QORB 2NOIA 5D2LE 1CIUA 4JPIA 2OAAA 1UJ3A 3QS3A 3GSOA 3ELQA 4R97C 5KEZA 2XU9A 3QIUA 4PJBE 4NN7B 2AQ2A 4B7IA 2AS5M 4AK1A 1M05B 5AL0A 1LEIA 4ACTA 2X4SA 5EOCJ 3WAJA 1MFCL 4KY1H 2V37A 1F4AA 1AHWC 3TXAA 3MVSA 5C0FB 3H9HA 3MX0A 5K9JL 1IC1A 4H20L 4HVBA 4P5TA 4XPAH 4Z3IA 1MHHB 2JFCA 4J3BA 3JV5A 1JS4A 2DKUA 3KXFD 3OLIA 4NIYE 3NJFA 5E7FA 5D1QD 4GQ9L 2X4UB 5GGSA 1EFQA 2O6DA 3M1OA 4FG0A 3VFMA 4PWJA 3BAKA 3FCUB 4NEHB 5HPMA 4X8GA 5DRXB 5C0CD 1OK8A 3CQQA 2ZCHL 2MPAL 3FB7B 1BVLA 2YLHA 3MLRH 4XRCA 1JHLH 4D9RE 3MV7D 2YD3A 3AS3A 4HWZA 4ZTPL 5GGRY 3FCGA 1QR4A 3MGOA 2Q9OA 3ULVF 2YJLA 5F96L 2BFVH 3TYFB 4LT7A 2X10A 1YEFL 1FNFA 1CN4A 1A4KB 3FU6A 4W6XB 5DGRA 4ZD3L 3ZQWA 4YH6A 3CFKA 1YEEH 1J5CA 2XPZA 3NSYA 4DGVH 2VR8A 2QEJA 5K1VA 5LQBH 1Y07A 1VZGA 1JNJA 5IVXE 1PW3A 1IEAA 4OY9A 4ZX6A 3BGMA 1NBZA 5C92A 2LFGA 2R1YA 1WP6A 4HA1A 3GIZL 4GXUN 1I1AA 2W9EH 3S3PA 5IB3B 2Y22A 1F4YL 4QHKJ 2LVEA 1QSED 1L3NA 1D5IH 1B88A 4QRUA 5GGVH 4QGYA 1L9NA 1P4BL 3HUJF 2NR6A 5GJTH 1DBBL 1SUHA 5IB1A 5T1MB 2R4SL 1I3GL 5FO8A 1DSFH 5I1EL 1BM3L 3UG5A 1WZKA 2HRLA 2PTTB 3EYVA 1R6VA 2EHBD 5JIQA 4HPOH 12E8L 3H1ZA 3FQWB 2R1WA 1SN2A 4KMTH 2GITA 5AW0B 3SDXE 3QUXC 1LE5A 1IBHA 2DI8A 1KEGL 3EOAA 1J1OH 1O7SA 2MQGA 3GSUB 3QEHB 4MB1A 1GYUA 4KXAA 2KHAA 3GHEL 1HNFA 1X9RA 4FZ8H 3EJZD 3DETD 1U8KB 3MRGB 1ZLDA 1YCSA 3VE0B 1RJZA 1USQA 4QAMB 4AUYA 2WYHA 2ATAA 1PZ2A 4XMXA 2DQHL 1KG0B 5C71A 4N6QA 4W9KC 5TDOB 3LXBA 2M83A 3A6CL 1ZLSL 3EAKA 4Y4KD 4EUPB 3EOTH 5JXAL 3ZT6A 3U83A 3CSYA 3MI6A 4IRSC 2HUHA 1IL1B 2NSQA 5KVDL 1XZ0A 4GP5B 1EJ8A 5D2LF 3RGVB 3SDDA 5BQ7B 2A74A 3A0OA 3AS0A 4EOWH 4OF5A 5KVDE 4PRHA 3JYCA 1IAKB 2F7IA 3MUY1 4UYQA 1UENA 2NY6C 5FDYA 5T1DL 4ZXBA 2E7LC 1XF3B 2VDMB 3TO2B 4CC4A 3IMSA 2ZCLL 4PJBF 4RX4A 1NCOA 2BVPB 4F2MA 4D7RA 2Y7QA 1I9JH 5FM4A 3ARQA 1P2CB 3VWJC 1DYZA 5C07D 5JXED 1LO2H 3T0AA 4PG9B 1NDMB 3HIZA 1E8ZA 3L4ZA 4S2SA 4C47A 4AYFA 3L13A 4L8DA 3RNQB 4PJFE 2Q5BA 2ZZUT 3QEUB 3MLUH 4MCMA 5EIIA 4M43L 5D7LA 1CYXA 5J12B 4BZ1H 1S7UA 3DA0A 1BJ8A 5B3JE 2A77H 2VKXA 4RDQF 3NPSC 1YUHB 2I24N 2XRAL 1AKJD 1EJFA 1IGIH 1JWUA 3LHPL 4UT9H 3O6MH 1GS7A 4QD2E 4ZS6C 1KJVB 3DIVA 5I76B 4ZX4A 2EYSA 1QHOA 2VZVA 4XBMA 3GQFA 3D3VB 3FRPA 3D8MA 5D2NB 1KIRB 2J2ZB 1PZBA 5C97A 5JIPA 1SVBA 1L9RA 2VRKA 3RDJA 1P4LB 1ZHLB 1QR1B 2AJZB 2VSMB 4FXKA 3AG3B 1U8JA 4V2BA 5ACZA 1OTSC 5E1QA 4Z7NB 3QPXL 1E2WA 3DXAB 3VJ6A 4AENB 1MI5D 1RIVH 1ORSA 3Q2CA 4YDIL 2FGWL 2H5UA 1BP3B 1NVPA 3ATDA 2D9QB 3KGSA 4R7VA 1KELL 5IVXF 1KV7A 4S0SD 2FZ3B 2VW7A 2DJUA 4FFZL 1WFTA 3BQUD 4RESB 4V11A 5H35B 1XGQB 2X4OB 1G9EA 2JB5L 5E6RB 2P7TB 4U1MA 5JIDA 3W0WD 2XPGA 1N0LB 1T21B 3QCVH 3AY4A 3LN5B 4IIQA 3NGBC 5FK9A 6FABL 1LWHA 3DYMA 4TVPL 1INQA 4XC3H 5KSAA 1DJWA 1S9VB 5EBGA 2EP6A 3HRZC 4TVPE 4OV5B 5B38G 3OH9A 1WSST 4X5WA 4P2QD 1CJYA 1F18A 3IJSA 5EULV 3ZW3A 1HK6A 5IQ9A 4HEPG 4XVUC 3SGJA 2IFGA 1JBJA 1F3JB 3MRMA 5JDJA 3VRIB 2HJKA 5HHNA 1SHWA 5E6IA 5CHNB 3H4FA 1B4JL 3D3VE 3T0EA 3S5LG 1D5XB 1QRNA 1S7TB 3EUDA 3K5RA 5EBWB 4GKNA 4L3ED 3OWRA 1F1DA 4DKAA 3APFA 2X0UA 2WLLB 4YC2C 4ZAKD 5KN5B 1CS6A 1B2WL 1U30A 2QZ5A 3PABA 4PJIA 4ZMOA 2NOBA 2WBJA 1OAXH 4NO5B 5CIPB 2E46A 4OD1L 4PBDA 5LG6A 2NNRA 1PZ5A 4FD0A 2YUWA 4BH7A 1XXFC 5ADPL 4L4VA 1PCZA 3ZTEA 4J1UA 3IXAB 1MFBH 1UZGA 4LL1A 1PTZA 3GIVA 1X5FA 4FRWA 1IGMH 3KS0H 4Y2OB 1RJLA 3BMVA 5CFHA 2G9HB 2EE2A 4GBXA 5D71H 2A6DB 3B8SA 3DV6B 3P2BA 4K3HA 1I82A 4KZCA 5FKAA 3ZL4H 3V6FB 2D31B 2FYYB 1WHOA 3QDAA 5T1LB 3HC3L 1F56A 3S34L 2MKLC 1OF2B 5FFGA 4PJEB 2WXLA 4HUVA 2BHYA 1NCWL 4XP6H 4IRJA 3D30A 4NZRH 5C1MB 1SEQH 2R0KH 4ZG1A 3PJNA 1TBPA 2EDWA 3ARDA 1A7OL 4GAYA 4PJFF 3FUKA 4N2GA 3EFDL 3GI8L 4X80L 3WDJA 3MLTB 4BKSC 2YK1H 4FQJH 4WEEA 4A38A 3IXTB 3S88L 1P4IH 4NQSB 4XAKD 5B3JF 4K5LA 1IGTA 3WSQL 4XCYB 1NSNH 4GSQA 3OG6B 4WFGD 4S1SH 1CD9B 4MA7H 2F08A 2N56A 3BPCA 3I6KB 4JVWA 4QHNA 3DVNB 4JFEA 5EA0L 1MCRA 4HUMB 2WNGA 1A6UH 4FA6A 2ITCA 3M88A 1KPRB 2DKDA 1J48A 4LRNL 4MD5A 3H0TB 5FV2A 3BVNB 5INDA 1HL9A 3G5ZA 3D5OF 1E30A 3BUPA 4UQAA 4UM9D 1R3IL 2RQ8A 4MS8D 5E9DD 2CO7B 4Q9CA 1KLGB 4W9JC 5C0NC 2HKHH 4LLAA 4X6EB 3RWFA 4BK8A 3FQ4A 4FG2A 5EU6E 2WD0A 2BVOA 4V1DD 3VRJB 3TC9A 1OCCB 2YXFA 4LDLB 4W4OC 4TL4A 4Y1AE 3GMLA 3IDMA 2X53A 1MQKL 4UTBH 1UVQA 4LPVA 5AUMB 5K33A 4JO2H 5IVZA 3WFZA 2GSIB 4PGEA 2QL1A 4MTMA 4EDWH 4XOCA 1HXMB 1MKFA 2HJFA 3F8UB 1S7QB 4LIQH 2R15A 1HCVA 3DJTA 4Y0GA 1RIUH 3EYUH 3CLWA 4XO3A 5IM7A 2DWEA 4NENB 3ME0A 3BXNB 1HNYA 3QISA 1MLBB 3BP5A 4HUWA 3KL5A 4M1GH 2FJHB 3IJYB 2FX7L 2YBRA 4GQPH 5DYFA 3NZ8B 4PRBA 4NZUL 2EIMB 3BVDB 1SF3A 5L4JA 6TAAA 2ARWA 4O58L 4TPRL 1WBYA 2JLPA 3LKNB 4JDZB 2VUOA 5IGXH 1KB5L 4TQEL 3EH2A 2BS71 4NC2B 5GGTH 3PWPD 5BVPH 2A7BA 2E7MA 1TU2B 4LDOB 3OKLA 4WWNA 2JELH 2CGRL 2QPSA 1G7MA 1IARB 3UIZA 2OW6A 3OGCA 3G5WA 3PQYA 1TMCB 4P46D 2RQEA 3MV9D 3EDFA 3FONB 3FQUB 4RFOH 2YXWA 4N9GB 3WAKA 1SF5A 4OUOA 5E9NA 5LBVA 2QVKA 5EU5B 1MWAH 2VABB 1N7MH 3QQDB 5LJYH 2J8OA 4EAEA 1W80A 4LCYB 4J7RA 1UJTA 2F54B 1QN4A 5JO5A 1X4XA 3W11C 4AZ8A 4RSYA 2RAMA 4MAYA 2R7EA 3BT2H 2H6OA 2FWUA 1OAYH 3B2UD 4N2EA 2XV6B 1UXWA 3O6FC 2OSWA 5KVEH 1FHNA 1YQVL 5GRYA 3NCCB 5MI0B 4GKOA 4UDTB 3RVXC 5TF0A 2RFXA 2Q8AH 1UWXH 1QLEB 4NPYB 4PJGB 4PB9H 4C56E 3GGWA 2MCPL 2ZAHA 1GAFH 1IQDA 1HZHL 4FGMA 1BMWA 1ZHBA 1T6WA 4MZIA 4BQ6A 2HTKD 1F11A 3DBXA 2OJ1A 1RUMH 4XNMA 5K5YA 5EZLA 3RIAK 1EK3A 2XBDA 1EIBA 2XVBA 4LHUB 4PLKC 3VVVA 2PCFA 5E2VH 1PDKA 5GJSH 3UTSB 3BUIA 2B5IB 1A6WH 1PNCA 1MEXL 2LR4A 2GJ6D 2XQBL 1Y7VA 5DUBA 5EOTA 4NDMA 1E5YA 4NQEE 2R1XB 4YDKL 4DFHA 3HG1B 5DSCA 3CVIL 4PJ7B 2J5LC 1AAJA 1NGYA 4PP2B 4XPBL 2F53E 4YBQC 5CD3B 1R75A 4DGIH 5ERWA 4MLIA 1V5SA 3DNKA 3DTXB 2APWA 3DHPA 5KYWB 4OTXH 4B41A 3TT1H 3B5TA 3DUUB 2F54E 1F3DH 3WD5H 3UG3A 2I60H 5C0AA 2OXHA 4G71B 4N2OA 4P5MB 4WDIA 5FYJL 2MCG1 4EZLA 3WS6C 4W9HC 5BXFA 4UINH 7PCYA 1V3KA 3QQ4A 5CINH 5D96B 2ZX6A 3S36L 1CFTA 1QSFA 1BEYL 1FYTA 3N85H 1XCWA 4K94L 3TA3C 4EZMA 4ZSOA 4ZDHA 4TLKA 1GY1A 3DX2A 1T1ZB 3K8MA 3SBWA 5FYKE 3HMXL 1WA2X 5HGDB 3B3IA 1CZ8L 1YEDB 4ERSL 5L2JB 3FN0L 1QFWH 2YJQA 3CTTA 1FFRA 3DRQA 5HI4C 1IM9B 2NY2C 5HJBA 1IBGL 2VMEA 1T5WA 1HHGA 3EF4A 5DGQA 3T1FB 3V4VH 2B16A 3DK0A 4NI3A 1J10A 3X1FA 1SXBA 4NRXA 3O6KH 4X8XA 1J8SA 3IWUA 4GW1B 4DKTA 1XAKA 3C8HA 4A67A 4LKXB 4LSUH 1U3YA 5DJYB 2CRIA 1TQWA 5KWYC 3AMLA 3LIZL 5FAAA 5M94B 3NSFA 5JHLA 3LZQA 4M6AA 3FT3A 4UQ9A 4PP1C 1S3RA 4H8QA 4JKMA 4RIRB 4WEMB 3VWKA 3HKZA 3K7UA 3K8LA 2CIIB 4FLOA 4BJLA 1D5ZA 5JN5A 5C08B 4NXKA 4NNXB 4YFLI 2ZPKH 3RVUC 3BZ5A 3NIDB 3STLB 2AXWA 1JGEA 1OE2A 3DSFL 2Y36L 5KVGL 4N24A 1QA9B 2AJYL 3VXRE 1JI2A 2E47A 1AQMA 3B7YA 5BZXA 1U93A 1Z9MA 2JTYA 3V9CA 5EOCH 1ADWA 3CN3A 3ZL1A 2QQLL 1QTPA 3NSDA 2VZTA 2DICA 1M2VA 1A02N 2IAMC 1XX9C 3ESUF 4K2UL 3RDTD 1LK2B 5DA4A 1A4BA 1JWSA 1N3NB 3IRPX 5A2CA 3F7YB 5MEND 2I9TA 1BLIA 4OGXH 5HJ3B 1NEUA 4XPHH 4HKBB 2GIYA 3I0XA 1UB6B 3VRLE 3DO7A 4AMWA 3M1CA 2OPCA 1FFTB 1IEHA 4KKCC 1EGJH 3WLWC 3L5WB 2DF3A 4KHTL 3BVTA 2YSSB 3O2DA 1BOYA 4FN0A 4OZIA 1O6SB 3UEQA 3ZE0B 4A7GF 5FYKU 3VO0A 3MRNB 1O7VA 1T83C 3RYMA 3F3HA 3QJTB 5AVSB 1FL6B 4ADGA 5C08E 1QEXA 4XPTL 4YFDB 3U0TA 3QUXB 3LIUA 4KKAD 4UUJA 4DGUA 5EF3A 1AJ7H 1QWUA 2XQYK 2E3VA 1KACB 3BZFB 4S10A 4EJYA 4JMXA 3S0PA 2HN7A 4AL8L 3S3DB 1BBDL 3Q05A 1W0VB 4LQ1A 3VI3B 4RDQG 3SYOA 2EIZB 4WW1B 3QFJE 2R56L 3FUHA 4F7KA 2IWFA 1ZCRA 1MZZA 2J12B 3MV8A 2X70B 2Q20A 2XTJC 2Y69B 1Y18B 2CD0A 4YHPA 1CL7I 1ONQB 3QZNA 4PJGF 1JZ4A 4D9LL 1EFXA 3QI9C 3QPQC 3OPZH 3ALPA 4N28A 1BEXA 4LO9A 4MJJA 2XX1A 3FUNA 4OZFA 1X5AA 4YX2L 1NIBA 4LEEA 4XAWH 3RG1C 3QYMA 3IFOA 4LGPB 2NY6B 4XI5C 1SY6L 4ENEC 2YLKA 1A7QH 5FHAL 5LGHH 4FCAA 4JQIL 4LEOB 5F6HJ 4XHQA 2BRRL 1JMXA 3UH8A 4LLMB 3HZMB 4LLVA 3EJRA 3VWJB 2Y9RT 5D6DA 4AT6A 2IALA 3V5HA 2WN3A 1UHVA 4D0DB 2VDRL 2H5AX 1F41A 1UG9A 5DC9B 1NC2B 2DM4A 1JHTA 2VXSH 2XIBA 2YGNA 1BMZA 4I5BA 2V2WB 2NT0A 2Z65C 5I71C 3TBVB 3DJ9A 3STBA 4OQ1A 2LLGA 4Q0XH 3VCLA 4MQXC 1I9RL 1AGEA 1H3GA 1NTDA 2HKFL 1ZS2A 4OFQA 1CFSB 3NPSB 4JHZA 1KTLA 2O5YL 4RWYH 4F93B 4JRXE 5IQNA 4G43B 4ZRGA 3T8XA 2JWYA 5BMFL 2FO4A 1A7RL 3MNWA 4JB9H 4RFEA 1YDPA 3WNKA 3V5KB 3TS8A 3GZPA 2IFFL 3MJ7B 4XBEH 4N2DA 4E36A 4KRPC 3ARXA 2PO6C 1A2YB 1S8DA 4Y9FA 3SDCC 5GZND 3ZHKA 3L2LA 3QJRB 2R0ZL 3D51A 2NYYD 2EH8H 4X5QA 3GMQA 5C0JA 3D85D 5FWRA 5HGHA 3S36X 3V79C 5J1AB 4AXWB 1FPTH 1WK0A 1H6FA 5E2UL 3FTWA 2XN2A 1I3VA 3FU8A 4IU2B 5BQDA 1GIGH 5D1XC 2A1WL 4OKVB 1HIMH 4FQPA 3CWGA 1NGPH 4AM0B 4BJUA 3K74B 4QEGA 1YY8A 3O6LH 1EHNA 2B1HL 5IHUH 3QA3A 4N1EA 4PV8B 5CGBA 3CXDL 3ECVA 2DQGH 4BZ2L 1UWEH 5A2IH 3QIUD 5IHWA 4IHOA 5DQ9B 2D0BA 3HVDA 2JKLA 3FFCB 1BV8A 1JWMA 2VQ4A 4XP5H 4XMLH 4KDTC 2A3TA 1TSRA 5DVKA 4FE9A 3NGBB 2XWJB 1I8KB 2NXZD 3DTDA 2Y7OA 2QFRA 4FYSA 3MV01 3QG7L 1FG2A 2V8MA 3E6FA 4K5NA 4TULL 5DJ2B 2XWTB 2BVTA 3CFJA 4HHAA 4JHAH 1WFOA 1P5VB 3HRZB 3ILEA 1M6OA 1W2KT 1HEZA 1FC1A 1NL0H 2Z34A 2P5EE 4XP9H 5CZXD 2HKPA 1GPOH 4P5TD 1IAII 1TTUA 4OIFA 4AH2A 5L88L 1W72B 1ODUA 3US0A 1XSIA 1TJGL 3UL4A 3ARTA 4Q8BA 5HSHA 1NAMB 2I5YL 1IFHL 5I75C 2Y4SA 1SDYA 1XGUB 2WUCH 1VGKB 3IDYB 4YC2B 2H41A 5J06A 5TE4H 2IIJA 4NN6C 2VDLB 1C5DB 3SE3C 3LXAA 1SNRA 3X14A 4XVTL 2CLRA 1XEDA 3KPOA 2FCBA 3K6FA 1DLFL 2RALA 1U95B 1KGCD 4Q97A 2LQRA 4NQDE 4AYID 4EUPG 3NIFB 1RUAL 2VR6A 3I6GA 3UBXG 1U8IB 2CA4A 3O4LA 3WLBB 2P48B 3H3BC 4OCNC 5ITFA 2F74B 2IGFL 1ZXQA 1AQKL 1FDLH 1A1OB 2CLZA 1UA7A 2KQMA 4KVNL 1OGSA 4CA4A 3F0ZA 4FABH 1ESOA 5C7XL 2W88A 2C5DC 4EXKA 1A3QA 2CO6B 3PWNB 4G1MB 4MSWB 1MDTA 3EF7A 5EHFA 1G1YA 2B4CL 3LPFA 5LWYH 3TJEL 5JIKA 1MIEH 3LVTA 4M02A 5DRNA 3B7SA 15C8L 1I1AD 2HWZL 2JJSC 2MNJB 4WW2A 4G3YL 3QE5A 4NC1E 3H9SE 3LVEA 3ZE0F 4B3EA 1WS7A 2YA1A 3VXPB 1EO8L 1YNLL 2BSBA 2PCYA 2NR6D 3CFTA 3HBPA 3PWUA 4RAUA 3VXTB 5L8KB 3F00A 3KH3A 3KPLA 3IPBA 5EU7C 3T1WA 4U1SA 2BHUA 2PETA 5BW7A 1TPXC 4FQLH 4MD4B 3AFLA 2DMHA 2W0PA 3A6BL 5DQJB 2HCZX 4GFXA 2MEJB 2UXVA 3BO8B 4BKTC 2VISB 3C5SA 2WZPA 4XXWA 3BHBA 4N0YH 5DK0B 2NX5A 1NC4B 4ZUUB 4AIZB 4OW6A 5E2WL 3SZKC 4GO6B 4PW3A 4ATTA 1DQJB 3C2SA 4JG1L 1GZQA 1ZA3B 3QORA 3PL6C 1FGNH 3HFMH 3U9UA 4MHHG 3L95B 1UYWH 4XCCL 1LMIA 4XWOC 1HINH 3IS1X 4HWBH 4PRHD 1HSBB 1M05A 2QGCA 3CDFA 1XMEB 4HLEA 5H2BB 4PY7B 4RX4D 2DAVA 1MW1A 1UXMA 3MNZB 5T8IA 3TIEB 4G6KH 5DVNA 3MBED 3H42H 5C0FA 1P6AB 2OSLB 2W65B 4NOBA 1MHHA 2C1PB 2K1MA 3N44B 4HF5H 4NLHA 4S1DD 3GXTA 4JZNB 1IM3B 4UZUA 4QTIH 1A65A 4NX0A 2IXQB 2X4UA 2QV4A 1C5CL 2PN5A 1KIUB 5D7LD 5DRXA 5BZZA 3SQOH 5IHBA 4YXKL 5BMPA 1BD2E 2FT8A 1TG8A 3BDYH 3KR3H 1N0XH 4K23L 2WLHA 1OCOB 25C8L 3DPUA 3H3KA 3TYFA 2DQTL 4AQZA 4MXVE 3G6JE 3NJXA 2XLLA 1E50A 4QO1B 1A4KA 4Y2DC 4IRZA 1I7ZB 5LBSA 4KKLD 1AGCB 4HX1B 3TN0C 2EC8A 4HKJB 5JR1H 1TMQA 3PP4L 2YAFA 1AGFB 2E6JA 3TWYA 1Q38A 1AO7E 2WXJA 3DX7B 4AVHA 5IB3A 3TV8A 4GNKB 2VL5B 3ZDZB 4B9IA 2GSMB 4K9EC 4JFHD 4F2FA 3B9VA 3SPJA 5L7XL 3UAFA 1CC3A 3P4NB 1NWOA 6CGTA 3ZQXA 5T1MA 2HH0H 3O6FB 5T5FH 3SYCA 4U3HA 4N2MA 4Z7OB 3VQ1C 5K9KB 1JCKA 2PTTA 3S6CA 4RMUA 5A2AA 5KSAD 5BS0E 3MODL 3FQWA 1YEHL 4ZNEE 3HHRB 1EAJA 4KQ4H 3GSUA 1NIAA 2YRZA 3QEHA 4FP8H 4JJHA 1GY2A 4FNRA 1B0IA 2Z8SA 1LXTA 5KSBB 5FGRA 4Z7QB 4ONGL 2F0CA 4KTEL 1ZGLB 3WIIL 3B7TA 5EF2A 3U6XS 1U8KA 3MRGA 5E6ID 4IS6B 4UILL 3VE0A 5CBEB 1FZMB 3EJTA 4JDEB 3T0ED 1QRND 2Y25A 4HCRA 1KIQB 2VDQB 2WAQA 1KG0A 2EJ1A 3E80A 3F65A 3FQ1A 1XH2A 5TDOA 4NO0B 3BFOA 2N1TE 2IH9A 4EUPA 3GRWA 1KYUA 2J5LB 4NZDA 1F3RB 2WBJD 2CJUH 3QR2A 1IL1A 2BLFA 3ESNA 3LNEA 3VU1A 3BH4A 2DYSB 3ZKQD 3QG6B 3RGVA 3I84A 4Y1TA 3WDIA 1TUOA 3A47A 2IOIA 4L4VD 1IBDA 1IAKA 3ZU8A 4OLVH 2WUBH 1XF3A 2DKSA 3TO2A 3OPUA 4Q9RL 1YECL 4NJAH 3QJUB 1OM3L 1LQSR 1F97A 5I30H 1U3ZA 4HS8L 3WE6B 1K8DB 1P2CA 4NHCH 4LGRB 4JAMB 1C08B 4KRNA 5GHWL 4PG9A 1NDMA 2VWEC 1KFAH 3NCMA 3ZK0A 3RZWA 2HT3D 2CO4A 4FCHA 1ID2A 2OV0A 4XVJH 4BFKA 3X17A 5I1GH 2HL9A 4ANXA 4FQHA