1QTPA

Crystal structure of the ap-2 clathrin adaptor alpha-appendage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
b'GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C)
molecule tags Membrane protein
source organism Mus musculus
publication title Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
pubmed doi rcsb
total genus 66
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 1999-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1qtpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qtpA02
1AISA 3VN5A 1RM1A 1QTSA 1PCZA 1QNAA 3OCIA 5CN2A 1JFIC 1GYUA 3MNMA 3HS9A 1NA8A 1QNCA 1VTLE 1CDWA 1KYUA 2YMTA 2D0CA 1YTBA 1D3UA 1VOKA 1KY7A 1QTPA 5IYCP 1QNBA 2E9GA 1W80A 3ASMA 1QN6A 1KYDA 1QN7A 1VOLB 4B0AA 1QN4A 2MJ7A 3ZHFA 2Z8UA 3EIKA 1QN3A 1PZDA 1NH2A 2A7BA 1QN5A 1P4UA 5IYDP 2G30A 1MP9A 1QNEA 4WZSD 1GYVA 5IYBP 1OM9A 2DWYA 3HS8A 4ROCB 3ZY7A 1IU1A 2D0AA 1C9BB 1TGHA 4ROEB 2IV9A 1TBAB 1QN8A 1KYFA 2DWXA 1B9KA 5CN1A 1NVPA 4BCXA 1TBPA 3OC3C 1VTOA 4PY5A 2D0BA 1E42A 2VJ0A 1NGMA 4RODB 1QN9A 3H1ZA 1GYWA 1R4XA 1YTFA 1KY6A 2IV8A
chains in the Genus database with same CATH superfamily
5A43C 2CA4A 3RX8A 2OZ4H 1IM9D 1Y18B 5I16A 2NY5L 5HTSA 1INDL 3BVNB 3U48A 4AL8C 4X4XA 4F8TA 4WY7L 3O2DL 4H8QA 4M8UA 4WKXA 4PCKA 1NEUA 4IBSA 4OGZA 12E8L 2GI0A 4V1DA 2OYLA 3CZEA 2QQNH 1KFAH 4N2KA 1EH9A 3FSWA 4JDVB 4BSWA 1OSPH 4LGSB 5FM5O 4NBZB 5C07A 3FFDA 3WFEH 1OE1A 2ZNXA 3FB5B 3HG4A 4M7JL 5KYYA 1WISA 2VLKD 3MRRA 4LSTH 5TE4H 4JY6B 5F6HI 1XH3A 2XPGA 4MS8C 3ETSA 2R0WH 4N0RA 4ONFL 1I9JL 2MCPL 5GRUL 2NYYC 3CZNA 2EIZA 2HUEA 6FABH 2HTKD 4NHCH 3WY1A 1MREL 5FK9B 5IEKB 1RAMA 1XMWA 2PCPA 2P1YA 4HSAC 2CKBA 3CQFA 2EDTA 1GH7A 2WYTA 4Q6KA 2KYIA 2BVPA 2HJFA 2EVIA 5CJ8A 1OAZL 3O3DA 2O5ZL 2FT7A 5IHWA 1IEAB 3BKML 3GRGA 3LKSA 3QO1A 5F7HA 5E2WL 2P5EB 4I1RA 4NSKA 4JM2A 5DHYB 4LQ1A 4UINL 1IC4L 1R5IA 2DQ6A 3C6LA 4XNXL 5AFAA 2QSCL 4IRSD 4TQEL 2YD8A 5EN3A 3OKYA 4DP5X 1N5AB 5EC1B 5KUMA 3L1OL 3PS6A 3GXDA 5TD4A 1IM3D 1A4JA 5DRWB 2BY1A 1N0XL 1TIUA 3ZYJA 5F7LB 3C8KB 1D5XB 4JREB 1MVYA 4NZUL 1XGPB 4XNUL 5MEOB 5C2UB 3ARFC 3UC2A 1OKEA 4M8QB 5ALBH 5L6YH 4HWBH 2PW1A 2W38A 2WW8A 2P24A 3MLUH 1ACYH 2XPYA 3CUPB 3IDGA 1LE9A 2WXIA 4UBDC 3OF6D 2WUCL 1NINA 2A2QT 4RGNC 5LXGH 3ESUF 4UV7H 2CJ3A 3AGWA 3ILDA 3VD3A 2CRMA 5DFVC 4I1PA 2BOCB 2DKDA 1D5ZB 4WW2B 4HD5A 4C56D 1CZ8H 1EPFA 4QRTA 1JXKA 5CR1A 3AG4B 3BE1L 3OD3A 2GSIB 1VADA 4O02L 2UVEA 2IVFC 2W91A 1HOEA 2Y8LA 4BIKA 1LWJA 2NX5E 2GJZB 3RDTA 4IRJD 3EBAA 1ZIAA 1YNTB 5B3JF 3LRSA 1Z5YD 4M62L 2PO6C 2V9QA 4F33B 1TTGA 3LIZA 3ZTNL 4NN7C 3R0MA 3FUMA 1A8ZA 4QJ3B 4ODBD 3JV6A 3NDYE 3QUGA 3D0VB 3QDGB 3SDAD 1A66A 2BFVH 5DVNA 3SKNA 1WFTA 3O41B 1UD2A 4MCMA 3LNIA 1QFWH 1RZIA 2WSPA 4KUCF 4IW4C 3T3PB 3S88L 1J1XH 3WEBA 1BBDL 1I1AC 1NOAA 1QTPA 2CQVA 4F80A 3PDOA 5ID1A 4JY5L 5CMAA 5E6ID 3PP3H 1TITA 1UT1A 2HFGL 3Q3GB 1LO4L 2JK5B 5E2VL 4BK5A 4I9XA 1K8IB 4BZ1L 3AY4A 3SKOB 5CP7B 3FO1B 2W88A 3L4CA 1SY6A 1AJ7L 1ZE3H 1DJGA 4CSTA 2E7LA 2Y8QA 3D85D 1XCQA 1CL7H 1KCWA 2CO6B 4C54A 1A7PH 3UGEA 5FM8A 4HKBB 4Y2DB 1T80A 1F86A 1MPAH 1C08B 3VX0A 2NY0D 1JWUA 2XVLA 2C4XA 2KLSA 5GPRA 1ZHKA 2ZOOA 4GXUM 2ICES 4NCC2 3B34A 4OLZH 3S7GA 4CMMB 3FF7A 1OF0A 5F1NA 1RIHL 4MMXA 4TVSa 5DJXA 2A6DB 5E6IA 4KUCD 4FLOA 4OFYA 5FO8B 5HJ3A 1PNDA 4JVPA 1C5DA 1QD0A 5KW9L 3RUGB 1SYVA 5J12C 1M1XB 5HGHA 1I9RH 4LBAA 5T1DL 3L2MA 4OT1H 3GTVA 4X2UA 5E2TH 4XCNA 3JWOL 2ZOTA 1T22B 2XFGB 1CDHA 3WFDL 3LN4A 4PJDE 4YL9A 3QEUA 3BN9C 1FFQA 1E9OA 3HUJE 1HH6B 3RVTC 1XD1A 5E6SB 3WIAA 1M7DB 2FATL 3MTXA 2D03L 5L8JB 1YNTA 2D0HA 5AZEH 1CLZL 3EJYD 2EUZA 2VRKA 4L8DA 4GB9A 5MEND 4RAUB 1U8OB 1JPFA 5K39B 2FYYB 1BLNA 4NC0B 3D12B 4QRPA 1P2CB 3NGBC 1LE5A 5JR1H 4PJ8D 4FTVB 4NGHL 1U91B 3TZVD 3OB0H 4WHTA 4Z3IA 3IDJB 4JUSA 4JQVA 3X3FH 4FI6A 1QLEB 5DJ2B 3U4BH 5KJ7E 4GXVL 3FQRA 5EF3A 2OR9L 1WEJH 3PIQB 3VN5A 2FSEA 3HR6A 1VSCA 3MODH 1T2XA 3WTVA 1IC5L 2DIAA 3Q44A 4X7CC 1X9LA 2YGOA 5IMMA 3M6DA 3FU7B 2V7NA 3L1EA 4RFEB 1XXFC 2YD7A 2H6PB 5CJXC 4IGBC 4KKRA 5F7UA 2CIKA 4PRBB 2BERA 5E6RB 1FFNA 1X5KA 3HG2A 5EUKB 1EBPA 1MCDA 3O9WD 3TCLA 4EPSA 1A4KA 3ESVF 5I75C 3GSQB 4GQRA 2ZNWA 1RSFA 1EZSA 2QTEA 1TTFA 1JJUA 1DTUA 5BJTB 5AL8A 1BAWA 3DXAE 4HS3A 3BP7B 3RWGA 2A6KB 3IYLW 4J7RA 5IY5B 4KQ0A 4KFZC 1BD2B 4EDXA 2BP8A 4X6EA 4Y2DD 1A22B 1BD2D 1WA1X 4PHXA 5DJ0A 3HG1A 4BZ1H 1QBLL 5HHQA 3EO0B 3GBNL 3HNSH 3LQAH 1MCSA 4FQ2H 3EYVA 4OZHA 5CWSB 3QH3A 1FLRL 3FMGH 4OCNC 5J13B 2OMUA 2FUVA 2O61B 5EIIB 5EU6A 1YMMA 4M5TA 1MNNA 3I3BA 3ASNB 4G3YL 4GO9A 5DWPA 5FAAA 5AW7B 3VG9B 5CKGA 4DP0X 3DI2B 2PCPB 1TYEB 1YHPA 3TPKA 5JW5A 3K5SA 5JIKA 3ZOAA 1XIWB 4X99B 3CBRA 2G5RA 3SYOA 4N2CA 1KPRA 2VN6A 4P99A 3MJ6A 3WENA 4L29B 3GJFA 1G4RA 5IMKB 3GI9H 4G82A 1DUZB 5KOMC 1L9SA 2MNWA 3VYNA 1EO8H 1NMBH 2GBUA 3GSNB 3OPZL 4IK7A 2RB8A 4NAJA 1N12A 4FYTA 3DYPA 3APDA 3IDIB 3SKJL 1O6SB 4W9ZA 3PP4L 2BHFA 1IJNA 4YLBA 4HV8A 4LRIA 2P80A 3E6FA 3FT4A 4LSRH 4ZAKC 5F44A 1XB3A 1AZBA 1ND0A 1T5XA 2VQ1B 1FZMB 3DX6B 5JIMA 1DEEA 1MCJA 5SWZD 4OFQA 5JHDE 4YXKL 1AZCA 1KCLA 4MA1C 4JHWL 4ALAH 3ZHDA 1GTNA 3PYCA 3PCYA 5D1XD 3X1GA 5EIIG 2XBDA 5EC2B 2BW4A 3EOBA 3LXCA 1P5UC 4X0KB 2AK4A 2FYVA 1AQDB 5KWYC 2IDCA 2NY1C 3NA9H 2YD2A 3NFNA 1TXKA 3VXSB 5D7IB 2WXOA 3FDWA 2K45A 3AC0A 2VRQA 4BH7A 4Y9BA 4OZ4B 3ERXA 3GMQA 3AT8A 2XG5B 4W9EC 3T6XA 1FZOA 4HIHB 5I0YA 1KCRL 1C7SA 1TZHA 3HS0A 5DMIL 1CDUA 1WS7A 4FG6D 2Y2TA 1L5GA 2GJJA 1IGMH 1P69B 2SEBB 3DETC 5D9SB 5I1LA 4Y4HA 3KGSA 4JFDA 2X4RA 5LWYH 1HYSC 1FCGA 1UM4L 3GSUB 3VWKD 3BFWA 2OOYA 3M86A 4U6XB 1U3HA 3LKOA 1OANA 2DS4A 4RMVA 1K2YX 2VLJA 3JWDH 1GKEA 1VFMA 4N90E 4POZD 4MCZA 5JHLH 4LCWA 1T1XA 4MXVE 3RAJL 5D7LE 4M48L 1CURA 1ZLVK 3WFBH 3CFIC 1NM4A 2WN3A 3IMWA 1KULA 2F08A 2Y4SA 1Y1UA 4E41A 4E9XA 5D2LE 1INQA 4GG6A 2R59A 3SYCA 4FNPA 1CO1A 1QSEA 5DJAB 5FO9B 2OL3A 2WWOA 4PJGF 1UZ6F 3KDMB 3QHFL 3KGUA 2LT9A 1V3KA 5C0BD 4NO3A 5JW5B 4JKPL 1PCMX 3RL2A 4TQHA 3L4TA 2D7NA 5IW1A 1FO0B 3JBG7 4MAUL 3W5MA 1TCRB 3OMAB 5GRUH 4PP2A 3RJOA 1JZIA 4WSKA 1YCSA 4U0QB 1G6RL 3RVUD 3NAAH 4ZW6A 3GMLB 3MV9D 1D5BB 3TO4D 1R3KA 1T6AA 4NHCL 2A0LD 2B7DT 2W95A 4FYSA 4Y4FB 4WUUB 5FUOH 3S0PA 1WHPA 2HG0A 3O6LH 1TETH 4Y19D 5D1QA 3VCLB 1JHKL 3FJTA 3EJRA 3V0HA 1KIQB 1XV8A 4QHKI 4N8CL 2XIBA 2HH0L 5K69A 4XI5C 2C1PA 3LKQB 5J6SA 1A6ZB 3SDDB 1MRCL 2YPVH 2E9WA 1IGYA 4PJ8C 5TF1H 3OR6B 2NTFA 4R4FH 1JDYA 2CLZA 1J5IA 4X6DF 4B97A 4K23L 2GYSA 3O6KL 1DANT 1UXSB 3QI9A 4NQVA 3OKKA 4XMWA 5GRVK 4AJWA 4NKDA 4CU8A 2R83A 4JRYD 3LS5L 3V6ZB 4FRWA 5TK2A 3VACA 4JRYB 3F6IA 5DR5L 1M3HA 1U4EA 3BUDA 4FFYA 3RPIA 1HHGA 3WV0A 5I9QC 3QJZA 1A1OB 4Y16A 4LFHG 2P5WB 3K5RA 1AKJB 1YJDH 1U3JA 1EEYA 3KPMA 3I02A 1TQSA 4BZ1A 1SJHB 1EFQA 2ZIDA 4KV5F 4ZO9A 5B3JE 3BQUC 4G6ML 4JLRB 4E41D 4JFFA 4CW1B 2ATKA 1JVOA 4IU2A 1FL5B 1K6QH 5GRWA 5A2KH 4BHUI 1BXXA 1CYXA 4DKFL 1R17A 2QELA 4KHTL 2AJVL 3PREA 1TZGL 1PJ9A 1U2CA 2DLFL 3Q2CA 4N0FA 2X7LA 4CDHA 2CUAA 1EGJH 2LQRA 2YAOA 4YX2H 1AGDB 3LD8C 1TJHH 3US0A 1H15B 3TV3L 2IPKB 2BW5A 1PCZA 3BWZA 2EDLA 4NNXA 3GPEA 2EKJA 4XNZB 1F3DJ 5ABZA 5IR1B 3FCTA 3MCG1 1GS8A 3MZGB 1WWBX 3FH7A 1WIPA 4LSVH 4BQCA 1UT2A 1HNYA 2N1TE 5T5FL 1JN6B 4B50A 2EHBD 2AGJH 3MRNA 4ETQA 1Z9MA 2F6AA 3L4ZA 4HKXA 4Q2ZB 3QFJD 5FYKD 2DM3A 5SX4I 3RL2B 3SGKC 3HFMH 4BINA 3MNDA 2HL9A 1KPVA 3L2NA 3VFRA 3S36L 3VFOB 2DQUL 1FFPB 4APQC 3UPRB 2HJLA 3CDYA 4EZLA 5I73B 3IGLA 3G5ZB 4NUPA 3SB3A 3NJIA 1U93A 1SFDA 4GIOA 5J6GA 1Q9WA 2V7HB 4QRQA 4U1HA 4WGWB 3TYGH 2ENJA 4ZX4A 4JM2F 3WTWA 1NANI 1QA9B 4O2FB 3R19A 1WYJA 2UWEA 3HI5L 3DGGA 4XPHL 4ORGB 1LO2H 2UXVA 3QFJE 4LHJB 5JPMC 4Q9RL 1XDTT 4HIEA 1E0OB 4PGBB 4UZSA 3X13B 1KWGA 3WJMA 3FOMA 1TLMA 3M7OA 2XN2A 4PR5B 3DROB 2LAAA 3LDBB 5JNYB 3DO4A 4LQFH 1WCQA 2FD6L 4KDWA 4WTWA 2A9NH 3QIUC 1JNLL 2WYZA 3TN0D 1KYAA 3W9EB 2FO4A 4Z78B 1BM3H 4Y19B 5CEXB 2VZ1A 3FB8B 4O58H 4OI7A 4G5ZL 4YH6A 2PXYC 5HDQH 3UTTB 1IT9H 3P0VL 4B9KC 4WK4B 3MKKA 1ZEAH 5BVJB 4KXDA 3WKML 3MLZL 4WF7A 2ZUUA 1A5FL 3CHPA 3FUFA 3P3YA 4CNIA 4P4RB 2PR4L 1L9RA 2FRGP 3TN0A 4TQEH 4FI8A 1J8HD 4IU3A 1FVEB 5B7EA 5IT2L 2JB6A 1Q9LB 3C5ZB 3WO4B 5HHMB 4UQ2A 3ZE0B 2DL9A 3HG3A 2GY5A 2C9XA 2DMCA 3L1FA 5E8EB 2PPFA 2EE6A 4YS4A 5IQ7L 1ZLWH 1T7VA 1KGXA 1KZQA 2X12A 2YPLD 3QDJB 1JHKH 5D4QA 3TNMB 3RPJA 1VEOA 4Y16C 3H8NA 2R23B 3QARA 1GZQB 1A3LH 1VAHA 1QW8A 2OW7A 4KUZL 3VH8A 2VN4A 1VTOA 4JDZB 4DF9A 2V3DA 4TLKA 2BOLA 3PGDA 3CFCL 1R3LB 2M2DA 3V5KB 1KPRB 2VXQH 5EO9B 3DDGA 4MB5A 4RWYH 4ZXBC 5I8KL 2XQYG 2AJXH 1OPOA 1N18A 1HKFA 1VHPA 2WBJA 3SN6N 2YA0A 1F3RB 1PAMA 3PY9A 1HILB 4J12A 4LASL 5T3XH 5C09D 3W81A 3LIZH 2OMZA 5IFJA 3ATFA 5AL0A 2ZFDB 3NCWA 2R69H 2EC9U 4KY2A 1A7RH 1LEKB 4NC2B 2FX7L 3SE8H 3MZTA 1BVLA 5EU7C 1IFHL 4WDIB 1SHMA 3F2LA 5IQNA 3L3GA 4ISVA 2EIJB 1D9KB 3QDHA 2CDFA 4QT5B 1YECL 2Z7WA 3EOTH 3DUUA 2VDMH 2KQMA 2EILB 5HSFA 1QRND 1U42A 3WKMH 1RVFH 2K7QA 5CR8A 2VSMB 4URTB 4HAFA 2MOQA 3HUJF 5JIHA 2KZKA 1GCFA 5IUSA 1KFAL 2E56A 2VMCA 3F12B 4NKMB 5C0NC 1RCYA 2GQHA 2VW4A 3I9GH 3LB6D 5FHBL 1AACA 1R3IL 3OKOB 2BY0A 3S2AA 2Y6SD 3W0WD 4E9VA 4XP5H 3LZLA 4PM1A 1B3IA 3P40A 4F3FB 4KHXH 1K85A 1NPNA 3RIFF 3TN0B 1MCHA 5D55A 4PB0H 1DBML 1BVZA 5LG6A 2ATAA 4A55A 2H2PD 5JHDA 1GS6X 4E42A 4FXGB 4P2QE 5L2KA 3N40P 4OM1H 3MRQA 4Q8BA 4R84A 3RWHA 5EU7E 2J6EA 1Z5HA 1URZA 2OCFD 3D39D 2FR4A 3LEVL 1NH2A 3MLXL 3U6XA 3QXUA 5HI5D 1T1YA 3IKCB 3X3GL 4WO0A 1M42A 1K4CB 2YO3A 2VXQA 2V9UA 3MU3A 5DC9B 1OO2A 1P4BH 2DMGA 3CK0H 3NIDE 4KI5D 1ET5A 2BDNL 4MBRA 5CP3A 5E8PB 3MXWL 1F8TH 3LEVH 2G4EA 2IO5A 2AFNA 2FEEI 3ZT7A 5EU4B 4L5FH 4LBEB 4S0HA 2MQCA 2BNQE 3P9MA 4WO4A 4ZS7H 1A6AA 1JPGA 3MXWH 3HA0A 3KLHC 3PQYD 1PIFA 4GBXD 2OX5A 1JMZA 4XP9H 2Z7UA 2A73B 4JO2H 3TO2A 1A02N 3QWRD 3TXAA 3EH1A 4AW7A 4JEGB 2R27A 2EDJA 3T0VA 4HJGB 4AVIA 4X5XB 5CD3A 2WSKA 4K7PY 3I0WA 4Y5YB 4JZNB 1BW8A 4HIPA 2WB7A 4I18C 4KQ4L 3QYNA 2CRIA 3KYKL 3NP4A 4IKKA 4M6MH 4PP1C 4XCFH 5CCKL 1UURA 4BFKA 5KYNA 3FB6A 2IAMA 3JTBA 3PAYA 1I3VA 3Q6GH 4U4BA 2B1AL 1YEEL 2EDEA 1HOCB 1SLXA 2EKSB 1CDCA 3BHBB 3DX9A 4AKQA 1OCWH 1QNAA 2EH7L 2CCLA 2AK4D 3A67H 1F5WA 2AITA 2L4OA 5LO7A 5LCVA 3R18A 1I3RA 1MCQA 1P84J 4HJ0C 3L3DB 2YQGA 4HZLA 4PJHA 4AUJA 1KEGL 3ENCA 5DJ2A 1AE6H 4JN2B 2V2WA 4AE0A 1X9UA 1FIGH 3AQZA 1ODUA 2DQEL 2WPGA 4XMKH 3GMOB 4P5TB 1C5BH 3TF4A 2EDRA 4K7PL 5IW6B 2NOZA 1HCZA 1AGDA 4WW2C 1ZY9A 1MVUB 2Z3FA 4GP8B 3WOVA 4NQSB 2H1PH 1P5GX 3K2MC 3HIZA 4Y5VC 3MO1A 1JPEA 4XGZA 1UOLA 4G43B 4N0YH 1CJYA 1RI8A 5CCJA 2OPCA 1NGQH 4PTTA 5IQ9A 3JV6B 5FCUL 3SY0A 1QUNB 1IGCH 4R3SB 4WRLA 2NR6C 1FSKC 1EV2E 1UEYA 5CZXD 5BRZD 1L3WA 1MCCA 2Q20A 4DP7X 1QQDA 3CZFB 4YDIH 2EICA 1W72H 4HCGA 3ZE2B 2DLTA 4NI3A 2JSFA 4WJ5A 1JWMA 5I5RA 1BAGA 4OCMC 3CIQA 4MQ7A 1E4WL 1PU0A 3RZCA 4JDTL 3I75B 1E8WA 3QBTB 5DC4B 2Q1EA 3SDAA 3V9CA 4FQLL 4CVUA 2JFCA 3V0IA 1MKFA 2V0AA 3T8VA 3KEDA 1TEFA 1ZV9A 4NNYA 5E7FA 4BK8A 4MA8L 1S7WB 3E8UL 5F7BA 2WK2A 3OLDA 3NA9L 1R1CA 1L4IA 3C6LD 1S7TA 3NBNA 35C8L 1ANUA 1LWRA 2NY5H 2Q5BA 3CDGB 5HDLA 5JA9A 1NICA 3LCYA 3LSOA 3VFNA 3RWEB 4LVOB 3T0BA 3VVVA 4L3CA 4MA1B 1U8KB 3GSOB 3PL6D 1WICA 4OSUL 4C47A 3L45A 5C0EB 4F93B 4QYAA 5C97A 3ULUL 3FUIA 3I3WA 4G8GB 2HLFC 3BFQG 3KPSE 4M7LT 3LV3A 4BFJA 3I84A 4R96A 2NQDA 4QNPE 5CFAA 1MAKA 2ZUXA 3POHA 4G8GD 3FFCD 4EAJA 1U41A 5C08E 4ZOEA 3SO3C 2WVVB 4WW1B 5ELIA 2D0BA 2Z93A 3QZPA 3WTXA 4NQCE 3TIDB 2VM4A 2E4TA 3VGHA 5I76B 1XF3B 1T89C 5TH2B 5BUGA 1YTFA 5CZVH 2PP9A 3G6JB 2AMGA 1N6VA 3PHAA 1MJJB 4PMFA 2IBGA 2MOVA 1AZNA 2AEPH 5F9DC 5HDBB 3VI3F 1Q1JH 1SOKA 4RGOL 2CALA 3OSKA 3QISA 1KXVA 4TF4A 3B56A 2YRBA 2DD8L 4XOCA 3GS4A 2VLME 4HJIA 1D7FA 1FGNL 2OYPA 2DJ4A 3TA3C 3IT8D 3IGAA 3O9WB 3QHZH 5AOKA 1I1RA 5DGQA 4GUOA 1IBGH 4MDJB 1HCVA 5JYLA 2IXQA 4RA0C 1PZ5B 1ZAGA 2L7EA 4F27A 4HQQH 3L3OC 3VXPB 1DQIA 5ACZB 1NBYB 3D2TA 5T3XD 1QKZL 2J2ZA 3KM1A 3MACL 3P11H 4PLJC 3U2SB 3HZVA 2AGJL 2A74B 2J57A 3PWLB 2XWTB 1IJ9A 3GPSA 2BNQA 4JDVA 4YGVA 2NXZD 2FJFB 3UO1L 3MLWL 4IJ3B 1BD2E 1YUHA 2AV7B 4D0CB 4JO1L 2CU9A 3V0VA 3WEXB 4A2FA 5KOVC 4LCYA 1A6TA 5EUOF 5FO7B 5DHXB 2YPLE 5FYJD 2XWBB 3QUMB 4CA4A 3SDDC 5L8LB 3OAYH 5EBLA 3WNOA 3VD7A 1QN5A 3KYMA 3O6FD 1TO5A 5FA3B 4I5BA 4AC4A 1F6AB 4Z7AA 1YPZE 2YPVA 4WZSD 2QR1A 5IFHL 1XGYL 1E8XA 3A23A 3WTUA 1BM3L 3C5XA 3CFUA 1D7BA 1MH5A 1CLYL 1NC4A 5FUOL 4WW1A 4IMKA 3VGBA 1P7BA 3N41B 4LCWE 1IFHH 4NAMA 4U7SA 3VD1A 2EVJA 4ORZC 4LPUA 1H3UA 1W6WA 5DSCA 3P69A 5MEQA 3CZJA 1JZ8A 1G5GA 3V4UH 3CVTA 4R4FL 1JZ3A 2EH8L 3NJXA 4ZMNA 5C3LD 4F8OA 4WFHE 6TAAA 4M03A 5JW3H 3QEQE 3IMUA 2BNRB 1TQCC 4S11A 3VG0L 1WBXA 4UM8A 4L3AA 3HR5B 4UDUA 2K78A 3NZHH 1E5BA 2NZ9C 4RDQF 3T0WA 2FKMX 1J12A 1UL7A 1FP5A 1Z66A 3FT2B 3LD8B 2E75C 2YMXH 4L4VA 4LIQH 1P6AB 2F54B 2WTOA 3A22A 3U46B 3VI4A 4UDTB 3TC9A 1YNLL 4KJPC 3ZKMC 4B9JA 4WO4D 2X6BA 1OZUA 3QZMA 5T5NF 1HSBB 3OHMB 5BZWA 4ACPA 1PZ5A 5ACZA 4XXDB 1JPSL 4HUXB 4L9LB 1T83C 5JLZA 1PZ2A 5AG8A 4DZBB 4RZKA 3CPLB 3EJSA 3QHFH 2IC2A 2NY7H 3O2DA 4EIZC 3DARA 3HE7D 3EIFA 3PE9A 1FWXA 5D70H 2V9TA 1BQUA 4M7LL 3O0RL 3S8GB 3H3KA 1DVFA 1GYUA 5ETUA 1YUHB 2W1NA 3UIZA 4OGAD 2QHRL 5IBUB 4KI1A 4IK6A 3BAWA 1R75A 3MGOB 1GRWA 4O2CA 1KB9J 1LWWA 5E8NB 4YEEA 4XCNB 2YZ1A 2QADD 1TVBA 2F61A 3JV4A 3TWCL 2X4NA 5DMYA 3QQDB 3AS3A 1YQLA 1MIML 1U8JB 1B6UA 1HI6A 3STZA 3FQ4A 3UYRH 1AS7A 2NR6A 4Q2ZA 4ETQB 4P2OA 4DFHA 1HZHL 1U8NA 4Y0GA 3C2AH 4ZFOA 4CADB 2YN5A 3RDTD 2COQA 3GHEH 1NFIB 1A0QL 5K39A 2JI3A 3OR7A 4LXFA 1SOSA 3PP4H 4JQIA 1RFDH 2FYYA 1M6OA 4YDJB 3US9A 3WIHA 1A7OH 1X5HA 3SD2A 4ADIA 3UYRL 1NBZA 5EG6C 3OGCB 1GHFH 3NCYS 1NMBL 2ZX6A 5E5MA 3UBXB 4O2FA 3DGGB 2LU7A 1TU2B 5T1MB 2ZD0A 3S97C 3A5VA 5HDOA 1HQ4A 4L37A 3FOLB 4OF8A 2X88A 2ZUVA 3DJTA 1BGXL 1RUKH 1S46A 4N85A 2FSEB 4TN9A 1ET8A 2HKAA 1ZA3B 3D69A 4W9DC 5IVXB 2R56H 2RAMA 3X11B 4G43A 4BKLA 1THAA 4JY4A 3DV6A 5DMKA 2FJGB 3V5DA 1K5NB 3IM1A 5C0RL 3CNKA 3V0FA 1RJLB 4M8VA 1ED3A 4UUJA 1LMIA 1LP9E 2NY7L 2W0LA 4TNGA 2JKXA 1PCXA 2R29A 2C4FT 5CINH 2JPIA 1CIUA 2GT9B 2CIKB 4LSVL 4AQEB 1A6WH 1IC1A 3QJRB 4BK4A 1NCCH 3RWIA 1D5BA 3UX9B 4KKAC 5EUKA 4OFDA 4JFOB 1F3JA 3ASWA 4PJIE 3QRLA 3UACA 3Q2VA 1JNNL 4X98B 3RFZB 3QZBA 5ACMA 1I3GH 4KNQA 4XPBH 2G60H 1LWYA 1N6QH 1IGJA 2XACC 1L6ZA 2F7QA 1IAKA 3KPPB 4Q58C 1N6UA 4WXAA 3INUL 4P5KA 4JJHA 4ANVA 2VABA 3U6RB 2Q8AH 5HYFA 4WFGE 5IGXH 3JTSA 3KM2A 1EHKB 3UBXG 3E2HC 4KRPC 2XVBA 4GKZA 3QJFB 2NZ9D 5GJTL 4P57A 1FV1B 2O5XL 3GMPB 1BJ1H 4XWOD 1CFNB 2B16A 3K7UA 1XCTB 2NNCA 4UV7L 1DP0A 3QG6A 5GGSB 5C6WH 1BG9A 2AANA 2ESVD 2D0GA 2ZXAA 5EU6B 5EIIA 1SZNA 1ZJAA 3RPIB 5L4FA 3CW7A 4Q7DA 1IVLA 3VFMB 1UD5A 1HI6B 3CXFA 3NH7H 4KJQC 2KH2B 4FFYH 1UT4A 3OCIA 4XNYH 1MW0A 2BCKB 3P3UA 4YHLH 3DX4A 4WWPA 3CSYA 4K15A 2TSAA 5B3NA 1M2VA 4WWKD 5HI4C 4F57H 4G9FD 5B1AB 5C2BH 1BJMA 4OUUB 5LBGA 4JKMA 4LKCB 4F9PA 2QKIB 1VGEH 2R1YB 3F01A 1P5VA 4NQEB 3K4DA 4PW4A 4UQBA 3TONA 4G42B 3V0DA 2E9JA 3MBED 4TNWK 3HE6D 3KHQA 5EO0B 2WGXA 2YD3A 4GKSB 4GAGH 3U1SL 3O0RH 4HV8B 3TS8A 2YWZA 3LS4H 3E6FB 4UZGA 5JDSA 3T65A 4NRZA 4HXAL 1KLGA 1U58A 2BP5M 1MIEH 5KSUB 3QA3A 4M1CD 1FNHA 3G9VA 1U6AH 2I5YH 4BUGA 5AW2B 5FA4A 2ZOUA 2JLLA 2LABA 1OZTG 1GIGL 3O4LB 4BDVA 1D5MB 3P54A 5B1JC 1SHWA 3CLWA 4PGCA 5F96L 3ISYA 2J2ZB 3VRLE 4MDRA 3PWLA 3RE0A 3MLTB 2E7CA 5AVYB 2JWYA 4OLXH 4LKXA 2J72A 2OMTB 1WAAF 3HG1E 4R0LA 3DSNB 4KTDH 1CLOH 1RZPA 1C16A 4ZT1A 1S9WB 2HPTA 1K8IA 4NQCD 3NACL 2UVFA 3KJ4C 5DQDH 3DVGA 5I66A 3VTTA 3Q7JA 5I1LB 2AJYL 4HUKB 3HB3B 3PPSA 4JFDB 5FO7A 1IKFL 3UTZB 4KJPD 2NY0C 3ZKMD 4ROCB 3EFDH 4PS7A 2MSPA 1MY7A 2VUYA 1JGUL 1ASQA 1HDMA 4MJ6B 2YD9A 3MRRB 4DAGL 1Z2KA 3OWRA 1G9HA 3E9TA 4M6OL 1T0NB 2OAAA 1UB5A 5CFHA 5GS0D 2WIIA 2HMIC 3HMXL 2JE8A 4FQ1H 2W07A 4ONHB 5ENWB 2OJZH 1G9EA 4NI6A 2X3CA 1I9IL 2VQ4A 4R83A 2JJSC 3C60B 4JB9L 3NJJA 5I15H 3MNZA 2UYLB 3FQWA 3HBGA 3MJ9L 3WIHL 3N5AA 1XCWA 2X6MA 2BVPB 2HJFB 5D1XC 1JGEB 3K8MA 1RULL 4GQQA 1BF8A 2ICEC 3VXSE 3ZZQA 5C9JB 2HYMA 5E8DL 2LHAA 1GGCL 3S35H 3QDME 4WI5A 3HI5H 3GBLA 1AJ7H 1GOFA 1X4YA 1Z5LB 2CH8A 3FT0A 1FHGA 5DRNA 3T8XA 4MNGE 1ZGLA 3VXTB 1L9MA 1S5IH 3MUGB 2ALWA 2RGSA 3NESA 3NJLA 1VACB 2O5NA 3GI9L 5C6PB 1J8HE 2RMNA 5GGUA 3QA3B 1YQVH 4E5XA 3X1NA 1Z1WA 4Y5VB 5FA4B 3K4ZA 1VFUA 4G1MB 1KTBA 4Y4KB 3WI9A 4RWHA 4E68A 1Y18A 5I16B 3ZL2A 2VDNH 2ADYA 1CLCA 1ZE3C 3HHRB 4JFHD 4OZGB 4X9GA 2W0FA 2B0SH 3BUYB 3HS0B 4BXVA 2OJEA 2QVTA 1C47A 1YEIH 1ZVSA 1AMYA 5E9DB 5E2JA 5B1CA 5FKAA 5GZOC 1EAOA 1N3NA 4R4BA 2J21A 2WO2B 4MGXA 5AG9A 3WFHB 4MJIE 3JWOH 4QTIL 4RBPK 2KQNA 3BIAX 5H37A 4Q52A 3P73A 1FYHB 4JLRA 2K8MA 2XKSA 3IDXL 2MTPA 2PTTA 4AIZA 4UZUA 5AYTA 3NJHA 3VXMA 3W56A 4GIAA 3H56A 5FFGA 1RSYA 4JDEB 3VWJC 4XVSH 5EOCL 5HYJB 1MW2A 1TENA 4EUPA 2X4QB 3IS0X 1JL8A 2BHYA 4NRXB 5DRXA 2Z91A 5C0FA 2IQAB 1NBVL 4HU8A 43C9A 2JB5L 1P7KA 2BM3A 4TTDD 3BH9A 4UYPA 3T04D 2FQEA 1A25A 4IBYA 5KYUB 4O2EB 4JKNA 4A38A 4B96A 5AD0A 3ENOC 1DBJH 2QRDA 1KCUL 4AEHL 4LLUB 5I24A 3P4OB 4DEUA 2IH1A 3L7EA 4BHUA 3G5XB 3VFRB 1CMOA 1NFDF 3GQFA 4RGMB 5T1LD 1JTTA 4M4PA 4Z7NB 4N8CH 2R69L 4QHLA 3SO3B 4UT7H 3B2MA 4WEEA 5L7XH 3CN3A 4UNIA 2YA3A 2LU3A 3SGJC 1ILUA 2F58L 1ZSDA 4WJG3 1WFJA 5A2CA 1Z9LA 1UWEH 1U8QA 4AUYA 1J87A 5BQDA 4A7VA 5GS0C 2AABL 2CKBL 2I25N 3VRIA 2XETA 2F7OA 2VWEE 2P80D 3D3VE 3WLBB 3BRFA 5F9WC 4PRHD 2PW2B 3ESNA 1A1NB 3IKKA 1HZKA 4Y9CA 5T1KD 4UIMA 2WGNB 3E6HA 2GSGA 1DJXA 4XC3H 3K6DA 4L4VE 4MD5A 3I0XA 1CDBA 4HKBA 2UZPA 2BFGA 2J6EL 3PDGA 3W39B 1F00I 5AKVA 4OLYH 3UGXA 3WHXB 4KKAD 2BVEA 4N8VG 3T4AB 4DGVH 3G08A 3MBWA 2DQCH 5BOZG 4Z0BH 3VQMA 2WXMA 2Z4QB 1LYQA 4PIBA 5E08L 4UILL 1M71B 5E2TL 1NIDA 2GAZA 2R5XA 1BVNP 5I0XA 3M45A 5LXVA 2BWQA 1I31A 4QXGL 1V3MA 5FO8A 3NUKA 1BQLH 3HS9A 2OBGA 2OSYA 4RISH 4KK9C 1YEEH 2QMJA 3DX2A 4P57B 1W6LA 3SPIA 2FJHA 1NKGA 2WTRB 4F7EB 3BRGC 3DYMA 3NDZE 5BNXD 1DCEA 4RRPA 2P8PB 5DMJB 4WFEE 5IFHH 2ZG3A 4FX5A 2X53A 5IMLA 1ORSB 2NNRA 3J7HA 3HG5A 1E9OB 4MNHB 3BHBA 2OK0L 2FQGA 4BE6A 1MPAL 3OF6A 1TTAA 1S7QB 2RBLA 5H35A 3GB7A 3JXAA 4H8VA 4XP9L 1VZHA 5B39B 3R4RA 4X6CE 4ZFOL 1AC6A 3EDKA 3H3PH 5AW9B 5MHSE 2WXGA 5ID1B 2K8QA 5G4OA 4IL8A 5HI4D 1B0RB 1GMEA 4I0KA 4JX0A 1HAWA 4LSRL 5E4EC 1CI5A 1JRHI 3CHXA 1VB9A 5EFIB 1A3RH 4K7FB 1CICD 1NTDA 5EBWA 2OTWA 2R0ZL 4QHLB 1BOGB 2J71A 1UCBH 4IQHA 5J3HC 4KKQA 1QYGH 3MJ8B 2R2BB 1B88A 4POUB 3VXRD 3FQTA 2DTSA 4NHUA 2OL3B 3DHPA 1A1MB 2LTQC 2WC7A 2P42B 3N42F 4PSRA 3I6GB 3N1MC 4QT5A 1YUKB 4RMQA 1EANA 4Z0BL 5HHPA 1KLUA 1P84K 3APFA 4ZDHB 2DD8H 3E6HB 1EUVA 2H2SD 3H4FA 4IMLB 3SOBH 2G3MA 4MXQC 1MCWM 4MZIA 3QIWB 4PGDA 4MAYA 4DFIA 2NWVA 3VXRE 4NN7B 2CKBB 4JG1L 3RUGE 4XO8A 3WLWC 4KNSA 4H4NA 4XH2A 4A04A 3H0TB 1C16B 2YS4A 4M6NH 5B39G 3HC2A 4G9FE 3SEPA 5DJ6A 4AGQA 4N8PA 4TVUA 1S7RA 4Z7WA 3FO0H 2DQEH 2F58H 4AEFA 2J44A 3MLVH 4YUEH 3VXNB 1KXQE 1MCOH 1R5IB 2ED6A 2PWGA 1J9SA 3QQ3B 4U6HB 4X5WB 4IKIA 1O7SA 2WBJC 2WCGA 3QR1A 4P46A 3P3RA 4BZ2L 1XBRA 5IOKA 2P5PA 4N86A 5GS0H 1RP9A 4RMSA 3CFNA 4ODVH 5BS0E 1LGVA 3SDYH 4QEGA 3C8KA 4S1SH 4YSTA 3OMZA 1W0VB 2WAQA 3QDAA 3DRTA 2B1AH 3KL0A 2GHZA 4LPWA 5B21A 5DI8B 1S7VA 5F9JB 2H6UA 5AW6B 2B3RA 4ILDA 4OB5L 4X6DA 4Y2DC 5BZWB 4LVOC 3GIZL 3GB7B 5HGDA 3HZ3A 3I85A 1NGZB 1ERNA 3BN3B 4Z95L 5IUCA 5E1AA 1N5AA 3WO3B 1HJBC 1AOZA 4P05A 4RRPM 3NCYP 1NAMB 2KHAA 5KS9B 4H2AA 5FYLE 3CH1A 3EYFA 3RPBA 4UTAL 1EEUA 1B4JL 3DHUA 5I1GL 2BRQA 3X3FL 4G8GE 2EYSA 4FN0A 4X7TA 1T5KA 4AGPA 2J25A 4B9YA 4NGHH 4Y5YA 2XU9A 3RHWK 3TJEL 4GINA 2F7RA 3QIBC 3QNYA 3NZ8A 3ETTA 3FFCB 3NEXA 4D9QE 5M7QA 3PUUA 3F12A 5MENA 2QQKL 2WXLA 4HEPA 4TVPE 2G5BB 1KN2H 3P9LB 3UBFA 4P2OB 3C5JB 4FQJH 3QRGL 5FYLD 3BZFB 5HVWA 3KRMA 4JRFA 2DL2A 3IWUA 3BDBA 3GEWB 1U93B 2N7AA 4NFDA 3B2UC 5IT2H 3G7TA 4NJAH 1IQDA 2D31B 1DFBL 1FVDB 2E8ZA 1YO4A 4LHUB 3F65A 4LGRB 3L3KB 5F6HJ 2GFBA 4MYWB 4OLUL 4CVXB 3FO2B 2F7PA 2ZKMX 3FZUD 4HHGA 3W11C 1H3PH 1IX2A 4ES8A 3DROA 5EPMA 3QQNA 1ZWIB 3II1A 1RUPL 4ZYKB 3TA4D 4P5TA 1NDGA 4C8XA 3VM7A 4TNFA 3WEAA 4FFYL 3LVEA 4L3ED 1WA0X 3FU0A 3RVTD 1WP6A 2Y7QB 4S1QL 1N3AA 1U3YA 4NXKA 4TPSA 2VZOA 1ZXQA 2W94A 3LRLA 3KWUA 2I07B 4BSJA 3D39E 1INQB 3KXFB 5BVJA 2DWXA 5CIPB 4WEUD 1WBZA 2YXWA 1BVKB 4GRLA 4D0DB 4PRPD 2YR3A 4KI5E 1OP5K 1AY1H 2Q8AL 4I13B 3UJTL 1KOAA 4I3SH 4NN5C 2CR6A 3VFPA 3H7BA 2G60L 4Z0XA 2FX9L 5DZVA 5KJ4A 4IRJB 1IM9B 3NFSL 1AGCB 2OCJA 4J8RB 2XV2A 2PWEA 3DJRA 1MCPL 2R0KL 1EO8L 5EU3A 4X0NA 1QSZA 1FV1A 3GMPA 1CF8L 2OS7A 4OCWL 4TNVK 4UQCA 2XZZA 5I18L 2WBXA 2AJ3B 1ID5I 4LP8A 4KRNA 4I4WA 2NSXA 4YIQA 4OW6A 4ZQKB 1F4YL 2EO7A 4WZ9A 5HSHA 1NA8A 1BBJA 5EA0L 5AVZB 5IHBA 4N68A 2K3TA 3BSZH 4AEIH 2BVQA 2IDTA 1KYUA 1E3ZA 4I7ZC 2YUZA 2R56L 3MBXH 3MR9A 3QR2A 4JUTA 2D0CA 1AGEB 3W0WA 1OALA 1FN4B 3RUGA 1OK0A 4P49A 4XNBA 4GEIA 1ZT7A 4DK5A 1U8KA 4J4PD 1QR1B 4N9GB 4JN2A 2NY1D 4IEFB 3ZGIA 1LHZA 3HNSL 3LQAL 2EDHA 3PDDA 4FFWC 1KMGA 2QR0B 3ZRCC 2R1YA 1TJHL 4M7ZC 1XSZA 4BH8B 2NMSA 1QFUH 3NQIA 1JV5B 4Q6IA 4F37F 1GMIA 1CR9L 1SDYA 4HKZA 5ITFA 1MJ7L 4GG6B 4QDGA 4IRSB 1A5FH 2B3IA 2Y23A 4PRIB 2EUXA 2XZAL 5IHLB 5D7JD 5KSUA 2WM0A 5FV2A 5L4IA 3MVSA 1HC1A 2Y7MA 4YBQD 4MAZA 4HS8L 3LRHA 1M6UA 2BHUA 2OP4H 3F6LA 5D96C 5T3ZH 4IDJH 5PCYA 1FO0H 4R8WH 3FPYA 4OCLC 3OR7B 4PUBL 4BGDA 4W9CC 2ZXBA 1M6OB 1JK8A 4YDJA 1BMWA 3CXHJ 4XN9A 2Y69B 3GSNL 4YFDB 5CHNB 1QOKA 1P9MA 4WEMB 2BX5A 4UF7C 2V8LA 1PG7W 4XNMA 3GNMH 3W82A 1V55B 3L54A 5AZ2L 2BZDA 4WSJA 1Q0XL 4XX1G 4EAIA 4L37B 3EFDL 4CDGC 4HS3B 2NQCA 2BIQA 3ULVE 4U7KA 1KO9A 5DYOB 2ESVE 4PP1D 4BV1A 1CICC 1K4DB 1SN2A 1FNGA 2AXHA 4P2QB 2H3NA 5LKNA 1I1FA 1AHWB 3VTMA 3AFLA 4J1UA 2LE9A 4BYHA 2KS0A 4JRXA 1WWWX 2VDNL 1A4KB 4BM7A 1ZPUA 3ILPA 3NRFA 1EXGA 2ZKXA 5HVHC 3WKPA 2X2HA 3FO9A 1BYNA 2GITB 3K72B 1G6RA 4LP5A 4L2YA 1PZBA 5JYMA 3O8XA 3GSOA 3K8LA 5C0EA 3N1QC 4YL4A 2DM2A 1T04B 1NZRA 4NIYE 3Q9QA 4AJVA 2OX5B 2DMKA 1IC7H 2BIOA 2B08A 3FHQA 2PYED 3PJNA 4ZAKA 5DJ6B 4PG2C 4KJYA 2OSWA 1MCKA 3IAGC 2QRCA 3UTTD 3P77A 1JDAA 1PEZA 4JGJA 4DO6A 5B7MA 4M48H 3I6KA 3QDGE 3QXAB 2VB5A 3AG3B 1YYMH 3IETB 3WDJA 4AG4H 3MLSH 5DSCB 5MEQB 1IGTA 2I9LA 1XB6A 3GDBA 2YAEA 5ANME 4YXKH 5C2BL 1BMZA 1FC2D 1Q9KB 5KVEL 1A6UL 3QORD 3LHPH 4P06A 5IYCP 3G5WA 4AYDC 2YPLB 3QDJD 4PJHF 3SCMA 1HSAA 2WP3O 3VSUA 4X5QA 5T33L 3NCBB 2ITEA 3RBGA 4P04A 3VQ2C 2CJUH 3O4LE 5EOTA 3U2SA 4LL1A 4OD1H 3GZQA 3QQ4A 4EAKA 1NAMH 4XNMB 1NJ9B 1B0GB 2XWJA 2VR5A 2EDXA 2H4LX 3LPGA 8FABA 3LNDA 1KJVA 4HK0B 3U0WL 3A6CL 3CN0A 3CVBA 3BZ5A 3EXLA 1KB5B 1DEEB 4QRRB 3MLPA 5C0GB 4RDBA 1PGRB 1A6TB 3S5LA 1I7RA 2MQGA 4G8IB 4MD0B 2XTJE 4RGMC 4F9LA 1V10A 1MFNA 5FW7A 5JXAL 3G5VA 3MYJB 1TG8A 1HH9A 2EIKB 4QMEA 1XH3B 2AEOA 3QXVA 2VUOA 2J88H 4EUPH 1P4IL 3FFCE 1SRDA 4FLRA 3LRKA 3VG9C 2AQNA 1D9KD 1TGHA 2X41A 1TVBB 2HN7A 1MHHB 4RMWA 2F5BL 4UM9D 3ILEA 5EOQL 4UAOC 3UYPA 4Q9CA 4WTQA 5KYXB 4NQED 4ZO6A 5DC0A 2C9UA 4QRSB 1QN8A 1ZDSA 3IF1A 3IMRA 1JP5A 4N8VA 5F1OB 4BXSV 4HIIA 1NGWB 3RGBA 3I6LD 1QHOA 3K6FA 3EW3B 2AJVH 4UQ2B 3DPBA 3P2DA 2RJMA 4NM4H 2HSIA 4XODA 1VGKB 4L3FA 1FZKA 5CEZL 4B9FA 5F7MC 3RI5F 4YOKA 1X5JA 2WBKA 1KXHA 5JW3L 1T4KA 5LCVH 1AS6A 4J3OF 5INDA 2DI9A 3R06A 5DLMH 5F71A 2BK8A 3QP3A 1IGML 1U8HA 2E4FA 4JFQA 3WJLA 5EORL 3ULUH 3QDMB 1T0NA 1MAJA 4ZZFA 1LO0L 3EGSB 3FOLA 4LARH 3US1A 2XKUA 3ZYIA 2BHZA 3CMOH 1R3HB 2BSTB 1RFDL 2BY3A 4H26B 1A1NA 2ZYRA 2NZ1A 5L6YL 1J8HB 2FWLB 4RGND 2K9UA 3Q6FA 4QD2E 4S1DD 4FCAA 2WVVA 3MDJA 4AYFA 2VMDA 3BO8B 5ADOL 2H9GA 2Y06H 2WCSA 3H42H 4M3JA 2K7PA 4NUJA 1IAIL 4IBTA 3LAFA 1PF3A 4HFUL 3DO3A 3DX7B 1FFOA 4PREA 2H32H 3E3QE 3PHOB 3QORB 5DS2A 4NS0A 1CXLA 3AM8C 4CC1A 2RCSH 4Z7UF 3NJGA 2R2EB 3QNZA 2J8UE 5HXMA 1AG6A 1P53A 3ZE1E 5A6MA 3KYAA 1YEDB 3D4GA 4ES9A 5CJ5A 3QUZD 3RGHA 3HCVB 1M05A 1MFAH 2HT3D 3BH4A 3OJMB 2BZ7A 1I75A 3CUPA 1LO3H 3IDGB 3T2OA 2DH3A 3FT3A 4DPAX 4UTBA 1LE9B 1QN7A 4Y16D 1OP5H 2Z0BA 3NVQA 3WIFB 4U1JA 2OZNA 5A6LA 3FB6B 5GGSA 4S2SB 1MFAL 4Z7OB 5H94A 1D2PA 1UWXK 1IGIL 2W0PA 3OM3B 3ZL1A 4XVTH 4F7TA 2E9BA 5JZ7C 1KIPA 3U7AA 1JDCA 3P0YH 4PV1C 4XBPB 3RYMA 1JHLH 3U9PH 5GGRB 5D71L 3DIFA 2H1XA 1JCKA 3KDPB 4M3HA 2OW6A 5I6LA 2FWUA 4B95C 4D8PB 3ARDB 1GA2A 4XNDA 1M2VB 1NAML 3ZMRA 4Y4FC 4FA6A 5IBTL 3LRSB 2ZUWA 3R06B 2GCYA 1NUFA 5AVWB 4B0MB 3FUHA 3EYUL 1RZ7L 1QASA 3ZKXB 5CILH 3HNVL 1J0IA 4V2BA 1CL7L 2P28B 4N28A 1M3JA 2DLIA 4K8RC 4F8QA 4GFTB 3IU4H 4LDLB 4KRLB 2PP7A 3JTTB 4PJEB 4FA8A 2YGNA 1JVKA 4GW5B 2FSDA 1JYVA 3V6OC 4GEJA 4JHVA 1NC4D 4HJUA 4JHWH 1MH5B 4I3GA 4N2FA 2X4UA 2X40A 3L7EB 5EBMA 1LK2A 3NSYA 4IBZA 4EIGB 4KC3B 4P9MH 3G6DH 4PJBF 2HZMA 5KTEL 3ABZA 1NCGA 3KS0J 1GJUA 5GGQH 5JPMA 2W65A 3CFMA 3PV6A 3JWNE 3L8QA 3FQXB 3FO1A 5I1DA 2UZIL 2VQ1A 1T5XB 3AXHA 4NZDA 1D6VL 1UOKA 2GTWA 5HJ3B 2ZPKL 3ARBA 3PWPB 2Z6FA 4LRNH 1MHEB 2ESVB 2N56A 2VDQL 1U8QB 3BAIA 4FLSA 4XBEH 3OQRA 3SHSA 5IB3B 1HE7A 1YY8B 3NQKA 2QFPA 4MXVF 1T7YA 3ILPB 1A4JB 5DRWA 4F5CE 5KVDH 2VLRD 4WIQA 2V17H 2VLRB 3DURB 5DD1H 3TBWB 1RZGA 3WSQH 4LLVB 4QYOB 4AI7A 3H9SA 5C6TL 2PABA 4H88L 2IPUK 3L9BA 3ML8A 3I50L 1HHJB 1Q90A 2RHEA 3JQOB 2VE6A 3MOQA 1J5DA 5DTFA 1G7MB 1RP8A 4HG4J 1NL0L 3NN8A 3D3VD 4ODWB 2YOAA 3GSUA 4OGYL 2P7TA 4E0RB 2CO7A 1U8PA 4U6XA 1BFTA 3UP6A 5I1JL 4L8CA 4PLNC 2WLZA 1T2JA 4K9JA 3B2VL 3DVFA 3C6LC 5TE6H 1CBVH 1FJ1B 3LXAA 3WMPA 2BMKB 1VCBC 3BWUC 4M29A 3TZVB 2DEWX 2R29H 3M46A 4O51A 4YZWA 4JDZA 4XPTL 1L9QA 1BEXA 3VI4F 4YDKL 1U8JA 1WRFA 3MYZA 5DCCA 4K9EC 3VXME 3QUYB 4WEBH 2VIRA 2MTAA 2G3ZA 3FH8A 3S37X 2AC0A 1X9RA 4JFEE 1NCWH 5CU9A 4LOEA 1SNRA 3BZFA 5K33A 1Z3RA 1AFVL 4X4XB 2VDML 1JN6A 4FFZL 3SYQA 5I1EH 2DV6A 4UINH 1XO8A 4HUMB 3A3YB 3RVXC 1MJUH 5IK3A 1FCCA 1GY1A 1EHLH 4ODVL 2HRHA 3CMOL 4Q6IC 2FECL 3C2SA 3B8YA 3SDXF 1KB5A 1XH0A 4QRRA 3C09B 4PS8A 3FQXA 4RMUA 3HG1D 5I1DB 5AOIA 3DUUB 4GQPH 4PJFA 4NCDA 4OJFH 1UA6H 2FJFA 3FN0H 1JAEA 5JHDB 4NN5B 4QKXB 3F7YB 3RWCA 5LGYA 5L2KB 4B5ZA 1FL6B 1SDDA 1GOGA 3TA3D 2WLMA 4AM0A 4KX7A 2UY7A 4XTRC 4G83A 3GI8L 3W9EA 1INEL 2G0LA 1UKSA 1NGYB 4Y88A 1CK0L 4OJDH 5D1ZD 1NCTA 4M61B 3DTDA 4D9LH 5AN4A 2IANB 3IF1B 1ADQH 3AJ7A 4HETA 3TBYB 2VE6B 2W0KA 2VMFA 1JZ2A 1MN4A 1VFOA 1ES0A 4ZODA 3NN8B 3NTCH 4EQ2A 5EC1A 4OT1L 1F4WL 3P9MB 2VJ8A 1DQMH 1CGVA 2VN5A 4S0SD 1BV8A 1QYGL 4HX1A 5D7KE 3WNMA 1IB5A 2NW2A 5I23A 4N26A 4F58L 4RIRB 3PGCB 2ZQKA 3V95A 2YK1H 4XXWC 1H3XA 3HLAB 3FCTB 4OLVH 2OYKA 3HI1B 3GTTA 2PW1B 2IAMD 3VDCA 4FE9A 4L3EA 4PJBA 1RV6X 2VH5L 3OTTA 3GIZH 3D51A 2F8OA 3W2DH 3VSQA 4KZCA 4JHUA 1NOLA 4GRWE 4XPAL 2WWKO 1WITA 1KTLA 4EDWL 1O0VA 5IM7A 1BFVH 1QPKA 3QG7L 4U1KA 2EVFA 4TSBH 4G1EA 4RAUA 4XAWL 1ACXA 2AEIT 1JK9B 2WO4A 5EO9A 2BOCA 5I0DA 3P2BA 5GISH 1T4WA 2VZVA 4U1HB 1W91A 3W2DL 4HWEH 5I0WA 3SPVA 3OKMA 4AIEA 3EXJA 3HZMA 1AXSB 3B3BA 4DUVA 1ZVHA 4L1LA 2VN3A 5FGRA 1LO4H 3P0GB 5E0FA 1R5WA 3UG3A 4M4RB 3KL5A 1K3ZA 4NBXB 3GMMA 1MCOL 1JZJA 3DBXA 4NYLA 5HDWA 4FP8H 3FOMB 1SMDA 3GMRB 3DJ9A 5JNYA 1W15A 2UXGA 4JO2L 2PYFA 5LBSA 3K71B 2HT3C 4NRXA 5DJDB 1RPUA 3GGWA 1L7TL 5HHME 5LLIC 2ODIA 2EACA 3GMQB 2EIZB 4F5CA 3L9RB 3F05A 4YXHH 3SQOH 4Z5RB 1MQKH 2XZCH 5A16A 3BEWB 3ES6B 1U3ZA 4LEXH 25C8L 5GZND 1WBYA 2ZXQA 6CGTA 2F74A 3N50A 5C07B 3TA3B 1KIRA 4QHUA 1DUYB 4H20L 5BJTA 2Q7YA 2DN7A 3EJPA 2ZSVA 5JOPE 3IPEA 4NO0B 5C0BB 1J0KA 2VDKL 2MOGA 3BKQX 1S9YA 4G9DB 1CGSL 1BQHA 5AOMA 4RAVB 3L1GA 1TNMA 3F00A 2QADC 3BN9D 4XVUC 4NT6B 1AHMA 1QWHA 4IJ3C 5T1KB 5K93A 3QWRA 2XNAA 5BVPL 2ADIA 3TT1H 2VDRB 4GKNB 4CAGA 1JPST 2DQJL 4PWIA 4YQXH 1E2VA 1AXTL 4R3SA 5IVXA 3D4VA 2Z92A 4PJXE 4LSPL 2WKLA 1KJ3H 5D4IA 3S34L 3VVWA 3MA9L 2XQBH 4URKA 4FLHA 3QUYD 3I9GL 3CIAA 5KSBF 5EU5A 5C8JB 1F42A 5C0AA 5BS0A 2ZKHH 1F2XK 4LPCA 1NBQA 4GY4A 3U7YL 4G7YH 4NLHA 4EI5A 4F7CB 3SE3A 2QPSA 1UD6A 4G71B 3K91A 4IM8A 3ULSB 3KH4A 3H7BB 2XQBL 4Z0XB 4XO4A 4AVKA 1IM9A 2APBA 1NUGA 4RISL 4OD3H 1ZHLA 4MVBC 4G6KL 5BZZA 4DEPC 4YSSA 3MCKA 4X5LA 3V7MA 3WEMA 5AVSB 5TTRA 3D7PA 3H2PA 4YIQB 3AVEA 2GKIA 4NPKA 2WJ7A 5C0CA 1RIUH 1UWGH 3H9SD 2AK4E 1YEIL 3S35X 5EWIL 3GUTB 3CBJB 4A6YH 4PJAF 1Q9UA 3V8CA 3Q5TA 4GRLC 1XSKA 3DRQA 1E6JH 1ZVSB 5KBPA 1QVOA 5DEZA 3VFMA 4FKHA 1QR1A 4M93B 1T5WA 2ZKWA 2ATPB 5EEWA 3S4SB 2EYTB 4CMHB 1RLBA 5D1QC 4XVJL 4W1TA 5FLUA 1D5RA 1YEFH 2VDPH 1Q0YH 3FU7A 4EZKA 4X8GA 5L7XL 4Y1AA 3HAEA 4OM0H 4P2RA 2FR4B 4P2AA 4YHIB 2A74A 3B8SA 1RK1A 1IKOP 2BNQB 1E2ZA 1MLBB 5IMOB 2GTZB 5KG9A 5C0DB 4TSBL 3G5VB 3MYJA 5E00A 3SE9H 1T83A 1OVZA 1UJ3C 4M3KB 1PZCA 3MJWA 4GKNA 3UADA 3BH9B 1KYFA 3UJJL 1FE8H 2CBOA 2GT9A 3HNTL 5ADPL 2G2RB 5E4OA 3ILQC 2ZUQC 4YHOH 1YQKA 3MJ7A 3PAVA 2QVKA 2FK9A 4PV8B 2H5AX 4XAKE 1L0XA 3PDOB 3GIVB 2WTPA 1PIGA 2ITDA 3JVGA 4CKQA 1WHOA 2JF1A 3EJTA 2WNWA 3MFFB 4C59B 5DZ9A 2PLTA 2X0VA 5LAXB 3HRZA 2LLNA 1NSNH 1YEJL 1XAKA 5C08A 1S7RB 1CCZA 2X3AA 3K2UH 1I1AA 3FFDB 5CF3A 2CCWA 3FS9A 1M1XA 3N43B 1MJ8L 1C5CL 1ONQB 5DS1A 4YXHL 2KLTA 4C57C 4OZFA 3G5YB 3EH2A 1X4XA 3KWVA 4L8BB 3T2NH 3UTZA 1AQMA 3IN0A 4N0UE 3U9PL 3C5ZD 4TYUA 4MQTB 2AERT 4AITA 3WYRA 5F7WC 3MAWA 1G43A 4NKDB 3MRCB 1ETA1 2APWA 3FQYA 4Z7UA 5C0IB 4Z7VA 1GGUA 3EO9H 2XY1A 3HKFA 4AYEC 4OFIA 1CFVH 5HVHB 4AK2A 5ENWA 1CG9B 3ATAA 4G6FD 4FC3E 3KXFA 1DL7L 2MHAA 2OL3L 3D25B 4G2AA 1FPTL 1BX2A 1OQOA 2CPCA 4L4VB 4LNRA 3TPUB 2XXMB 2UZXA 5A1AA 1LM8V 3BAYA 4OZHE 3PWUB 2P5EA 5IQ7H 3V4PL 5ESQB 1VFAA 4C56B 2ENSA 4PLOB 4AGMA 1EGJL 1ZANH 2BLFA 3WFBL 3ZZSA 4NO5B 4M5YH 5IB2A 1OTSD 1EJ6A 1SY6H 4WQOA 5C7ZA 1E50A 2L8AA 1TZIA 4AQOA 1X7SA 3L9EA 2NNFA 1GGYA 4NOFA 2PF6A 4WHDA 1CFTA 1AR1D 2DWTA 4GBXC 4N0CC 2YEZB 3ZE2E 2F8XC 2A9MH 3EZJB 2H2SC 2GIXA 2F68X 2AMUA 4H8HA 4UDTA 4ZUSB 2ZTBA 4JFPA 1ET7A 5C0ND 3LPPA 3IJEA 3DGDA 4PW3A 2E47A 1N4XL 1X5AA 3C8HA 3QDGD 3RVVC 1LXMA 4ZQKA 4F8PA 2NY6C 4U1LA 5DR5H 3SODB 3PGFL 3MNVA 3GIVA 1WJ3A 3UCQA 3DJSA 4EOWH 2ITDB 5J3HD 4YQXL 4MDJA 3RIFK 1IC5H 2X2UA 3VXPA 4XBMA 1ZIBA 4HEME 1U3HB 4NM8L 3KLAA 1P5UA 3BD3A 1N64L 2H6PA 2NYKA 4S1RH 2GI7A 3VGFA 1HJCA 4QRTB 3SIKA 1BZ7B 3FCBA 3M17A 5H8DA 3RJQB 2EE0A 1EVUA 1IVTA 4U2ZA 5J1SC 5C0CE 1R19A 3CFBB 4RGNE 4UOW1 4LLDB 4W9HC 3TOPA 1GPOH 4FNTA 4UTCA 4W4NA 3QAQA 4BZ2A 2DBLL 3AS1A 1CD9B 3EYSH 5ITFB 1VRSA 1CLZH 4ABVA 2VOTA 1J5HA 4FQCL 4AOFA 5CNHA 4Y19A 5D1QD 2FX8H 2W60B 2Z31B 2GIMA 1OIOA 5EBLB 3VFGL 1I1CA 5FHAH 2XBZA 5E94A 2Z93B 3WNNA 1O7DC 3N1PC 1KNOA 3MV8D 2AJZB 5DUMH 4NO0A 1KSRA 4CNIB 2CR3A 3HHSB 4G9DA 3GSNA 3S37H 1FVEA 3CHSA 1OEZW 1ZA3A 2IALA 3D69B 3FRUB 4PJGB 3X11A 1S3KH 4BKLB 2FJGA 5IROA 4HGWB 4IIZA 1QSFE 4JFSA 4Z76B 3NRQA 5D7LD 4ZAKD 3SOTA 3ZE1B 1QHPA 4J3OC 4L1SA 4NQTA 4G80B 3IXAA 2BS9A 5DO8A 4P2QD 3OGOE 3DURA 3TBWA 5JPNB 1KZYA 3HVNA 4FJZA 3OQ3B 1FG2B 2ZZUT 5FFOA 2WZPD 3VNZA 4JFOA 3D0AA 2VR3A 1T7WA 3CMGA 3WGUB 1YEKH 4PN6A 1JZFA 1JI1A 5CEYB 1I8IA 3QUML 5CZRA 1J0ZA 3JUYA 3QUYC 2DQGH 4ICWA 1MUJB 4MMXB 2VH5H 5F0LB 3SDXE 3V52H 5I1JH 2NOEA 1X5YA 1TPXC 3GKWL 3N91A 1M3IA 4GS7C 5I1HL 5KYWB 4YMPA 1I3RB 2CIIA 3QUXD 1N68A 4PS4H 2YARA 4JPVH 2MCAA 1BFOA 1DLFH 4JREC 2QT6A 2FBRA 4HUWA 4MQXC 4Q6IB 5CJXA 3ARFB 3ULVH 3QZWG 2CGRL 4GAYA 1UD4A 3UL4A 5IYBP 4ODUA 1CBJA 2F53D 1CE6B 3IN2A 1I3UA 1N6QL 2CO2A 3TH3T 4KMQA 2GPZA 1G6RH 1QATA 1VPOH 3FN9A 1ADQL 3VH8G 2CM6A 5HHXH 2X1QA 4JFZH 3R8BB 5KSAA 4I0PB 3A6BH 1I7TA 3KPNA 3ZTEA 4Z7VE 2UXFA 1A14H 1J5OH 5GRJL 4BFOA 3STZB 5FOBB 1FN7A 1PZ3A 4GUQA 3W11D 3I3DA 3LPOA 5LQBL 3TEZA 1HL4A 4AQ1C 5F7NC 4OZIE 1IBHA 2ZCLL 2RCSL 1UFGA 2EO9A 4D8PA 4Y1AD 3P02A 4G6KH 3DXAB 3ARZA 3FN0L 3PIQA 5GZOD 1UA6L 4WUUA 2BJML 4F24A 5F0MB 4WJ5B 1LO3L 4QKTA 2OJ1A 1GYWA 3ME0B 3TO4B 3ATEA 4XNYL 1SVZA 3FT9A 2AXFB 4YE4H 1TCRA 3TH4T 4ZSOA 3B7RL 1ZA6A 3IKCA 3WXWH 3BYTA 2BVYA 4M6OH 1PY4A 5DUPH 5MI0C 1FG2A 2RACA 1SM3L 3KWTA 1KGUA 2QLVB 1B6DA 2PYEA 4GMTL 3BJ91 1PYWB 4IOSA 1AXTH 1QG3A 3MJGX 2P5WE 4QRRE 2ICWB 3TT1L 4D9RD 5B22A 3TWCH 2PKDA 1JSYA 5IJCC 1RIVL 2DJUA 2QQQA 1JCVA 2Q86B 1E7UA 1SM3H 3T0XA 4P46C 1ZMYA 2X4OB 2J4WL 2FCBA 1NMAL 5C1MB 4ABUA 2XHIA 3VFVA 2ZCKL 1KPUA 4PJ8A 5D8JL 1P4LB 5JO5B 2XG4B 3H7LA 4HIIB 2H32B 2LW3A 3BI9X 5MEOA 1QSFB 3U0PA 5I6KA 1FIEA 3OPZH 4LO9A 5F7EH 3T5WA 4LSDA 4N1CA 1FRGL 4DTGL 4AYSA 4JHZA 3T1FB 4OGXL 4K9EH 3HI1A 4NKOB 4JFXA 5LNEA 1DL7H 2OL3H 3B2XA 1FDLL 1JPSH 4AT6A 1AMXA 4MMYA 4JZJA 5IWLC 3KZ8A 4GAJH 4MAYC 5EN2A 3MROB 1SUHA 4MB1A 1LEIB 1VACA 3SCMB 1PPIA 4X99A 3KPSB 3QK0A 4IBWA 1CG9A 4A68A 3IDNA 4N5EC 3MHZA 3TWYA 4YHZH 1H9VA 2AJSH 1NIBA 1IKNC 3NABL 4FNQA 4X42A 5CP3H 5K1JA 5KVFE 1DVFD 2AQSA 1XHHA 4QWWD 3A6CH 4LL4A 3FMGL 2IDSA 2FUTA 2H9GB 1DYZA 4FQ2L 4M62H 5I74B 1EO5A 1BXUA 1RURH 1O6SA 1QTYT 2EH8H 1RJCA 4O02A 4LRNL 3HPJB 3EJYC 4C83B 3QFJB 4WY7H 1OY3B 2DDQL 4UNUA 2OQJA 4KXCA 3S5LG 3ZKSD 5B1BB 1FHNA 3BLBA 2DBJA 4XMLL 4PYGA 5KW9H 3C5SB 1R6VA 4DEWA 5FYKH 5TDPA 4K3JH 2WSDA 4KI5C 5CAYB 4ZUWA 4QGTA 2QADB 1OSEA 1YC7A 2W92A 2JJWA 3C87A 3GXTA 2HTLD 2VGLM 5AAMA 2W0FB 2DTML 2FH8A 3JV0A 3QNYB 5GJTH 3N0PB 3QUMA 1MFDL 4LSQH 5E9DA 1WD9A 1F1GA 5GGVL 4HPHA 2BIIA 2ADJB 3BYYA 4FULA 3TFKD 2GUOB 4LHUG 3SPJA 2QKSA 4PJCF 3ZDXF 5G2NA 1I4FA 2J56A 4JM0A 5FX3A 3DX1A 1NGWA 5F1NB 2NUTB 1Q94A 1REIA 3O3EA 4LVEA 5CWSA 1LDSA 3QQXA 3MGAA 4MQSB 1A7BA 2APXA 3RWHB 4P4RA 5DWUL 1V54B 5A7BA 1YLBB 3Q06A 1E6OH 3JZYA 2CMRH 1KELH 3VXNA 3NK3A 4P2CG 4WUUE 2EIBA 1QWNA 4GI6A 2ICEB 2CBMA 2ENYA 4X5WA 3KEHA 3C8DA 4TV3A 4MCZB 4MA7L 4YBLB 2XN9D 1G6RB 5AKSA 5J6HA 3P0YL 4FMKA 2RQEA 1OT4A 3F8UB 1EJFA 1W0VA 2CDGA 3S96B 1EA9C 1I8KB 4Q9QH 1YEGH 5IQMA 1A3ZA 4I3RL 4JGMA 1SHSA 4Y2OA 5I26A 2VLLB 4DW2H 2XFXB 2EUWA 1ZK5A 1KACB 2PCXA 2QGDA 4HALA 1T1ZB 4FABL 2EDBA 3LKPA 2HRPH 3P77B 4FG2A 1MCLA 2EUVA 4GRLB 3CC5B 2VDOL 4Y2NA 5J11B 4CN1A 4HPYH 4A1RA 1QR4A 3KYOA 1AGBB 2A1WL 2X09A 5HD8D 4W9IC 2BP0B 1NMAH 2G3NA 1OARL 4KI5F 3VRIB 5A2FA 2YQ2A 1WK0A 1T0MB 2PW2A 1DVFB 5I1IH 2C7UA 4AYBA 1CFSA 1YPZA 1AZUA 3EYQC 4P4KA 1UXWA 3CFQA 1LVEA 4N22A 2WBJB 1QNZH 2IGFL 1KB5L 1PD1A 4I89A 5JLZB 1U9KA 5CIPH 4GBXA 4AG4L 3GSXB 2WINA 3QQDA 2IG2L 2JCCF 4FQHB 3D4CA 2A5UA 3MLTA 4JR9L 1ITCA 2O6EA 3FTWA 4Z77A 2DQJH 4P9HL 2WNGA 3PWPE 1DHKA 3KPMB 3THMH 3LHAA 5D70L 4FEMA 5KYYB 1CGYA 3TBTA 1AZRA 2B1HL 4R5XA 1A6VL 3SGEH 3WNJA 1MVUA 3ZE0E 1F6LL 4YUEL 3O6ML 4IEFA 5C70A 1UM5H 3I2CL 4JKKA 3KL3A 3BLPX 4ZYKA 5IP4A 1J1XL 3RIAF 4L8CB 1NPJA 2QSTA 1YNLH 2FGWH 3VD0A 1G1KA 1R5VA 1WAAA 1ZLSH 1U0QA 1E3XA 3V4VB 1KGWA 2EEAA 5CLTA 1S7XB 4HUUA 5FF6A 3DA0A 1U8NB 2I7SA 3I9IA 4KVCH 4IRSA 5JQ6H 3RTLA 2OTUB 3BEWA 3DV6B 3O8XC 1KV3A 5IJVA 1J1PH 3N6YA 4Y19E 5E2UH 5D6CA 4J2XA 3MRPB 5CUSL 5K9JL 4XN7A 4YVNA 3C9NB 2VN7A 4K71B 3EDJA 2RD0A 1E4KA 1ZJBA 5AAMC 1MCIA 1BOYA 3VCLA 1T1ZA 1HYRC 5EHFA 4ERSL 4K7FA 2PNDA 5CSZB 1JFIC 3ARQA 1Y0LB 3VFPB 3RZCD 1E8YA 2DWSA 4Q74A 4DVBB 1QX1A 3W9DB 5HDRA 1S2EA 4TUJA 4AXWB 4EALA 5FGBC 2JKTM 2OTPA 2QPUA 3COOA 2AK1L 4WJKB 5A2LH 3RDJA 4E9LA 3EUDA 2Z4TA 2ZUYA 5BOPA 3LEYH 2KL6A 2MQ0A 4X7FC 3VW3H 1U8MB 1FZJA 1EZVX 3CLFL 2QQNL 3LKRA 4JFUA 5GGVH 2B2XL 4EJYA 5LN8A 1SLUA 4OVUA 1NUDA 1CU4H 3II2A 4B53A 3WE6B 1F3JB 1TTBA 1EEYB 5ALBL 5GQBA 4XX1E 3FYIB 4MYPA 1NC2B 3AU1A 3MNWB 4QXTB 5GS2D 3SJVA 3MRKA 4UQ3A 3OWEA 3H0TA 1GS7A 4ZFFB 3MPCA 4UB0L 2EDQA 3P4MB 4M61A 3MLWH 2QMKA 2XG5A 3ULVF 4JFEB 1XEDA 3CSPA 4IU3B 2Y0SA 4IKLA 4OCYH 5I8CB 1TZHB 3B9DA 2EAEA 2F53A 4N24A 3PAUA 1JFQL 4L0YA 3TVMB 1TJXA 2BZCA 4OUUA 3Q1SH 4LT7A 4HEPG 2C3VA 2EZ0C 3ZBMA 5E2WH 4X0KA 3WNLA 2FT8A 4BRVA 4BWWA 3VJ6B 3MCLH 3K2KA 1NCUA 4NKQB 2YIHA 1JV2A 3C08H 4XVTL 3PXLA 1Z9PA 2WWMC 3A4DA 1UXMA 2WUBH 4ZUSA 1G7QB 5FS5A 2P45B 4NZ8A 3TJEH 1IGTB 2I9LB 3L7FA 4ZMWA 1NGQL 1J9CT 3AWFA 2FO1A 5D9SA 2LTQB 4G8FA 1JD7A 2QEJA 3U0TB 5GS1B 3X1EA 1E4JA 4DKAA 3NZ8B 1GJIA 3MRDB 4UQEA 4XNAA 5E9DD 5AB1A 1TJIH 1UH3A 4DP8X 2P5WD 4U3SA 4K7PH 3LNHA 5CZXC 5B39A 5EULV 2PPAA 2AV7A 4LHQB 4D0CA 7FABL 4BFBD 4M93C 1C9SA 1FNEB 1IQDB 2D31A 3MRHB 3WHE1 3LVTA 4GYBA 5D1QB 2B1HH 2LV4A 2J5LB 3D85A 4ZMOA 4XCCH 4OB5H 4G6JH 2XWBA 1T1WB 1KB3A 4PH8A 3H42L 4G8IA 1S7SA 5F9OL 4KH9A 1YZZA 4K94L 3GSNH 2HMID 1QBBA 1NPUA 3MOAL 3R7RA 1DO5A 4ZI8A 1ASPA 1NGYA 3DHJA 4XCCL 5IROC 1RUPH 3V0AC 4NKMA 5HVGB 1Z3GL 4YE4L 1KLUB 3T09A 2K6ZA 4G5ZH 2GJ6D 2HRGA 1VDGA 4HMCA 3SKMA 4GW4A 2C3WA 2WXQA 4R26H 5AB2A 4ZAKB 2BSDA 2Y25A 2OM5A 2CO3A 1UCTA 1V05A 3BP7A 3RWGB 4UQAA 3BPLB 2VR4A 4JE0A 3LDBC 4LDOB 4LPXA 4UOJA 3TNMA 5D2LA 3U30C 1T03L 3IDXH 4MJ6A 4PV9B 1QFUL 2Z1PA 3TBCA 3TIDA 3RWJB 2WTRA 3VFTB 1XGUB 2AV1B 4ZFZA 3EDDA 5IHZB 3NPSB 2GJ6E 2OXGA 2C5DC 3CHQA 1R24A 3HBQA 4X9HA 5B4MC 1T6BX 1F41A 5I1KL 2VZSA 4M7KL 4DH2A 2B5IB 5AYUH 2HLAB 2AF2A 3RVWC 1J9RA 2P44B 4D0DA 2Y7SA 2YKLH 3S5ZA 1UACL 3PP3K 4PWEA 5CEZE 1NEZG 2MHAB 3CFCH 5CCHE 1SJEA 1QFWI 1N8ZA 2ITCB 3HOGA 3QCTH 3SPVB 3MN8A 1NCAH 3D48R 5CN3A 1ZPLA 4OJCA 4OGQC 3VXSD 5KBNC 2FL5B 5TDNB 3NIDB 1JRHL 3D05A 5CGYC 4ELKB 1BOGA 1FN4A 4JL2A 4PJAB 5BPPA 5A3ID 1MWAA 4YX2L 1C9BB 4AJYV 2NSQA 1NSNL 1YEJH 2NXZC 4YK4B 5T3XE 4MQXD 1KBGL 1GAFL 1HWGB 3B2PA 3UXFA 2X1PA 5CD5D 1KJMB 1N9PA 3GXFA 1DE4A 3L08A 1SEBA 2CJUL 1UA7A 2AZUA 1BCIA 2X2YA 4NO2B 3CX2A 4HH8A 2VSDA 2BVQB 4J3TA 3UYOD 4HH9A 4HWZA 5TDOB 5TPWL 3AG1B 2IF7A 2HJLB 5FECB 2VCOA 1DANU 1NBYA 3LEYL 3UZEC 2Y1VA 5C0CB 2G2NA 4NFCA 2WINB 4YZFF 3UO8B 4LOUD 4AV0A 3VXUE 3FB8A 1XR8B 2D0FA 2E7DA 2VJ0A 2Z31D 4K3JL 5AEAA 3C5JA 3BGMA 5FYKL 1JZEA 3BVUA 2KZBA 3QULB 4XC1L 5HHOE 3SQBB 1DQJB 5C09E 3A4FA 3DRQB 4LQFL 1JF1A 4ICXA 1L5GB 3MLYH 2VW6A 1D9KC 3HEIB 2WQXA 3QXDB 3WAKA 1QEWB 5TE6L 4WO4C 3ULVC 3DPDA 1G0XA 3ATDA 4R0LB 2IAND 4JJ5B 2IQ9L 8PAZA 1T1YB 2HL8A 4OZFH 1MF2H 1SXNA 4D0BB 4YHYC 4JO4H 3ZHNA 5E70A 1CK0H 2XQ0A 2VXSH 1B4TA 1QPPA 1MEXL 5DYOA 3G6JF 4ONGL 1BXAA 4ABWA 4JCWA 1GZQA 3ARPA 4AM0Q 4DN3L 1NCAL 1KTRL 1S78D 3CXDL 5T5NG 1DLHB 3ELAT 4P2YA 3DVIA 4EUPG 1YNTF 3BT2H 4JFVA 4U1GC 4IBVA 4HIQA 5DK0B 5DJZB 5F7DA 1PTZA 4JFYA 5KAQF 1LNUA 1RUQL 4WCYH 3ZTDC 1KF9B 2YQBA 3V6BR 1CXKA 5CD3B 1IL1B 4FJYA 4HX1B 4L9LA 3V7AE 3G08B 3MBWB 4RRPG 4RIRA 2JHJA 1MCNA 5ACLA 5EEVA 3EFOB 2I9TA 4TMPA 1KTJA 3HMXA 5INCA 5DUBA 1FH5H 2AABH 2OI9B 3DSFH 3LRGA 3RTQA 3GNML 5IROD 1FZJB 5FHBH 2PMZA 2Y6SC 2YPKA 1F13A 5TF0A 4G6MH 1LP9A 4HLZH 1ADWA 1DE4B 1DDHA 2IMNA 3D39B 3D2UD 3AU0A 3MOBL 4JVWA 2DY2A 3AXLA 4RX4A 1OM3H 5EUOB 1UT7A 2JKRM 1FZOB 4HIHA 4XRCB 1BEYL 4LP4A 2F7IA 1GSKA 2B59B 4OV5B 2SEBA 3BWAA 4G1MA 1J88A 2APFA 5I6NA 1BAFH 1LMKA 2QV4A 5H4YA 3BIBX 2DB8A 3BGMB 4MMZC 1R46A 2ZXWB 3OB0K 3I74A 3L3KA 4UMSA 4K94H 1A7RL 4XMUA 3DO7B 3CN2A 3NZSA 5IB1B 4G6FB 3A0OA 3ZVVA 4NAQA 4M1GL 3ZO0A 4ZMQA 3VD2A 5LCVL 4LCWB 5L2JA 1WIUA 5F88A 1NQBA 3MGOA 5I76A 4JJ5A 1LEGB 4CBPA 2WOBA 3QFJA 3QR0A 4Y2LA 1WZ1H 5DJYA 4NQDE 4M5ZL 2CLVA 4X6CF 4HEMA 2FVNA 4X6FA 2PYFB 5AUMA 4D0BA 5C0JA 3N41F 3NFPA 1BQRA 2GJZA 4UTBL 5EFIA 1FNSH 5FGSA 3RDTB 4W6XB 3CSGA 1IGIH 3O0LA 5IW1B 1U8IA 1RZKC 2XY2A 4X7EC 2FBJL 2CA3A 4H20H 1KN4L 4KUZH 1DVXA 3FSAA 4KVNH 5EIVA 2AEQL 1B4LA 5CJQH 3DMMB 4P2OD 4TQPA 3SOBL 3D0VA 4G8EA 2DQDH 3UTPE 4E42B 3F84A 3TDHA 4LB8A 4XCEB 4P5TC 3VFSA 4XP6L 2GJPA 5F6IB 1NLDL 2ZYSA 5B4MD 2IOOA 5E8DH 4KKLD 3HZVB 3DVNA 3DUHA 4ZS6C 4ENED 3GXMA 2XQYA 5IVZB 5D4JA 1BQ5A 3S5LB 1BGXH 1RUKL 2F7LA 2W59A 4LMQI 1BZ8A 4GG6E 4MA7H 3FKUS 4HD9A 4IOFD 4U6TA 3QYCA 3VRJB 4ELMF 5C86A 4M8QA 2EIEA 4HJGA 3ARDC 3WE1A 1SJMA 1P1ZA 3IVKB 2E27H 5DFTA 1KJ2A 1DBKL 4A6YA 1UTDA 1FL3B 2COVD 2HX8A 2Q3XA 4BBWA 3RWDA 3GSWB 2W07B 1MHCB 2LGNA 2UZIH 2ZXCA 1G5AA 2EXYD 3VMOA 2ZSWA 4GRLD 4I77L 3BZDA 1OW0A 2E6PA 4U3HA 1D7CA 1OTSC 5MEPB 3BPOB 1CU4L 2EEDA 1EHAA 3I9AA 2EEXA 4I5BB 3MX0A 5ISZE 3B5HA 4GSXA 2LVEA 4L0ZA 1LO0H 4GW4B 5FIEA 5MI0B 3QUKA 1I7ZA 4H1LA 4LAQL 2R0LL 2JV6A 3UTTE 3OAUH 5MENE 1EZLA 1N8OE 4B41A 2WLLB 4ALAL 1U33A 3OZKA 3Q8AA 4P4KD 1VADB 3KCWA 4FXTA 4X6DB 1PSKL 1L9TA 4HFWB 3KH3A 4PMEA 3JV5A 2H32A 2JB6B 2HVBA 4JQXC 3IDIA 4I88A 3RWJA 4P9HC 1CFNA 4G6AD 4NKIH 3DC0A 3SDAC 2VLMD 1QUPA 3IJSA 5DJCA 4QJ5B 3ARVA 1XIWD 3ORJA 4PVBA 3KVQA 4M8RA 3ECBB 4PRIA 1NCJA 1H6UA 2DQDL 3IU3A 5GHWH 1RY7B 5K9QG 3RY5A 4JZJB 4TQ8A 5CLYA 4WNQB 1CFQB 2PUQT 4UMGA 1S8DA 2JJUA 2A83B 3TGXA 2WXJA 1LLAA 4ODSL 5IVXF 1KN2L 3BX7C 5FC9A 3O2VH 1E8ZA 1PCSA 1HCFX 1T5WB 2YXVA 4EQ3A 5MENB 4J3WA 1R3JB 1ZHBA 2P47B 4X8JB 2DKAA 4XZ4A 3S3SA 4LCUB 1OW0C 2A9DA 3SCMC 1BZQK 3BVNA 3D50A 4H5SA 4JFTA 3WJJA 4G42A 4NQCA 3SGDH 3I2CH 4CC0A 4KJWC 4HGMA 3VSTA 1MFUA 1I8MA 1KDIA 1DJSA 5EPCA 1QSED 2A6IA 2P8MB 1B0GA 3NRPA 2VL5A 2Y06L 3EYOA 3MI6A 5KG9B 2F15A 1YJDL 1I1FB 2CUMA 1KCRH 3PL6C 4PTTB 1QLFA 3BP5A 4HXAH 4WTZA 3WKNA 1VKXB 1QBMH 3O6MH 2N7BA 2CIIB 5I8EA 1QUNA 5BV7L 4DK3A 2ZKHL 4NNYB 5DEGA 2AAVA 1NOFA 3FQTB 4P23C 5I1EL 3GSWA 2XN9B 2H3XC 1KFIA 3O6KH 4TVPD 3KD4A 4S10A 4WI3A 5F3HA 3N44F 1AO7D 3UAJC 3H85A 4H1LH 4WI9A 1KJ2L 3FQNA 1AO7B 3UDWC 1B90A 2OMTA 1A9EA 4HIXL 2DYPA 2VISA 2BVOB 5DT1L 5I1KH 1EDYA 4FZEH 3QWOA 1CDWA 4PGDB 1OWRM 5BXFB 3EG9B 1JYWA 3C12A 1E28A 3IE4A 3HC0B 3LZPA 4I18B 4BQ9A 2QHRH 4M5YL 1LD9B 2R9HD 3QEUB 3NSJA 2R23A 4W81A 4KK9D 1E30A 2D7QA 5ESAA 2DJSA 5EORH 3CGTA 4NQDA 3VB9A 2ZJSH 1NCCL 4NPYB 4KQ3L 4GUPB 3ZLQC 2WKOF 3MRMA 1BLNB 4ZD3L 1SQMA 1URIA 2OMYB 3SO5A 5AQ0A 3P11L 1QN4A 4CGUB 2NDFA 2CRZA 4FTVA 3ME0A 3L3HB 4PJXA 5MERB 3OG6B 3QNFA 4L4TA 2WD0A 3OKKB 4UUJB 5CSGA 1IBZA 2DMHA 4HUXA 3EGXB 3OGDA 2P8LA 4OQ1A 1NC2A 3MNWA 4LF3A 1BBJB 4TM9A 3TH2T 4OD2B 3B9KB 1HVXA 1EUTA 2V17L 3RNKA 4BFRA 3ARTA 1NEPA 4XPGL 3E38A 3V0WH 1L9PA 3UAJA 4H0LC 2NYZA 4HUCA 3GK8H 1BLIA 4Y5XC 1M56B 3F58L 1TYRA 2N3JA 1ZTXE 2HA1A 4CU7A 3HZKB 3SE6A 5DWUH 3SBQA 3FT4B 1OAYL 1FC1A 3CPUA 2EIDA 5CBAB 1RHFA 1EIBA 1XR9A 1FZMA 3DX6A 2EDNA 3N04A 3UJTH 4G59C 3QO0A 2W9DH 1LDPH 1JYNA 3K71A 4GG8A 1M7IB 4IBLT 5GISL 3T4YA 1FORH 4F7MB 2Y6TE 1WJWA 4F2EA