1QTPA

Crystal structure of the ap-2 clathrin adaptor alpha-appendage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
b'GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C)
publication title Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 66
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 1999-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1qtpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qtpA02
3OCIA 1W80A 4RODB 3EIKA 1QNCA 3ZHFA 2G30A 4BCXA 5IYCP 2Z8UA 1R4XA 1YTFA 1PCZA 1TGHA 1TBAB 2MJ7A 1QN3A 3VN5A 1GYUA 4ROEB 3MNMA 3HS8A 4B0AA 3OC3C 2YMTA 1NGMA 5CN2A 4ROCB 1D3UA 4PY5A 4WZSD 1QN4A 1KYDA 2DWXA 2DWYA 1OM9A 2IV8A 1GYVA 5IYBP 1AISA 1QNAA 1QNBA 2A7BA 1QN9A 1QN7A 1KYUA 3ASMA 1CDWA 1IU1A 1QN5A 1KYFA 1KY7A 2D0CA 1VTLE 1QTSA 1RM1A 2IV9A 3ZY7A 1JFIC 1MP9A 1P4UA 2D0AA 2D0BA 1QN8A 1YTBA 1NH2A 1KY6A 2E9GA 1B9KA 1E42A 1TBPA 3H1ZA 1QN6A 3HS9A 1C9BB 5CN1A 1VOKA 1GYWA 1VTOA 1QNEA 2VJ0A 1NVPA 5IYDP 1PZDA 1NA8A 1VOLB 1QTPA
chains in the Genus database with same CATH superfamily
1X7QB 3U48A 3D52A 4UDUB 2QQKL 4M7LT 4AZ8B 1MFAH 4D9RE 3NIFB 2F74B 4FJZA 3FRPG 3I74A 1MFAL 3C9NA 2G2NA 2P43B 3WE1A 4ODWA 3EGSB 4Q8BA 1BAFH 4G8GE 2ZSWA 1H6UA 3PGFH 4L1SA 4F91B 4AGMA 1WCBA 4DP7X 5IBUB 1BAFL 4YVUA 3PGFL 3KLHC 3KPOA 1F86A 3OM3B 4UYQA 1DJWA 4OCXH 5IB1B 2OMXB 1SEBB 2FE0A 3D25A 4U3SB 2XTJB 2HT2C 5ID0A 4OCXL 2YR3A 4J1UB 5D72H 2AMGA 4WUUB 4BRJA 3N6YA 1RK1A 4WNQA 2I26N 1FCGA 4UUJB 3OMIB 4WI6A 3BGFC 3BUTA 3L4ZA 1U33A 1QUNA 3TH4T 1NEPA 2CBOA 1V5SA 3JV5A 3BW9A 4M6NH 3QC5X 4Z3JA 2VH5H 4N68A 1G5AA 2P5EE 4M6NL 5EOTB 1UD5A 2VH5L 5IYBP 5E9DB 5H37G 4XNBA 1VGKA 1X9QA 3U7YH 3EO9H 2XLLA 3FU7A 2E75C 1WTLA 1BD2B 3GT6A 3EO9L 4RRPM 4ZO6A 1EXUA 2EXSA 3HG3A 1ILSA 1JD7A 1E9OA 2ATKB 4BA8A 3LKNB 2O61B 4XCYA 3TVMD 4HJSA 2Y7SA 4PGJA 4N2AA 3GS4A 1L7IH 5AVUB 5T33H 4HUVA 2PWEA 1HIMH 1L7IL 2FCBA 2VLRD 4ZYKA 5T33L 1S2EA 3QUXC 1MLBA 1HIML 2XA3A 5F89B 1YJDH 2D0BA 3PDOB 1QVOB 1YJDL 3TFKD 4LT7A 1VFOA 1JHTB 2OXHB 1XL6A 3F12A 1Q90A 1TYJA 1YAZA 3VGEA 3RUGB 3ULVE 2TAAA 5IJKA 3QIWA 4HX1A 5I5IA 4LHJB 1JGEB 2K8QA 2DTSA 5C0EA 2YD4A 4NN6C 5C2UB 3H9SB 1CXLA 3FRPB 4ELMB 2Z0BA 3ZIMA 5E6IA 3NCMA 4HPYH 2BSBA 2H2SC 2N1KA 4ZQKA 1BLNB 3IMVA 5LXGH 4HPYL 5IREA 1DVYA 2L8AA 4FNPA 4WX8A 1FVDB 2Q76A 5I0WA 1IO4C 1T2QH 5C3LD 3V4PB 1M7UA 3FN0H 3WV0A 5JXEC 2VLLB 1AXTL 1T2QL 4PJDB 3T8XA 4JY6B 3FN0L 4W9HC 3VU2A 5J6SA 4PVMA 3EIFA 3ZDZB 2QADD 2VJ8A 4NRZA 2E7HA 2P47B 5A43C 2JMRA 3BOVA 3VXPB 4XXCC 4IHOA 4JR9H 5GISH 1KCVH 1E65A 2Y7QB 4JR9L 5E8EA 5FA4A 3TF7C 5GISL 1QSFE 2A9AA 1KCVL 2XWDA 2H0FA 2WQVA 4NB7A 4U1LA 1RH8A 5FKPA 2C1PA 5EPMA 2ERJB 3VXUE 5CGMA 1AR1D 3CXDH 4K4KA 1QLFB 5I1HH 1MCQA 2FLRT 3CXDL 3N42F 2V33A 2GK0A 5I1HL 2RD0A 4KKAD 4I2XA 2L4OA 4E42A 3VQ2C 1F6AA 2J7LA 2W80C 4L8DA 1QFUH 3FFCD 5F7HA 4R4ND 2BOBA 1V05A 4QLRA 1QFUL 1NDTA 2IC2A 4NUQA 2OSLA 3DVNA 2NX5D 4XO8A 1KBVA 4Z7UE 3KLDA 1E0OB 1ZIAA 2BSSB 3ZMRA 1L9NA 3B6SB 1G7JB 4WY7H 1T83C 3QJFA 1SEQH 2VWEE 1MW1A 3NSYA 4WY7L 1G7QB 1M1XA 4PCKA 5HDWA 1GGBH 5IROD 2G2RB 1DZ0A 3UDWC 3NEXA 3GEFA 1GGBL 4Y1AA 5KBNC 5BS0E 1J0JA 1XSZA 1ASOA 3LRKA 4AV4A 3MYZA 2F7QA 3K0YA 4F7TA 4HHWA 1TKWA 4PS7A 3VVWA 1M71A 4RMSA 4ZFFB 3WIHA 3EO0A 2W92A 3OAUH 4GUCA 2XTJC 4KFMA 1J8HD 1EANA 3GSXA 4TL5A 3MJ7B 3OAUL 4HWNA 5D71H 2GI7A 4ZS6C 5EZLB 3ZT7A 2NYKA 4Z5RB 4L48A 3Q5YA 5D71L 2DL2A 4OQ1A 3VFPA 2FQGA 1EJ6A 4LLUB 1DQQA 2FEEI 5C07D 3SY6A 4L37B 3TCLB 1DJZA 3ABMB 4NKDB 3KYAA 1NFDB 4M6MH 4AIOA 3ARBB 4R90H 5F8RC 4M6ML 4NQXA 1QHQA 2HFGH 2KDYA 3B2XA 1SDYA 4JFEE 5JXAH 2A9NL 3TA3A 2HFGL 4KKZA 1TT6A 1HNFA 4H1LH 4HS3B 5ACMA 2MIZA 2MQGA 3T1FB 3SYAA 2FKMX 4A2LA 1QZ1A 2MOVA 3LEVH 1PKQB 2H32H 4KY2A 1E4JA 3LEVL 3T5WA 3SE3A 4WO4D 3BI9X 1N8ZA 3AG4B 4XHJC 5KBMA 3OV6A 2OOYA 4M8QB 2OMUB 4BK4A 4P57B 1I8UA 1WCQA 2P8LB 4KHXH 1IM9D 3IRPX 2XZCH 1MAJA 3PWJB 5J4MA 5IKCB 2XZCL 2BVEA 4HDIA 4WI9A 2B2XH 3ZO0A 4CU6A 4LCWE 5AG9A 3Q5TA 4XNUL 4ES8A 1HOEA 1Y07A 2B2XL 1S3KH 4B95C 4OZGE 1S3KL 1RU9H 1OLLA 5DRNB 3FT1A 3S37H 2WWKT 4JFPB 1RU9L 1THCA 2BVUA 5ITFB 3S37L 5KVGE 3CVHA 2XN9D 2OMTB 2HRLA 3CN1A 3QDJA 4UT9A 4X4ME 2CA4A 3WFCL 2ZXGA 2OZ4A 3VFNB 4RMQA 4JY4B 1UGNA 4TNVK 1NGPL 1XTLA 4D8PB 5CEZH 1LLAA 3MLTB 1RP9A 3KPNB 1RZ8B 2AK4E 4YHPA 5CEZL 4ZXBB 5FCSH 3BZ4A 2W60A 3HC2A 1OT2A 3RIFK 1F4WH 1HOCA 2GAZB 4HCFA 1K4DA 1AIFA 1F4WL 3ENOC 2AJZA 4JO5A 4HKBA 4K23H 4L0YA 1KN2H 3BPOB 4B27A 5CBAA 3OX8B 4K23L 2ORBH 4R7DB 4AYID 2HTLC 2ORBL 5D1ZA 5EC1A 3STLB 3FO9A 4IYKA 4I4WB 1GGIH 1S9VA 2JKWA 2J56A 5A6LA 1GGIL 4A67A 2AJSH 1W8NA 4KDTA 4L3ED 4PHZA 4YQXH 5JPNB 2AJSL 4DFIA 3WFZA 2EIJB 4H40A 4X6CF 3PWUB 2W9LA 2ERJC 1IAIH 1JWMA 4P3DB 4JB9L 1Z9SB 2IAMA 3O3BB 1IAIL 4HPHA 5I16A 3WMPA 5D2NB 3GBML 4RBPK 2NDGA 1QSEE 4IRSA 3CXHK 1EQWA 5F9JB 2ETWA 1UATA 2ZONA 4IKNA 4K94H 1WIOA 3FTUA 4XPAH 4X5XB 4K94L 5AUMA 2YSTA 3W57A 5IF0A 1SM3L 3B9KA 5DUJA 3D51A 1R24B 3IH7A 5IVXB 3WE6A 1C8PA 3RB7A 4AQEB 3I9GH 5IMLB 4XOAA 4JJ5A 3VI3B 1ET5A 3I9GL 3HE7B 4I88A 2R1YB 1JYWA 3PL6D 1FIGH 5T1KB 2YD3A 3NQKA 2IOMA 5E2VH 2ADFH 2Y2YA 3CV5A 3DRQA 5DMGD 5GGVH 2NR6C 1FIGL 1E4KC 5E2VL 4H88H 3EDJA 2ADFL 3NEEA 1XSOA 5DEZA 5GGVL 5LQBH 3IGKA 4WRLA 2YGVA 4H88L 1C8QA 4L8SA 1BMZA 2Z7WA 4OGXH 5LQBL 2Z7UA 2ALAA 4JS7A 1KXTB 1YPZE 1LNUB 4NEHB 3GMLA 2WBXA 4K9EC 4Y2OB 5SV4A 3SE4C 3MV8A 4JFXB 2HP4A 1IEHA 2P44B 5FOJA 3QORB 3BHBA 3VFSB 4BWTA 2OMZA 3SQRA 4Z3GA 2E8ZA 4LPUA 4AKQA 4LVNB 1TYEB 1V3LA 2W0FB 1UVQB 2VLME 3ARBC 3IJHB 5BMNA 3D3VE 2BIOA 4EZLA 2VDLH 2WAHA 1KXVA 1EZVX 1QKZH 2VDLL 2H6PB 3ZSTA 4ENZA 3PNWB 5J8OA 3QFDB 3G5VB 1QKZL 1J9RA 2XWZA 4HISA 4RFNB 3WN5B 4XHQA 1L4IA 2V6HA 3C04A 1ZWIA 1CD1A 4FFZH 1CFNA 3SDCB 3APCA 3HHSA 3OLDA 1D5BB 4FFZL 4QYOB 4ZZKA 3LPWA 4X6CA 4OIBA 2FUVA 4YE4H 1BCIA 3U9UB 2E7MA 3ZE1E 3MR9A 3HI6H 2FECL 5BRQA 3ZYZA 4YE4L 3LNIA 2QR1A 2DI8A 3HI6L 4GSRA 4MBOA 5J9PA 3OKMA 3P3RA 1CXHA 1L0XA 4WTXA 2EO9A 2RA1A 3IDIB 1FNEA 3NA4A 4YSOA 1IQDA 2ITCA 5D7LA 4DVBA 4YDZA 3TBCA 3WJMB 1G9HA 3K4AA 1DVFB 1RERA 4TPRH 4YBQD 5DF0A 3CGTA 3FUFA 2YD5A 1X44A 2IGLA 4NYLA 4TPRL 1WT5C 3DI2B 5FF6A 2XWTA 1OGAD 1SZNA 2BP3A 5F0MB 2NUPA 1EO7A 3VXRB 3VXTA 3EH5B 2XV2A 3BN9C 4M43H 4G7QB 3RKDD 4WFFE 4CW1A 1FYTD 1WFUA 2DH2A 4M43L 3GJFA 3CZGA 2FUQA 4WWPA 3B83A 4P5RA 4X7FC 4J39A 4HG4J 3DO7A 3I02B 1YYLH 3NIDE 3AY4C 2NUTB 3WY1A 4U6XA 1MRDL 1YYLL 4D7PA 3H6AA 3BPOC 4OV6F 1TLMA 2IWKA 2NY3B 3HTLX 4EAKA 2LTQB 1ET7A 2PXYA 3KGSA 1CMOA 4MMXB 1EV2E 1Q72H 4XNZB 1FPTH 3T0EB 2HRPH 3A67H 3QQ9D 4U1KB 2ZCZA 4F7KA 2Z8VC 3DMMD 5I76A 5IQOA 2VDNB 1FPTL 2P24A 3FQXB 2HRPL 3A67L 4P23A 4P9HH 4DEUA 3MLZH 2H9GA 4DP2X 5JPNC 5KS9E 1LP9F 3IKCB 1TF4A 3EYVB 3MLZL 3V52H 1VTOA 1MCHA 5CGYD 3RWFB 1JV5B 1WIPA 1WK0A 4MNGB 3V52L 1R47A 1UTDA 1WS7A 2ICEC 4Q0XH 2VERN 1IKNA 3T08A 3L3HB 4Q0XL 3OCIA 5DWPA 4JHBA 4OM0L 1Y7VA 3ARPA 4N2LA 4BSWB 3O2DA 3SN6N 1JGDB 4AH2B 4MA3B 4RNRA 4O2CB 1C7SA 4M61B 1QEWB 3E1ZA 4GRLA 2K4WA 1E27B 3BE1H 2OQJB 2ZAHA 5DC9B 1CD8A 2J71A 3BE1L 3G6AA 4NO2B 4MJ6A 5GZOA 4QXWA 3HE7C 5HHNA 5LGJB 4EUPG 32C2A 3N1GC 1G7HA 2VXSH 4UM9D 4RAVA 3VN5A 4WU5A 3PIQB 1NUDA 5DFVC 2VXSL 1CCZA 1A9EB 3HEIB 1GY1A 4P2OD 4NX0A 5IFHH 2VLJD 3GMQA 5IFHL 4CMMA 5E94B 3CFTA 3QIUA 4HS6A 5I5JA 5E08H 3RWHA 4G9DB 2WAQA 4PR5A 1YEGH 4PVLA 5E08L 2ZWLT 4KQ4H 3QORC 5GPRA 1YEGL 4KQ4L 1H19A 2PYFA 5L2KD 2AQ2A 3L4YA 5D1QC 5F9OH 3WYRA 2PNDA 1LDPH 1MI5A 2EHBD 5F9OL 5D1XE 2PYED 1LDPL 4AQ8C 1VADB 2ZOLA 1WHPA 2UWEB 1KIUB 4J4PA 4PJEE 3RGBA 3T6XA 1IU1A 1KFIA 2XHIA 2C3WA 3IFOB 3WTVA 4F7EA 1U95A 2WK2A 3WN5C 4CNIA 4FX5A 4W6WB 4DAGH 3E6FA 1CLVA 3P4NA 4ONFH 3ZDYE 4DAGL 2Q20A 3NYKA 3SDCC 1A3ZA 3KM1A 3RNKA 4YHOH 3SOBH 4ONFL 3C2SA 4MD0B 4R3SB 4XMKH 4XPGH 5JIMA 4YHOL 3SOBL 2X0UA 2UXVA 1UWEH 4WU7A 4XMKL 4XPGL 4YXHH 1MF2H 1UWEL 1ZV2A 5CJOH 1P5DX 4GH7B 4YXHL 2DQEH 1MF2L 3CZLA 1D5ZA 1E5BA 5CJOL 3DVGA 2A9CA 5F1IB 2DQEL 2VXQA 2A38A 3TBTA 3TZVA 1C12A 2EKJA 5F3BA 3SKMA 4PJ7E 1KMGA 5G4OA 1KTDB 1LWJA 1WTGT 1XCQB 3OJDA 4IU3B 4EOWH 3SO5A 1ZXQA 4B9PA 5E23A 1FJ1B 1JZEA 4R9HA 4EOWL 5HD8D 1RJZB 4IS6B 4U1HB 1DVFC 4D9LH 2ZG2A 1U6AL 3MU3A 2WQWA 1FGNH 1I85C 3GPSA 4DO6A 1R46A 4GBXD 4V11A 1TVHA 4AGPA 3ULUF 1FGNL 4JDEA 4FEIA 1PVHA 4G8AC 4LK4A 5JORA 3T4YA 1EERB 4Q7DA 4EUPB 1MH5A 1OP4A 2ZE0A 4KKBD 4KMLB 4Q6KA 5BV7B 4DK3A 2FR4A 2QPSA 1R19A 3VWKA 3EJYD 4GP5B 4Y4HB 4C56E 4RODB 1ED3B 2KLTA 2WKOF 4LLMA 4OCMC 5KAQF 2NY3C 1ZRUA 3E80A 2J20A 2LTQC 1R4XA 4XRCA 1FHGA 2AAVA 1ZHNB 2QLVB 1LQBC 1JK9A 2EQDA 4GKOA 4MMXC 3BQUD 2Y8QA 2WCPA 3NCYP 4QRSB 4XNZC 1L9TA 3T0EC 2K6ZA 3HMXH 4PRHB 4QYAA 4JO3H 3HMXL 1JMZA 2IGTA 2XN1A 5DMJB 3V4VH 1IARB 3IDJA 1VZGA 4JO3L 4L29B 4PJGA 4PWHA 1IAII 5FECA 1PQZB 4QHLA 3V4VL 3GTNA 5KN5A 1LWVA 3U6RB 3LZFH 4FFYA 4PB9H 2CLRA 4BHUI 3LZFL 1AACA 4PB9L 2MRYA 2RCSH 4IKIA 4NPJA 1MVUA 2ZUSA 4MJ4A 2RCSL 3IFNH 3RJOA 5AW9B 2NOBA 1BIHA 4HUWB 3ARGA 1UQSA 3IFNL 3GEWB 4MCMA 1BG1A 4MWFA 4QG5A 4G8GB 3NFSH 2P8MB 1OV8A 2ARJB 1YDPA 4BK5A 2EZ0C 1JD9A 3NFSL 3QCVL 1KPUB 4JBSA 3V6ZB 1FFRA 3SIKA 2IALA 1DE4B 1FZOA 4DPRA 4PG9B 4OLUH 3VD0A 1YN7B 1WBZB 4NBXB 2A5UA 4ZJ9A 2D7OA 3P30H 3DECA 1NIBA 4ABVA 2OR9H 4APQB 2GJRA 3N9GL 3P30L 2OR9L 2NSXA 4WFGD 5FUZH 3MOBH 5DK0B 3HZMB 5A7EA 2NY6B 1Z0MA 1LWHA 5FUZL 2IQAB 2OV0A 3MOBL 2P5EB 3IAGC 1F8TH 2YXWA 3PAVA 2DWEA 3FUIA 5TFSH 1F8TL 1KY6A 3IM1A 3HZYB 3GMPA 5TFSL 4BZ1A 5D7IF 4LPVA 2CGYA 4PWKA 2WKOA 4L2YA 4AYMC 2XG4B 2NOIA 3UAJC 3WFDL 2NTSP 3EZJB 1OD7A 4JRYA 4IEFA 4WKZB 1CLCA 3A4FA 3DX6A 1HEHC 2OR7A 2KZWA 3BPNB 5T3ZE 5C71A 4JE0A 4MTMA 4ZUSA 3OKLA 4HWEH 1J12A 1XH0A 3EYOA 4HWEL 3AGWA 4GFTB 1RUPH 4PI2A 4YNYB 1U3HB 4FFWD 3KCPB 3QQDB 4R0LA 1HL5A 1LL1A 1RUPL 1QLEB 5F1NA 4XAKE 2RH0A 2VYRE 4N24A 4ES9A 5MENE 2Z92A 2JSFA 4U1JA 4DP4X 1VFUA 4G2AA 5H4YA 4WHCA 4W9LC 1EDQA 2FZ3A 4H1LA 4YZFF 5E51A 5HSFA 4EKJA 2BH0A 4YE0A 2WZ6A 3QXAA 5BCAA 3T2OA 1KLFB 1MW0A 3F7VA 3PUCA 2XC8A 5PCYA 2H32A 1UB5B 3L95B 1G4MA 3KPSB 3LXAA 4HLZG 3RRQA 4KOCA 5BQ7B 3MAWA 3OGOE 3WHE1 1WGOA 3BESR 3PUUA 4N2IA 3M86A 1J5IA 4UAHA 1OVZA 1AQMA 3LIZL 3U30B 4AOFA 4AXWA 3PHOB 3O6KH 5IMOB 3JWDC 3UTQB 2AFNA 3O6KL 1IM3D 2BNRE 5HHOD 1CFMA 5BV7C 1RZ7H 3A21A 4AIXA 1A6AA 2GIMA 3RLSA 2EDWA 5C0IA 3K81A 4OZ4B 4QT5A 4Y4HC 4YVNA 1SPDA 4K3DH 4HK0B 4ELKA 3L5WB 1HHKA 1QSFB 3PRZA 2GTZB 5GGSB 4K3DL 1IFRA 2UX7A 1E4XH 3C12A 3ZX1A 4CVZA 3WEAA 1KIQA 5K69A 1OWRM 3VXUB 3DX9A 1E4XL 3LKPB 1M9SA 4N6RB 5B1JA 2X44D 1N26A 3UJTH 3FJTA 2O6FA 3B9AA 4L1TA 4MNQE 4HVBA 1O7DE 3UJTL 5ALCH 4F2ME 2D31B 3LEXB 5ALCL 4ANVA 1CFVH 2ZUWA 3D18A 4Z7UB 4EAEA 1P4IH 3IVKB 2Y72A 4JM2A 5C0AD 3FUKA 3UYOD 4F1ZA 1CFVL 4OT1H 2LABA 3K4ZA 1P4IL 3V4PH 3X1GA 3N43B 2B7DT 1RQ5A 2OKMA 4PJBB 5KJ7E 4OT1L 4F27A 1Z9NA 2FIKB 3V4PL 3M7FB 5I1DB 2BNQE 4MKTA 1SLXA 4KNQA 3JWNE 2OOXA 1NBCA 5CLTA 1AHMA 1P7QA 4JVWA 1HQRA 3VYPA 4QO1A 5BS0B 2X4UB 2X7LB 4P2AA 4BV1A 2H7WA 4PV8A 4P49A 2H8PA 1AGFA 3DOIA 4FFTA 1AMXA 2KUTA 4MD4A 4PHXA 5KOVC 3SOTA 2RFXA 4ILDA 4YHYB 1J86A 2JXMB 2QLYA 2D0FA 4KKRA 1RUKH 4NI3A 1CYXA 3CHQA 1I1FB 35C8H 4RCAA 1KCUH 5EWIH 5BZWB 2I9LB 1RUKL 1HCFX 5EWIL 5H37H 35C8L 5GS0C 2F19H 4NWTH 4HP5A 3GLEA 2F19L 2V4LA 4NWTL 1QUPA 4BHUA 4APQC 1JHKH 3V55A 5I8CA 4L23A 4PEEA 2HTKD 2E46A 3SKOB 3E6HA 3IF1A 4HKJB 2X4NB 5ERWB 2NY6C 4PJXF 2J8UE 1GKOA 5E0FA 1WBYB 2X2UA 2EIKB 2FO4B 3BIBX 4M7ZB 1XBRA 5EEZA 3BZEA 2VUYA 3VJ6B 1P1ZB 3FCBA 3TOPA 2DPKA 3TXAA 1ASQA 5K39B 4OUUA 5J13B 4OF8A 5EU6A 3ULSB 1HEZB 3NIGE 3K6DA 4JVPA 4WWKD 4L4TD 4PJ8A 2W9DH 1A22B 2VW4A 1E2ZA 4PI0A 4IL8A 2YZ1A 1N6UA 2VN3A 4W1TA 3UGEA 2NDFA 2VXTH 2W9DL 1EGJH 2YZ8A 1L5GB 2VXTL 4NAMA 4BFIB 5T5NF 4Y2DA 4N8VA 2IBBA 3AMLA 5CHNA 4CILA 3HI1A 1WEJH 1CTMA 3QAZB 1A65A 1FVCA 2YGOA 4XMLH 1D2PA 1WEJL 3BPNC 1I9RH 4XMLL 4JM2D 5A6MA 2IJ0C 4K9EH 4EQ2A 1I9RL 4K9EL 4LCWB 4KNUA 3ZMEA 1CT8B 2N0MA 2JCWA 1Q94A 5FX3A 3MYJB 1BW8A 4OZGB 1FN7A 2KH2B 2X53A 1U3HC 3DV6A 1QAWA 4NKMB 2CRZA 4Z77A 3ULVC 4ZW6A 4LL4A 5DQDH 3UTTD 4L9LB 3QJUB 3ZHKA 1P84J 5DQDL 3GPEA 1QASA 4GO9A 3HVDA 2AK4B 5CJQH 1BAGA 5DWUH 5B7MA 1I1YB 2UYLB 4IGBD 2WZPD 4HA1A 4UTAH 3MC0A 2COQA 3BO8B 1YN6A 3GXDA 4FLQA 5CJQL 5DWUL 4UTAL 4FFZA 3UG5A 3HNSH 1A6UH 1CF8H 5JIIA 3PJSA 1DJYA 2EP6A 3HNSL 4OF7A 2F15A 5EEUA 1T89C 1A6UL 1CF8L 2YQ2A 3UERA 4O4YL 3U30C 2Q10A 3PQYA 4EI5D 4XN2A 2WW8A 3W37A 3T4NA 2OFQA 5DS8A 4GKNB 4M5YH 3FTGB 1Z32X 1WD8A 2VLKD 1P5VB 2VGLM 4NUMA 43C9B 5DUBB 2AZUA 2I24N 5F70A 4OLWH 1QI5A 2VDOB 1T21A 5CSZB 4Z7VF 3A4AA 3M6DA 4OLWL 4YGVA 1B0RB 3KCWA 4AEEA 2WANA 5C0RH 3JXAA 2B1HH 4KRPB 1AH1A 1MWAB 3KWUA 5BVJA 1E7UA 5C0RL 1MG2C 3FB7B 2B1HL 2DLGA 5JW4Q 3UPRB 3MLRH 1CFTA 3SD2A 3EDKA 2DW5A 3ETBJ 4ICWA 4OFYD 3VX0A 4DUXA 2R69H 1TJIH 3MLRL 1PCMX 3LRLA 1TJIL 2XTLA 1IBFA 5HGHA 4KI5D 2JLPA 5HVGB 1F3RB 3UOAB 1NC4A 2VWEC 4HEME 5KBPA 2X41A 1RPQA 2Z6FA 5MEQB 2EVFA 4ETQA 3RDJA 3RPIB 2NRDA 4POZD 5SWSA 4IBUA 4NQCA 4UQCA 4X4ZA 1SMAA 3B1TA 3GJEA 4P3CH 4ZMZA 1JPGA 3VWJA 4X8JA 4P3CL 1YMME 3SDYH 3GZOA 3QFJA 4WTZA 3CZFA 1XCTA 3PV6A 2ZYIA 3SDYL 1YPZB 2E6PA 2WQRA 3L9YA 3OWRA 3QJHA 1IVTA 4RVBA 4XP5H 4LCUA 2GYSA 2Y1AA 1JXGA 4XP5L 2QFPA 1FVEA 5EA0H 5F2FA 3W11C 4Y16D 5EA0L 5F7FA 3QJXA 2ZXEB 3MRKA 2ZT9C 3KXFD 3B2PA 1AISA 2CUMA 3G6JE 4OD1H 2CIIA 3D3VB 4NAJA 4M7ZC 4OD1L 4H2CA 4UQ9A 4GXUM 3JYBA 4GQQA 1NEUA 5CGBA 1RLBA 2BSTA 4HMCA 3OR6B 1J48A 4X5WA 5J13C 3N06B 1HEJC 4HZAA 5LBGA 2IPKA 3S5ZA 5C9JA 4YDNA 2P4AB 1PAZA 1D5MA 1U2YA 2J12B 1IT9H 3I9IA 3GGWB 4OUOA 3ECBA 3DETD 4KNSA 1BPLB 1NCGA 1OGTA 2X10A 1IT9L 1Q0XH 2Q0ZX 3ZE1B 1JPSH 5EEXA 1H5BA 1A1MA 1UA6H 1Q0XL 4OBRA 4ORGB 4BSVB 2G4EA 4G71B 3QAZC 1JPSL 1UA6L 1ZV5A 4JMXA 4JFVA 3FT2A 3WTXA 2WC7A 5IB2B 1PIFA 4ZX4A 3D4CA 1KIPB 5AVYB 2CHDA 1EAQA 5DJAA 1JZ8A 2EDBA 4KK9C 3ZHDA 5I0ZA 2IG2L 5IOPA 1ULVA 3CN4A 2PTUA 2NMSA 4ZMLA 1BF8A 1F0LA 1N12A 4AK2A 4AJ0A 2F7OA 5EZOH 4NUGH 2FX8H 5I1LA 3KZ8A 2MJWA 3STZA 2NY1D 3G08A 4NN7B 4NUGL 4RAUA 5EZOL 2FX8L 3LKOA 4X4XA 5IB4A 4MDRA 3TTYA 1EBPA 4L9LC 2F58H 4OLYH 1W0VA 3OD3A 1SBBA 3UFIA 2Y7LA 1KBPA 2F58L 4OLYL 4UQ2B 4WTQA 4PS8A 3IAQA 4MCZA 3ZN6A 3GMOB 5ETUA 1Z5HA 1GSKA 5DRZB 3CFBB 3NIDB 3VXMA 2OTUA 3SYQA 1DJIA 4HHGA 4NM4H 4ODVL 2XVBA 3CDYA 4XVUD 4NM4L 2HXAA 4RAHA 4K3JH 1XR9B 3F65A 1SF3A 3LD8B 4Z7WA 5TE4H 4K3JL 3WIAA 3U7AA 3F7YA 1K5WA 1NPJA 1J8RA 4HUNB 2ZUUA 3F7LA 4XOEA 5TE4L 5EBWA 3TYGH 5I17B 3CWSA 4LHQB 2TRHA 1KJMB 2XV3A 4XN1A 3TYGL 3EW3B 1PMYA 3QS3A 2DQJH 4NQEE 5D96B 1HH9A 2DQJL 2AEIT 3G9VA 1E4XI 1N64H 5KS9B 3IJYB 4AYFA 3US0A 1U8NB 3L1FA 1VGEH 3JBG7 2GTQA 3Q48A 4KO6A 1F3DH 1EXHA 4FQXD 1VGEL 5KEZA 1JZ4A 3G5YB 1AY1H 3RX5A 1K35A 4MLIA 3N89A 1JFQL 3GBNH 1AY1L 2BVOB 4KRPC 6PCYA 5C97A 1BXUA 5LAXA 1E5AA 3GBNL 3B3IA 4X8XA 3POHA 1XGQA 3WSQH 4B9YA 4AC4A 1ZSDB 2WWNA 1I8KB 3QUXA 4LEEA 3I75A 1PS3A 3WSQL 3ZJAA 4KH9A 4DTGH 3MNDA 3GMRA 2AJ3B 4DTGL 4HFWB 4IBWA 4JKLA 5ICYA 1AKJD 1IGMH 4M4PA 4MZRA 1NCHA 3HE6A 4U4BA 4AJWA 4B9IA 1IGML 3L4TA 1GGCH 2XKNA 3BVXA 2YUXA 1GGCL 1UHVA 3EYSH 3ZT6A 1BQRA 5I1JH 3UBHA 3EYSL 3EJTA 3A6BH 3KLHD 2EEBA 3HMXA 2OSWA 2M83A 1MVFA 5I1JL 4HBCH 4RGNB 5JDSA 3ZY7A 3A6BL 2WXPA 1T5WA 2VDNH 4HBCL 4YSDA 4XO4A 2R23A 3PDDA 2G3NA 2VDNL 5DA4A 3ZYJA 2GBUA 1QABA 1NL0H 3AQYA 2XOTA 2WKLA 5HI4D 2FO8A 3LRGA 2N7SA 5EZJB 1M56B 1NL0L 2ZJSH 4B9JA 2NQCA 2ZF9A 1J18A 2ZJSL 1HXYB 4S1QH 4GMTH 5JNYA 1YSOA 5D1XB 3QWOB 4S1QL 2ED8A 2VQ4A 3KDPB 2I69A 4XXCA 4QHMA 2YPLA 4PGDB 4PJEB 2Q5BA 4Y4KB 3CSBA 4EI6A 3TBSB 4Y7OC 4QJ5B 3IRCA 3KLAB 1WZAA 1H8NA 2CR3A 3CDGB 3HA0A 2F18A 2FYYB 3FCSA 5DD0L 5I8EA 4G8IB 1NVPA 3EGDB 3ZDYB 1HXMA 1B6UA 1F3JB 5CILH 2ZKHH 3EG9A 3EYFA 7PAZA 1ZTXH 2B20A 4HIXH 4E9VA 4U1MB 4GI8A 1ZTXL 4J3OG 4MVBD 3FCTA 4YFLI 2IADA 1AJ7H 1GZQA 3CUPA 3D39D 3HKFA 1XTMA 3O3EA 3WNLA 1N3NB 3GRBA 4ZDHA 3S8GB 1AJ7L 1DLHB 5K1JA 3G5ZB 2Y06H 4GW1B 1IGCH 2ZYHA 4PJ7B 3BH9B 3PWLB 3CFKA 2Y06L 4JM0A 3CHXA 5IMKB 3RUGF 3L3IA 2C34A 1PIGA 1X7QA 4HIEB 3HAEG 4O2FB 2FSEB 2X09A 3GSUA 2RAMA 2NLJA 3C08H 1C1EH 2EXYC 4KTGA 4AQ1B 4W9JC 2VSCA 4KTEH 3C08L 1IGTB 1C1EL 3H7BB 4NN7C 4UIKH 3PPEA 5TGBA 3RIAK 4BELD 4F9PA 4KTEL 2LW3A 4HCGA 4UIKL 4WW1A 1JPEA 3V5DB 3CQPA 4ECNA 5A2KH 3QUYC 4JZNB 3CWTA 3AM8C 1JERA 2YAOA 1ECYA 1SEBA 1XB6A 3E0GA 4PJDF 4U3SA 3F04A 3K2IA 3NUKA 5AVRB 5JXED 1FO0B 4U3CA 1P6WA 2IIJA 4C56B 2CA3A 1JXKA 2R1XB 1S9WB 3ARFB 4FE9A 4ONHB 2IBZX 1YA5A 5FR3A 4HF5H 4JZJB 5EBGA 4HF5L 3OMAB 1QPPA 2VE6A 4LLVB 4W6YB 5ITBH 4IOSA 2EIBA 1ONQB 1HH6B 5ITBL 2ZKXA 3MRFB 3X1BA 5E2UH 5D96C 4XTRC 5HJBA 3TL5A 5E9DA 4D9QE 5LO7A 4WDIB 1W0YT 1ZIBA 5E2UL 2CO3A 5FFOA 2BSCA 1NDGB 5C09E 1BD2A 2B9AA 1OARH 3CCHA 2DKAA 1S9YB 4MCNA 4MXVF 5T1MA 3IYLW 1OARL 3EJPA 1FV1A 2EYTB 3Q05A 1SJXA 3NK4A 4XBEH 5AEAA 4DK6A 3MFFA 4DSYA 5CD3A 1ADQH 3VTAA 4TVSa 4EUPH 3D05A 1ADQL 4K5OA 3JWDH 2CALA 5IG7B 5EO9A 1ZANH 5I0XA 1AXIB 1BLIA 2WGNB 3CFMA 1U8LB 3JWDL 4HIJB 3REVB 1RZJH 5BV7H 1ZANL 3VD2A 1TBPA 1FIEA 3VFWB 5BV7L 3KYNB 5DJ0B 1QVOA 1ZT4A 3MRNB 3WMSA 4LSRH 1JHTA 2LGNA 3VH8G 1SLWA 5D2LE 3INOA 4LSRL 3RUGA 5H4ZA 2DH3A 5D5MB 2R27A 2F1AA 4W9FC 5AKVA 1RHHA 4PIBA 2D0GA 2A4EA 3H9SA 3FRPA 4NO0B 1DJGA 2DQUH 3FS9A 3HPJB 1G7PB 4ZS6D 4FDWA 4JDTH 4WUUD 4DQAA 1FVDA 3IFPA 3KYOB 4XMTA 4JDTL 5HTSA 1R9FA 3K6IA 3EIKA 2OTWB 2VLLA 3HZKB 3Q8BA 4PJDA 4JY6A 5IHUH 5F7AA 1F1AA 3MA7A 4TLKA 4DP0X 3U1SH 3W2DL 3IDMB 5IHUL 1TETH 1KOAA 3U1SL 2WLLA 5D1XC 1TETL 1UT1A 3M1CA 2ZOUA 2BFGA 2XXCB 2MJ7A 4A6YB 4HD5A 4WJ5A 3P11H 4Y4KC 3X3FH 5J57B 4C4BA 3P11L 1PNCA 4NQSB 4WHTB 3X3FL 1U2CA 2Y7QA 3IMSA 4Z0XA 2DMBA 3WS3B 5IVOA 5KVFE 2MKWA 1U4EA 2Z8RA 1EEZA 2F9BT 5H37A 3VM7A 1M6UA 3O4LA 5GS0H 5FYKH 3V0EA 3VFMA 1MUJB 1XSJA 5GS1B 3VM5A 3PAYA 4LEOB 1IAMA 5GS0L 1UEYA 1U92B 3T3PE 1AI1H 2Z65C 2K8MA 2R2HA 3EJSA 4Q4EA 2BWDA 1AI1L 3TJHD 5MENB 1XEUA 3RVVC 1J0HA 3LQMA 3DURA 1IAKB 3LMJH 5DJZB 1F00I 1SMDA 2BSSA 1RIHH 3GRWH 3LMJL 3KH3A 3MJ9H 3B6SA 1G7JA 4L9DA 3H9HA 4FNRA 3GRWL 3L3JA 4LOFA 2G2RA 4AQ1C 1MHEA 2EIMB 1EGJA 1W2KT 3VFGL 1I8IB 2E0PA 3VH8B 5AWNH 4XWGH 2Z0UA 2V7HB 2NR6A 3BLPX 4JKWA 5DK2B 5AWNL 4XWGL 2ADIB 4EJ1C 3AC0A 4BQ9A 3A6CH 3CBRA 4RSVA 1PZ2A 1CTNA 2J57A 3A6CL 3DO4A 4ZFFA 2BNRB 1DDHA 3VACA 1B0GA 4JDVA 1NKOA 4F3FB 1XH1A 1Z1WA 4DNLA 4PS3A 4Z5RA 3QYNA 3RZCB 1DUZB 4G8EA 1EWHA 3ARFC 4OFVA 2HTLD 4A7GF 4LLUA 3TCLA 4L37A 2J1YA 4JZJC 2JHJA 1NFDA 3KPPB 2ALWA 2DMHA 5FGRA 4GS7B 3ULVH 2MCG1 2F1EA 2X9YA 2E7CA 3ULVL 1GZHC 2E59A 2JIXB 2NNRA 1FF5A 2NX5E 4MNQB 1PLGH 4UTAA 4HS3A 5EC2A 3ZRFC 1PLGL 2D7MA 3SJVE 1KJVB 4LCYB 4G83A 4LPYA 4RH4A 1ETB1 4PW9A 3EHBB 2H26B 3SPGA 4A2EA 3BVDB 4NZ8A 5DC0A 5GGRB 3BWAB 3TV3H 4MQTB 2ZWKA 3KE0A 1U36A 3AABA 5F88B 3TV3L 3ZHFA 4BCXA 2P8LA 1AGDA 4RWHA 4ZW3A 5AKRA 4Z8FH 5IKCA 4NKIH 3F6LA 4Z8FL 4PWFA 1YO4A 1A9VA 2OAAA 3VI3F 4Z3HA 1QFHA 3O8XA 1CDGA 4NKIL 5DQJA 5KANG 1LD9A 3LY6A 3SB3A 3E2HB 2PTTB 5DRNA 3WIFB 4I18B 5HPOA 5KG9B 5JMVD 5HXMA 5HYIA 4ROCB 1WT5A 5DYFA 5C07E 4L0ZA 1NMCB 1OF0A 4D8PA 3PWPE 1RZ8A 2PUQT 2R69A 4HQQH 2J8UB 2LVEA 1COBA 1F97A 2WP3T 4HGWB 3TBWA 4MJIA 3CH1A 1G1OA 1NBZB 3QPQD 3AY4A 2JOIA 3M46A 5DO8A 2ZP0T 4UWQB 5DUMH 1F11A 4OJDH 5DLLA 2BS71 4P46C 5DUML 3NIGB 2QTVA 2QVKA 5DJCB 4R7DA 2G75B 4QR7A 1DVUA 3EDDA 3ARBD 4XPHH 4BKLB 1WZMA 3AFLA 4XPHL 1DQLH 4I87A 4I4WA 5ISZE 1CPUA 3MOAH 1DQLL 3SE6A 1VIWA 1RPUA 2GIYA 2XFXB 2OMWB 5JIQA 4GINA 1NWOA 1UL7A 3MOAL 5HHQB 2CK0H 5JPNA 1JZGA 3OMZA 4E41B 3BAEH 4FNQA 3KBFA 3NGBB 2CK0L 3A3YB 3RDTD 3BAEL 1JAEA 4Z7AA 3QQ4B 1M2VB 1DZBA 2FX9H 3DX0A 1MXDA 3LVTA 3WN6A 3MACL 3SDDB 5DO2C 3K0WA 2J2ZA 5GS1C 3AT0A 3O3BA 3LZNA 1TNMA 2ICEA 5F3HA 3M1BA 5I1KH 1HHHB 3V0FA 3TO4D 5F9JA 5E1AB 5A2BA 5I1KL 3G5XB 3T3ME 4HLZH 1T1XB 3DVIA 3R4RA 2CXGA 2XTSA 3EDEA 1MFMA 3DLQR 5MEOB 4Y19A 4CU7A 1JWSB 4PJ9B 4YXLH 1MCOL 4XVTH 2GEQA 4PFEA 1RZPA 2D7PA 1S8DB 4BCZA 4AQEA 4YXLL 2AITA 1KFGA 5EBMB 1YY8B 3NFPA 3VI3A 2AV1B 2VDRH 3HE7A 4IHBA 4ZPVB 2R1YA 4JANB 3RA7L 2IDCA 5T1KA 3UEQA 1VHPA 2CBTA 4LOEA 5A2JH 3THMH 1KGIA 1E9PB 4NRXB 1EJOH 4UTBH 5T8IA 4ZFZB 3THML 3FBQA 2F8IA 3IE4A 5LWYH 1EJOL 4ZXBD 4UTBL 3QVAA 1K5NA 4LP8A 1S7QB 3P02A 4OZIF 1KXTA 5LWYL 4Y2OA 1TQUA 1TUPA 1KYOJ 3VD1A 4EMZA 5I6KA 2ITFA 3TEWA 1AXSB 2E47A 4HLJA 4JFXA 1I75A 4QWWC 3QORA 3SODB 2J43A 3C5ZA 3RZCC 3VFSA 4EN3B 3Q43A 2QGEA 4FYTA 5FA3A 5D1QA 4FG0A 4GY4A 3PDGA 5GSRA 4HMEA 1J8KA 3FUMA 2WBJA 1UM5H 4GS7C 4AYEC 5KYXB 2YN3A 1UM5L 1YC7A 3GQFA 5KVGL 2J8OA 5CN3A 3VNZA 2XPZA 3MTRA 2H6PA 1O7DC 1N6QH 1TEFA 3QFDA 3I84A 4PVBA 4PWJA 4BIKA 8FABA 1N6QL 4FL4B 4QHUB 3BSZH 1WAAF 5DJYB 3T6VA 2B15A 4NZTH 4PJIE 4YHMH 3BSZL 3SDCA 3EHBC 3IGAA 2J1WA 4IJ3B 4RX4D 1D5BA 4YHML 4QYOA 5LGHH 5ECJE 1HL4A 3QA3B 4LQFH 1OAZH 2NY0D 5LGHL 4LQFL 1OSZB 5MP6H 5FO7A 1I7ZA 5EUKB 3JWNC 3OXRB 5MP6L 1R5VB 1XB3A 4LPCA 5JHLH 3BUDA 2BCKB 4GAGL 1EFXB 3MRBB 2X89A 4LKCA 4AGNA 4YDMA 5JHLL 5JHDE 2NY7H 4BCYA 3W0WD 4G6MH 1YMMB 1EUVA 4MMZB 2NY7L 3QNXA 4AV0A 4XB7A 4G6ML 3L9RA 4FAAB 3WFBH 4UQ3B 1I9JH 2JKTM 3E2HC 1DVFA 5C0NC 1RZKC 4LL9A 4JQVC 4U33A 3WFBL 2OTPA 1I9JL 2ODIA 2VDOH 2B59B 3K72B 3RL2A 2O72A 1I85A 2VDOL 4ONGL 3RVUC 1NMCC 1X6NA 1NJ9B 2Z31B 3BFWA 3ZDXE 4MJJA 1G9NC 1KJ2A 2YRZA 3PP4H 4K7PY 1GL4B 2V2TB 1MWAH 3HS0B 2WXHA 3PP4L 3G6JB 1MWAL 5AAWC 1MSPA 2Q8AH 4HH9A 3K6SB 1WUNT 2JCCE 4X5PA 4Y9EA 3QFGA 2Q8AL 1A7QH 1HYSC 5CP3H 3U7WH 5CINH 2L7JA 3DSNB 4ONOA 3SGDH 3SYCA 4OZIA 3U7WL 3EFOB 5CINL 4PRNB 3L7EA 2IF7A 1QRNA 5HYSG 2Z64C 2V5RA 5EO0A 2V3DA 4Z7NE 2PF6A 5FYJD 3D48R 1BOYA 1KBGH 5KW9H 4F33B 5D7JB 1SMOA 2FJGB 1XF5B 1KBGL 1TG8A 5KW9L 2O1AA 4NGHH 5BZZA 5GSVB 4TTDC 4U1KA 3FU6A 3P9MA 4NGHL 1UKTA 1JZ2A 2H0EA 1N0LA 5AB1A 3NGBC 5CMAB 1RULH 1SLUA 3NABL 3DTXB 4EIGB 1JCKA 3AU1B 4XX1E 4JJOA 1M42A 1WAAA 3SDDC 1ORSB 1MDAA 4DETA 5K9OB 4WZ9A 4M4RB 1O5DT 1GJWA 1OGAE 2GITB 3RGVB 2QEJA 2OPCA 1PBYA 4RLDA 4AH2A 3LNEA 4MA3A 3X17A 1HJCA 4O2CA 4PJ9C 2XN0A 4M61A 3NQIA 2BC4B 1OE3A 2V2WA 4NT6B 2VXUH 3F0ZA 5ECGA 2CPUA 5DHYB 5E6RB 5AAMC 4NO2A 5F96H 3AWEA 1LE9B 2WWMC 2EO7A 3PIQA 5F96L 5E24E 3LS5L 4GXUN 3VXRD 1A9EA 2YRBA 1CUOA 1NGXB 4QXUH 4QXUL 4XN7A 4DULA 3HB3B 4QDGA 5LAPA 3IETB 3AS1A 5E94A 4KXZH 4G5ZH 2DYRB 3VQMA 1I3VA 5ACLA 1ETZB 4NQEB 4V2BA 2EH8H 3OZ9H 5E4OA 4X42A 2Z4QB 4EN3C 1VDGA 2BSRB 1FDLH 2EH8L 3OZ9L 4HHAA 1QI3A 1IZJA 3ALXA 2PN5A 4D0DB 3PFQA 1FDLL 3GHPA 3VGBA 2W65B 2PCPB 3EF4A 4AUJA 4LNRB 3EJQA 3CXHJ 3T0ED 5HYSB 5DVPA 3ZYOA 2F54D 4TN9A 4MDJB 1XO8A 5HSHA 2LLGA 1QQDB 1MCBA 2JHNA 5E1QA 4FL4C 5BXFA 5FUCE 2A83B 5F9DC 1TDQA 3K71B 5KTEH 2CD0A 4IJ3C 5KTEL 5B39G 4BFJA 1EVUA 1VCBC 5C92A 5KVEE 4PM1A 3ESOA 2NOZA 5TDPA 3B1UA 1P5UB 1C9BB 1FUNA 4HIIB 3LH2H 3J7HA 5F1IA 3KEDA 2EZ0D 1YMHB 4R4BB 2BOLA 1Q9LB 2QSTA 5TQ2H 4BFGA 2F8XC 1U8MA 1KTDA 5LG6A 5TQ2L 1XCQA 4IU3A 2F08A 4MMZC 3WL9A 5EG6C 5DJ6B 4CL7A 3RNQB 3QQ3A 4I0PB 5FK9A 4U1HA 2EDTA 4GI9A 1M53A 5CLWA 5L2KE 3H53A 3MV01 5EU5B 5DURB 4OSUH 2Z31C 4A7TA 1Z7JA 4OSUL 4S1DC 4YL4A 1ADQA 2DS4A 3LPGA 3HS0C 3QJRB 2MQCA 2YQGA 4EUPA 1KSRA 3VXSA 3OKKA 1L9MA 3CFQA 1JYXA 2IDFA 2DYSB 4X7TB 4QXTA 1IILE 4GYBA 1T6WA 1MW3A 1ZHBB 1SBSH 1FQ9C 1L7TL 4X50A 1GJIA 1BWMA 3MLUH 2OA9A 3IBEA 2OCFD 3I50H 3MRQA 3MX0B 5C0CA 4GO6B 1SBSL 2DB8A 1THAA 1ED3A 3MLUL 1BSIA 5IBLC 3GF8A 3I50L 3ZKQD 4M7JH 3FRUA 3DDGA 3FT0A 1BXXA 4M7JL 5KSBE 3RWEB 3VXOB 3BMVA 4JFFB 1ZHNA 3UAJD 5JIDA 2QLVA 1EZSA 1NC2B 1PEZA 2E6JA 2FHFA 5D7JC 1L3WA 3IJEB 4NPYA 4QRSA 2RIKA 4NOBA 4WFED 1E28B 1YAIA 3P9WB 3BWUF 1ID5I 4PRHA 4YPGB 4LSVL 4X6FB 5CFAA 1YUKB 4RMUA 4HK3N 3DPBA 1PQZA 3OAZK 1GGYA 2F53B 3U6RA 5CU9A 2D3NA 5F3FA 3SNSA 4ISVB 4Z78A 3FPXA 5A2AA 3ULVF 3KRMA 3AT9A 5EIQA 2XVLA 4BKTC 1KPRB 1Q0YL 3ECUA 2A0LC 4GQPH 4HUWA 5DRWB 5B39B 1JNHB 2R39A 4FG4A 3RGVC 1S5IH 3C5JB 4G8GA 2A6DA 3WI9A 4WKXA 3N1FC 2P8MA 2ARJA 5IFJB 1S5IL 3DBXB 2DEWX 3D5OF 1KPUA 4X6BB 3VFOA 2G9KA 3RTQD 3G6DH 1XBDA 1OP3K 3P3TA 3SKNA 2VTFA 1AC6A 1DE4A 1GIGH 4TMPA 4PG9A 4HJEA 2XIDA 2JQAA 5I6PA 1GIGL 2PPAA 5HDBE 1YN7A 3IGFA 3Q44A 4KJWC 5FGSA 4XMWA 5AN4A 3MRJB 3BEVA 3KR3H 5HYEA 1ITBB 1XIWC 2X4TB 3MNWB 3HPLA 3HN5A 3KR3L 4S0HA 1VEPA 5DK0A 3HZMA 3HB3C 4ZPTA 2IQAA 5AQ0A 3HZVB 2VN6A 4Y4HD 3LRHA 5F97E 3MJ9A 3T77A 4XVSH 2CHZA 3U4BH 1YC8A 1ZMYA 3R7QA 3HZYA 4HKZB 3U4BL 4UF7C 5J1TC 3X1EA 4AMWA 2GI0A 3FU8A 2YPVA 2XG4A 1XZWA 3IMWA 1QTPA 2KLRA 3DX7B 4P2QD 2D7TH 5F0JB 5AZUA 1YY9C 3Q2CA 1N7MH 1QHPA 2D7TL 2V5SA 4FZEH 5GGTH 1H8SA 1N7ML 4FZEL 4IMKC 2PW1B 4OCNC 4ALAC 5JYLA 3OQ3B 5GGTL 1FFPB 1MRFH 3MCG1 5ABZA 1EDHA 1PYWA 4G59C 1MRFL 1FO0H 2IPUK 4JFYB 1RK0B 3UBFA 1FO0L 3EH2A 4QHKI 3UTSB 1P5UC 2B16A 4X0KB 5D2LB 2F7PA 3KCPA 3BH4A 4TUUA 4GAAA 4RBPH 3B34A 5BO1H 2FGTA 4XNMB 1S6NA 3HS8A 5F21B 5BO1L 3QZMA 4X80H 2DL9A 4FQPA 4XGZB 3B7YA 4NHCH 3KYMB 4PP2B 2CO7B 3A4EA 5IMMA 2WYTA 4PJHF 2R0ZH 3BCDA 4NHCL 3GMNB 4F5CE 3TO2B 1MLCB 3BD4A 4RFEB 2JJTC 4I0PC 4AZUA 1KLFA 2XZZA 4PTUA 4P5MB 5DU7A 4D7RA 3FCGA 3GI8H 3L95A 1NUFA 5SWQA 1A6VH 5EV7A 3GI8L 4APQD 5BQ7A 1T89A 3CHOA 3U46B 4QY8A 1A6VL 2R1WB 3AXIA 5BJTB 3N44B 5T1JA 1KDJA 4DUWA 4NQVB 4LAQH 3RGHA 2W59A 2ROYA 3S34H 2P5ED 1A4JB 4LAQL 2WO2B 3SGDI 4XNDA 1M3QA 2Y07H 3S34L 2AAAA 2AV7A 4LSQH 3UEZA 2Y07L 2QR0A 2IV9A 4HK0A 4LSQL 3L5WA 3D2UB 1BXVA 1T6BX 3OKYA 2AANA 4XWOD 3VXUA 5EO1A 4LNVA 1C9SA 4RISH 4FFVD 1FSKC 3T3PB 4C4KT 4JFZH 4JFZL 4QCIA 2D31A 5CSBA 3QYMA 3DIVA 2B77A 4ATTA 2FGWH 1T6AA 3CWAA 4PGEB 1A7NH 4O02B 2HSIA 2FGWL 4M1CC 1PCXA 1A7NL 2AQNA 1MXGA 4UT6A 1U3HD 2FIKA 4QRPD 3ULUD 3ESUF 1KO9A 5EZPA 5I1DA 2BDNL 2A6IB 4JFDD 2ICES 3DX8A 2I5WA 3SCMA 2NW3B 4ZMXA 4FNLH 1NUGA 2QADB 2X4UA 4A6YH 4HSQA 4FNLL 4OM1H 1BOGB 5HHOE 4A6YL 1MNNA 3EBIA 4OM1L 5FO8A 1P9MA 2JXMA 4H25A 1S7RA 3L8QA 4TS6A 5T3ZH 1Q9OB 1ZGLM 1I1FA 4BXVA 3KPSD 5DMIH 5E95B 5T3ZL 5B8CB 1L6ZA 1X5XA 2BK8A 5E5MB 4KDWA 5AYUH 2N3JA 4JRXA 5EU4B 1AR1B 2K70A 5JIPA 5AYUL 5SWZE 4NO3A 3FB8A 4KXZI 4FLRA 5ERWA 4KVCH 2BY0A 3CQFA 1I8MA 2FO4A 1SOKA 2VZOA 4MD5A 1R1CA 4X99B 4JFEA 4JFQA 4KVCL 4MAYD 1P1ZA 3FQYA 1QSFD 2NX5B 4L3CA 4XN9A 3FQUA 4GKZA 3QUHA 5AVXB 5C0AE 3GBEA 4YFEA 3SJVB 4YHLH 3O2VH 5K5YA 3GSOB 1ACCA 1KV7A 4YHLL 3O2VL 1NBVH 3DXAE 2VDKB 2Q7YB 4PJCE 4KJYA 1NBVL 2WLIA 1VPOH 1L5GA 3SZKC 1XR8A 4BFIA 4UTBA 3U0TA 3NP3A 4Z6AT 3RURA 4DP9X 1VPOL 3IT8D 1AANA 2E86A 1AYOA 5CZVH 2BIQA 1X9LA 1VZHA 3MCLH 3B3BA 5CZVL 1EDYA 2VSDA 4XPFH 5AYQA 3MCLL 2W38A 4XPFL 3GSNH 1UD6A 4Z7QE 4FA6A 4QTIH 1IJ9A 1LMIA 1T0MA 2R29H 3GSNL 4HUXB 3FUDA 4ZTOL 4QTIL 5F7DA 3HR5A 4NKMA 3MN8A 5BS0D 4AM0Q 5JHBA 2PW2A 2EEXA 3QUZA 2FJUB 5GGRY 5C07B 3UTZB 4AY0A 5I1EH 1I9EA 1J9QA 2XVGA 5I1EL 2CJ3A 4X4MA 2M1KA 1DVQA 3ESNA 3PWPB 1T03H 1IC5H 1TLKA 2MMXA 1E30A 1G7MB 4K5PA 5JLZB 3BSZA 4LLDB 1IC5L 1T03L 4Q6IB 3QUMB 3RWCA 3WHXB 1NH2A 1Y6MR 1GTNA 2DJMA 2YGPA 4OKVB 4HH8A 1UB6B 3MJGX 2H45A 1ZLVK 4J3TA 3FFDB 3O41B 5GIRB 4ACTA 2HG5B 4OFDA 2A73B 4DP1X 2GPZA 2OMYA 4U1GB 4GNKB 3BVNB 3B7UX 3JWNH 1QX1A 1T5XB 5H35B 2ENQA 5I6XB 5ISZB 4H5SB 1U8HB 1J88A 1F56A 2YMXH 1IM9B 3EOBA 2ZXAA 3FTGA 2YMXL 5GRJH 4HUUB 4JUSA 1P5VA 1VEOA 4FQ2H 4UZGA 5GRJL 2Z35A 1VOLB 3TFKC 4FQ2L 3SBPA 2P28B 5CSZA 1CL7H 1RZKH 3U2JA 1CG9B 3STBA 1HDMA 1N9PA 3GXPA 1ZOXA 1CL7L 1RZKL 1B0RA 1Q0EA 3QI9D 1J0KA 1MWAA 3MSPA 2GTWA 1G9NH 1QSEA 2GHWB 2NSQA 3IFLH 3ZU8A 3VI4E 3VSTA 1G9NL 3T3MB 2IAND 3IFLL 2NLVA 3EAKA 5CEXB 2EYRB 5CP3A 4LCWD 1WD9A 1R3LA 3TGXA 3LXBA 1TBAB 4IMLA 3IDNA 2MKLC 2FQEA 4PBVC 2MOQA 2BP8A 1AZUA 1BZ7B 5IW3A 1XD1A 1PY9A 1WS8A 2A2QT 2O5ZH 4KXAA 1L9RA 4JW3A 4NZDA 1RZGA 5MEQA 2O5ZL 1S7SB 2C7UA 4NNXB 2MEJB 2QADC 2F5BH 1MPAH 3F8UB 2F5BL 2AK4D 2DWYA 1USZA 4XH2A 2AERT 2AQPA 5HGDB 5HBBA 5G4MA 5INCB 3UGUA 1FFQA 2VLKE 1ZVSB 4Q52A 1TPXB 1QSZA 3KH4A 3S36X 5B8CC 4BXSV 1YLBB 3EBAA 3MMEB 3TU6A 4GUPA 4EPSA 3MRLA 2JTYA 1AR1C 4QGYA 3LXCA 1U8PB 2GK2A 1A3QA 4FERA 2EC8A 1OP5K 5AB0A 2W1NA 4TNEA 3S5LG 2Z7ZA 4KKAC 3D3VA 3GSQA 1A3LL 4X4YB 2YC1B 1SJMA 2WIIA 5HGBA 1T20B 4R4NC 4KROB 4X6DE 3VGFA 1BM3H 3KPRA 5ELIA 3OR6A 2BLFA 1G9MC 5G4NA 2FT6A 1W72H 1BM3L 4O00A 5CGTA 4G3YH 3D4VA 4NP4H 2MCPH 3LZLA 1MCSA 3BKMH 4G3YL 4NP4L 7TAAA 1JYVA 4B9ZA 2Y6SD 3BKML 3H0TB 4OGAD 1WISA 4I9XA 4TXVB 4KRPD 3CC1A 5IROC 3ZO9A 2KZKA 5TDOB 1WAEA 3LZRA 1SXBA 3PL6B 1BVNP 1T66D 1RUMH 4W9ZA 3ZE2E 4P4KD 4N20A 4PD4J 3MO1B 4MS6A 5IB2A 5JHDB 5FGCE 1KIPA 2C9QA 4G7YH 2D4DA 3MCKA 3QNYB 2WNXA 2CGRH 2HFEB 2UY6A 1T80A 4ABWA 4ZRGA 4E9QA 2CGRL 3U9PL 1NCDH 1ZHLB 3BDXA 3L45A 2XKSA 4JG1H 1NCDL 4TL4A 3RFRA 3KXFE 1NGZB 4JG1L 4CBPA 3FAWA 3SDXE 3ZDXB 1S5HB 2E4FA 3L5IA 4M9PA 5JQ6L 2G2PA 1OCWH 5TH2B 1IUZA 4UQ2A 1GR7A 3QUYA 5EBLB 3GLZA 3VRLE 1UXSB 3NG5A 4K7FA 1OCWL 3TESA 2OXGB 1IL1B 1B0WA 2JCCB 3GMOA 25C8L 2DWDB 3AM8A 3MREA 4Q6IC 2XWCA 2ICWI 3T4AA 4WK2B 4JPSA 2G0LA 4LBEB 4KKNA 1HCVA 4GP4B 4WHDA 3WEOA 3W38A 4E9YA 2VLMD 3BRDA 4AGQA 4O58H 4U1GC 4AW7A 1I1AB 3CHSA 4LPWA 4Z7NB 4O58L 3WKNA 3HBGA 3S88H 4PBXA 1KJMA 5I6XC 3S88L 4WLCA 2ADGB 1ZJBA 1J1PH 1ZT7B 3OKEB 1VERA 4JVUA 3S5LB 1J1PL 1K8IA 3OSEA 5KS9A 3E38A 1UWFA 4N90D 3N50A 2CDGB 1RZFH 2H6OA 1T04A 2ZP8A 4XNQB 3NSCA 1NPUA 1RZFL 4UQEA 3FSOA 5AB9A 3G5YA 4YO0A 3TT3H 1PD0A 3QNZA 3U4AA 4PRPB 5D7SH 1PZ5B 4CSPA 1XGTA 4L8CA 1OGAB 3C60B 4N86A 5D7SL 4L4JA 3M7OA 1ZSDA 4OLZH 4JPVH 3UYPB 3SKJH 5C8JB 4OLZL 5E1HB 2WXKA 3VCLB 2AJ3A 2YFNA 4DW2H 5C1MB 5CCJA 4HFWA 4JPVL 3SKJL 1AAJA 3Q8EA 3VDAA 5B3NA 4DW2L 5H8DA 2DM4A 1SOQA 4E0RB 3AUVA 3RWDB 3F7KA 3PGCB 2D3JA 2VDQH 2KQMA 5I82A 1WG3A 1TVBA 3ABZA 5CJ8A 1N18A 5IQ9B 3HCVB 2DICA 1HT6A 4ERSH 4N0CD 2WQSA 4FCAA 2FJHA 4ERSL 1O7SA 3TS8A 3KW8A 1KN4H 5C7ZA 3VRJA 2ENSA 1P53A 1KN4L 3PP3K 2LVCA 3DMMB 3ELAT 3O6MH 1CICB 3HS9A 5C9KA 1TPXC 5FKAB 5B3JF 3U1QA 2V9RA 5EZJA 1V7MH 5EF0A 5ESQA 3MUJA 1V7ML 2E7DA 3S5YA 3NZSA 2WXJA 2CJSA 1LTXA 2EABA 2E74C 1VKLA 5D1XA 2J5WA 3K8MA 1K85A 3U79A 4APXB 5IYDP 1R17A 3TEUA 3C6EA 3D09A 4TUOA 3VFUA 4Y4KA 4DPBX 2BRQA 4KROC 3SYPA 1OHZA 2ZUQB 5CXPA 1FNSH 3IXTB 2B5IB 1WV7T 3BLBA 3KLAA 1I4FA 5E6YA 5F71A 5GZNC 4AVKA 1FNSL 4GRWE 2FYYA 3LX9A 4ZMNA 4G8IA 1T3FB 3EGDA 3BN3B 3KBHE 1BQLH 1AHWB 1NGYB 2XQ0A 3UP1A 5E8OB 4U1MA 5AALA 3ILQD 1DQIA 3PL6C 4K9JA 2Q7NA 3AZUA 2XU9A 2D03H 5DMGC 4J3OF 2P1YA 5JMOC 2HVBA 2D03L 3VAEA 2BSED 4J6RH 4P2OB 4RSYA 3HG0A 2DIBA 3G5ZA 4J6RL 4LPTA 4PJ7A 4J3BA 3PWLA 1I7UB 3GI9H 5HYQB 5IMKA 4WI7A 1D3UA 1PL3A 3GI9L 1UURA 5DSCB 4HIEA 4PJFF 1AG0A 2A74B 4JHVA 3PF2A 4FHJA 3TNMB 5FEBA 2J3SA 5C0BB 3WJJC 5L2KB 1Z66A 4AQ1A 2R2EB 4LP4A 4PWIA 1A4BA 5FW8A 3H7BA 4RGND 3RBGA 3IDXH 3BH8B 4FZ8H 4PY7B 2H4LX 3IDXL 4FZ8L 2VIRB 2ZUVA 2PCXA 4JZNA 4DP8X 5E9AA 4ZFOA 5HJGA 3CTTA 1RHFA 4ALAH 2H41A 5IJDC 4AYSA 3EBHA 1J87A 2CKBB 1FO0A 4ALAL 1RMFH 1KY7A 4C56A 2YFOA 3LN4B 1S9WA 1RMFL 2QREA 1WWWX 3TIEB 4ONHA 5K59E 5KSBB 1I1AC 1UD8A 4WW2F 1R0AL 1QFWI 4LLVA 4OFQA 3H85A 3D39E 2HJFB 1KGXA 4YMPA 1GZHA 3MRFA 3CZEA 2FUTA 1K9TA 4WDIA 3D0AA 1V55B 4JPKH 2WSPA 3QEQA 5JO5B 5JN5A 1NDGA 4JPKL 4CVUA 4OV5A 2WLHA 2ICWA 2Z1KA 2A3TA 3QDMA 4GEIA 1S9YA 4AEHH 1QWUA 5C08A 1K2YX 4AEHL 4LLYB 4HZ1A 1PG7W 2XBDA 3L9BA 1OW0C 4WVRA 3HHMA 3HOGA 3S96B 1KF9B 4GBXB 4WEBH 4FTVA 5ANME 3C60C 2QMKA 4WEBL 3LRSA 3FTVA 3QZWG 3KGUA 4M6OH 3RKDC 4FI6A 4HIJA 3REVA 2JJVA 2P46B 3AS2A 4M6OL 4AMXA 3KYNA 5DJ0A 1P0SE 4N26A 2D9CA 1BX2B 1DBBH 2Q6WA 1DBBL 4ODXB 3C5XA 2Y22A 4GRMA 5HDBB 2JQZA 4JMNA 4U1SA 4PJFA 3E9TA 1MHHB 3HAEA 3HLAB 2X87A 1EJFA 4LOUD 2AVGA 2P3YA 2IFFH 4NO0A 3RQ3A 3NZHH 4JFOA 2J1KA 3FQRA 3BKJL 2IFFL 3HPJA 4YAQB 3NZHL 3QQ9C 3AW5A 2FHBA 4PRIE 4ZW8A 2EICA 3DMMC 1KLGA 3GXMA 2Q8BH 1CICC 3P77B 5KWYC 4OI8A 1QATA 5EFIB 2C26A 3ARFD 2QSQA 3Q5OA 3HZKA 1NCNA 1HK6A 4P46A 4Y1TA 5BO0D 2MPAH 3MV7E 4WWNA 4YHNA 4ADGA 3IDMA 4JKPH 1OGPA 4Y7MA 1FWXA 2MPAL 4H8PA 1IFGA 1XL4A 2IH9A 3FT3A 1LK3H 3QJTB 4JKPL 4AUYA 2B4CC 1LK3L 1S7UB 1L0YA 4E9TA 4WW2A 2ZUQC 2R15A 3P4MB 2B5IC 4G7VH 2VZ3A 4NQSA 4WHTA 2KPNA 1E2VA 4AVIA 3TIDA 1NOAA 4G7VL 1QOKA 5FUCC 4GG6E 1XF4B 3QIBB 5DCCA 1RJLB 4HJ0D 2V7NA 3TH2T 3UADA 1AHWC 5KANI 2FD6H 3FTWA 3D0VA 1MUJA 5GS1A 4AKOA 2KQNA 4LEOA 1BJ8A 4OD2A 1U92A 3V0VA 2ED6A 5FCUH 1CQYA 1GTFA 5EDSA 5GRYA 3X1FA 5FCUL 1BJ1J 4P2OC 1DQDH 5F7YC 1WDAA 4PH8A 4NCDA 1DQDL 1IAKA 1JFIC 3MHZA 2HN7B 4I13B 5D70H 1UXLA 4YN3A 1OEZW 1GMIA 3QZWB 5D70L 5FLUA 5GRZA 1UXWB 3WY3A 5BOPA 3O3AB 5AW3B 1INQB 3V0GA 4OIIH 5L4JA 5DS1A 1I8IA 1X5YA 3I2CL 3MKKA 3VH8A 4OIIL 3MJWA 2DD8H 3IDGB 1E5ZA 1D7FA 1LK2B 1NFIA 1SN2A 2BERA 4F15B 3L7FB 3QDGE 3AG3B 4YSPA 3KLQA 4NERA 2WHVA 3GFUA 4R7NB 2IMMA 1KG0B 4XE5B 1ZSHA 1HX0A 4F3FA 2EUZA 4MNHB 5E5UB 3GSNA 1IEAB 4KKQA 3VSUA 3RZCA 3NCFB 2R29A 1DUZA 5T1LB 2BIPA 4JRWA 2NPLX 2QGCA 3RB5A 2FX7H 2CDFA 3VFVB 4KQ3H 2ZX9A 4AIZB 4XMUA 4N28A 1XSIA 1HESA 2FX7L 4KQ3L 2GCYA 4W9KC 2AXGA 4ELDA 1E9QA 2JIXA 1SN0A 3CLFH 5IHZB 2WNGA 4JCLA 4LCCA 3CLFL 1NDMA 5DJXB 3D4ZA 4F2MA 4F8LA 5B3SB 1VZIA 3ZRSA 4PSPA 1NWPA 2L7QA 5IFAH 3LKQA 3ASOB 2HJKA 3KBPA 2G9HB 4MX7B 2FTAA 4OAWB 5DO2D 5IFAL 4XP1H 4GIOA 5HD8C 5EN2B 1LGVA 4XP1L 3F84A 1UH4A 3DOSB 2BNQA 5F88A 5EN3A 4GBXC 4ELME 5MEND 4CUCA 5E70A 1ACXA 3C6SB 1EBAA 3QJSB 3Q6FB 1QFWM 4KKBC 1IM3B 3L3DA 3RWGB 3BAXA 4WI4A 3EJYC 3T65A 1H0DB 2BHZA 5KVFH 2X4SB 4LLQA 1LM8V 7FABH 3WIFA 4JQVA 4Y5XB 5KVFL 3DV4A 4P2RD 7FABL 3IWVA 1QN7A 3LEYH 5DC2A 2EE3A 2NXZD 3Q2VA 5SWZB 3X12B 1TJXA 3LEYL 4UMSA 4MAZA 5D7HA 3BQUC 2VKWA 2WYIA 2BNRD 2YJLA 5AAWA 1P4BH 3QXDB 2WWOA 1P4BL 4HGWA 3AS0A 5I18H 5DDHB 2G4GA 2KKQA 4O02H 4TUJA 2ZPKL 3BUYB 2FWOB 5I18L 1XAKA 5C0AB 4PJ5A 4O02L 5DJCA 5E6ZA 3I6KB 2G75A 2O3OA 3NSJA 4I89A 4M8UA 3DXAB 1U8IB 3QK0A 4NO5A 4PJCB 3TF4A 1LO4H 2NOEA 1W6WA 4MNQD 2Q86A 1ADWA 1LO4L 2OMWA 4NM8H 5HHVH 2P7TA 3T04D 3BWZA 1E5YA 2DYPA 3ZL1A 5HHQA 3F62A 1P1VA 5HHVL 4MQ7B 4PY8I 5EOQL 1L3NA 3FT4B 3MJ6A 4JZOA 4N9GB 3MLYH 3ZHLA 3QQ4A 1M2VA 4HEPA 4M5TA 4OTXH 3MLYL 3RIKA 7PCYA 3LH9A 5C0FB 3WKMH 4PJ6A 1C7TA 4OTXL 4Z7QB 3DIFB 3WNOA 3WKML 2IEPA 4OZHF 2YK1L 1A6ZB 1OO2A 1MELA 4H26B 3Q9PA 3VE0B 3B2VH 2Z8WC 4CKQA 9PCYA 3GJFK 4B9GA 2BVPB 2OSYA 4BZ2L 1XH3A 3B2VL 3BPLB 4F7PA 2Z4TA 4QRUA 3SDAB 1T1XA 5IEHA 1RZQA 2BP0A 1I3GH 5EIIB 4QTFA 1JUFB 2EIEA 4V1DD 1J10A 1I3GL 2ED9A 1GKEA 2ILLA 3D7PA 4PJ9A 3HG1D 1W72A 3DO3A 2YOAA 4DPCX 1G9MH 5C0ND 5DEGA 5EBMA 5K9KB 5SX5K 5DJDB 1G9ML 1YY8A 5AAMA 4ZMAT 5HPMB 1DQJB 4WWKB 1RZIA 4JANA 4ZAKB 4XE0A 2VDKH 5CR8A 1YNTB 2YEQA 3EJRA 5MEPB 2ENJA 2VDKL 4ZFZA 1F6FB 1MCWM 2AJUH 1OB0A 3N85H 4F15C 3EO1B 4GW5A 5C6WH 2AJUL 1BJ1H 1S7QA 2APTA 3N85L 5AVWB 2IPUG 1H9DA 5E8DH 5GRXG 3WNJA 2V9QA 5E8DL 2ZOTA 2BCMA 4Y1AE 1AO7D 4ZX6A 5DI8A 5HYJD 2YWYA 5AZEH 3OMNB 2CBQA 4FLSA 3FQNA 5AZEL 2XN2A 1QN4A 5FB8B 2Y5QA 3S2CA 3TBVA 3S36L 3PWVA 1SDDB 2CHWA 4WFHD 3WDHA 1N5AA 4FFWC 4NBYB 5KYXA 1RLWA 2LLLA 4AX3A 4TTDD 3BDYH 1JK8B 5AYTA 3BDYL 1QN9A 5B21A 4UQIM 3VI4B 4N2GA 4P07A 3L3OB 1B3IA 1ZD6A 3CWGA 4KTYA 4X9FA 5IHHA 2OYPA 4FHBD 3QUMH 1DFBH 2YQ3A 3SDDD 3K4DA 3CHPA 4QOKD 3QARA 3QUML 4IRZA 1CWVA 3FTYA 1DFBL 2BINA 3JTTA 1S7VA 1CD0A 3QA3A 2QHRH 4HEMA 2E3VA 4Y89A 2FEJA 1LEKA 2WB7A 2QHRL 5EUKA 5F6IB 4F7CB 3PCYA 3MQIA 3OXRA 2OYLA 2Y5TB 5T5FH 3LJ3A 4UIMB 1TZHB 2BCKA 1EFXA 2VABB 2A6KA 4XO9A 5T5FL 3AMKA 2CIKB 4LHUA 2HA1A 3MZTA 4LZKA 1IV8A 5J6GB 3AT8A 5L4MA 4KMTH 1YMMA 3BYYA 4MMZA 4BH8B 4BQ6A 3CC5B 1ND0B 1QO3A 3D34A 5C86A 4PV1C 2W81C 2VLKB 3ESVF 2HVKB 4Y5XC 1PD1A 1R75A 1ZVYA 2B59A 3K72A 3O3DB 3S3JA 2PR9A 5DZ9A 1OE2A 3GINA 4Y2LA 2Z31A 3EDFA 2QV4A 1W6LA 2BXZA 2CNZA 3HS0A 5CLYA 1OGSA 1IIKA 3G6JA 1BXAA 2AABH 2X70B 3ROOB 2JNZA 5IW1B 3V4UH 2IXQB 2QV2A 2AABL 4Z1PA 3V4UL 4X6DB 1KIRB 3LS4H 4EN3D 3DSNA 1K3ZA 3QDJE 4J3SA 4LL1A 1HZLA 3FB6A 3KWWB 3LS4L 3K6NA 3UABA 1H3UA 1AQHA 4LB8A 4KUCF 4CC4C 2EDFA 3O45A 5D2NE 1ML0A 3KPTA 5D4JA 5A6IA 3Q6GH 2VZ1A 4RDQG 4FA7B 4F33A 5D7JA 3GB7B 4U6YB 2FJGA 2G30A 2WLMA 2DV6A 3DROA 5GSVA 5EZIH 4W9GC 1KWKA 3K46A 4U6HB 2WMPA 5EZIL 3ZE2B 3W0WE 3KTUA 2KS0A 5CMAA 1LHZA 2QDWA 3EZ8A 3LOWA 1ZA6B 3ASWA 3L1OH 5FGCB 1CGTA 3AU1A 4ZSOA 3QRGH 3BGMB 4ZMOA 2IDUA 1IGYB 2HUHA 3L1OL 1A1NB 3MNMA 5D4QA 1JWUB 3F7RA 3QRGL 1ORSA 4FYRA 5CJXC 2J4WH 4CGTA 5I0VA 3VA6A 2NOHA 4M4RA 3B8SA 2OMVB 5FV1L 2J4WL 3D69A 3NZUA 3SDAC 3ALPA 3CBJB 3U0PB 2HTKC 1X9RA 3KXFB 1A1OB 4TQ8A 4E41D 3SDXB 2AQQA 1XF2B 3E8UH 3ME0B 3GHEH 2HLEB 4WHYG 3QULB 3BD5A 1A6PA 4KUZH 4KWUA 3E8UL 3GHEL 2X0WA 2BC4A 3FMGH 4NT6A 3L54A 4E9RA 5KBKA 1NKRA 3FMGL 5DHYA 4BFBD 1ROCA 2NZIA 3BLKA 1BZ9B 2DM2A 3V79C 3KS0H 2ESVD 2MTPA 4N0UA 3MJ8A 1TXKA 4WWKC 1Y18A 1LE9A 4LPXA 4ZAKC 4QRQB 1V5JA 1JZ3A 1CXIA 5FYJE 1F58H 1XIWA 4NDMB 4JO1H 2ZWNA 2ADYA 1F58L 4M1DL 3CAFA 2R4SH 4JO1L 2ZG3A 5B1CA 2ARWA 2R4SL 3DVFA 4EDWH 3ZK0A 4PLNC 4NKQB 4QKTA 5J6HB 2DQFB 2X38A 4EVNA 3KVQA 2Z4QA 4ZUVA 5CU5A 2R7EB 2BSRA 3O9WA 3QWRA 4JLRB 5EUOF 1H6EA 1A47A 4P99A 3WTSA 2P5WD 4UILH 4LNRA 4G9FB 1RCYA 4UILL 5ESAB 3FH7A 1CDYA 1PGRB 2WCSA 4W4OC 4FADA 5HYSA 3VQ1C 3ZKXB 2FLBT 2TRYA 2NY1B 1QN6A 4QTHB 3LXUX 3EADA 4PV9B 1IAOB 2N56A 5DHMC 1QQDA 1MZZA 3L3OC 4IMKA 4UAOB 3LHPH 1YEHL 5DQ9B 2ZWYA 3V0DA 1KT2B 3FYEB 4PTTB 1ETA1 4OLVH 2NZ1A 1QW8A 2NYZA 5DUPH 4OLVL 2A0LD 4HV8B 1A4CA 4U1IB 1S78D 4UV4L 5DUPL 3S8FB 1PSKH 3CFDA 3RPJA 1ZLWH 4YDJB 3GDCA 3RGVD 3VXRE 2GW5A 5LDUA 1PSKL 4TNGA 4ZOEA 1IBGH 1OKEA 4DF9A 1TYRA 2PTVA 1YMHA 4R4BA 1IBGL 3S35X 3L4XA 4X6CE 3EJUA 4N8PA 5DJ6A 3W56A 4NXSA 2JJTA 3RNQA 1ZT1B 2H3NA 3MBEB 5DR5L 4P9MH 1NFAA 1A21A 2ITDB 3V6BR 1U58B 5AKSA 4P9ML 3G04A 4FQXB 4OIAA 5D7LE 2V37A 1CD9B 2Z9TA 3KBEA 3EYQD 2J6WA 2F54E 3DGCR 2WXLA 5BPPA 4TM9A 3R8QA 4NQED 3W1ZA 5LN8A 1HWGB 1B0IA 2FJFB 4R84A 1C08B 1KYDA 3MX0A 2VQ1B 4JE4B 4ABQA 5E8PA 4J3UA 1OM9A 4GRWB 4K2UH 4JPIB 5CSGA 3D06A 4K2UL 3RWEA 1QNAA 1T4KB 3SKUD 4AUUA 3C09B 3ISWA 4ZS7L 1PF3A 3FDWA 2YBRA 3IJEA 3PPSA 4GOSA 4PJAF 5I8OH 1FP5A 4QRTB 3ASMA 1G4RA 3LCYA 1JFHA 1E28A 1G1KA 2HUEA 3DGGB 3WNMA 3PXHA 4HGMA 5I8OL 4UCFA 3TEZA 3MGOB 1VACB 2K9FB 4N85A 2VITA 5HI5D 2XWBA 5IESH 4C4UA 4BSJA 1PD6A 5I5RA 4AM0B 5IESL 3HG2A 1DFXA 1KCRH 1P4UA 4CBZA 2D0AA 4ZNCD 1C47A 5DRWA 1KCRL 5B39A 1JNHA 1FE8H 1NOFA 2FNBA 3FTSA 2O26U 2B4CH 3HUJF 5A2LH 1I82A 1FE8L 1PW3A 3CDZB 1FCCA 2B4CL 3DBXA 5EH1A 3PXLA 5F9WB 4N1EA 1JN6B 4I0PD 3K8KA 4X6BA 3N0AA 4Z3EA 4JN1H 4ZOBA 2C9PA 1AQDA 4HIHB 1CYGA 5F6HJ 4JN1L 2YSSB 1JI1A 1O7VA 1EPFA 3CFUA 5BRZD 2EYSB 1M05B 1KULA 3MRJA 3OKDB 4F2EA 5KVEH 1D7CA 3E3QE 4X7CC 3VGHA 2AGJH 5KVEL 1YECH 3GMMB 2GJ6D 2AGJL 2VMEA 4WFEE 4GKSB 1YECL 3ZBMA 3D39B 1WC7B 4OF3A 3RYMA 2CH8A 4UDTB 4GIAA 5EF3A 4PGBB 2ZOKB 3IU3A 4KGJA 5ENWA 3TN0A 1G1CA 4YBHA 3PE9A 3ZTJG 1SLVA 1XQ4A 5C09A 3B2UC 1UH2A 4BQCA 2PETA 4JFFD 4KV5F 1NC2D 3MRIA 3BP6A 2H2PD 2WN2A 1X9UA 2H5UA 1NCOA 1VFBB 3P0VH 3GRGA 2VISB 4M29A 1XGRB 3ZKXC 2NY1C 4F93B 1NAMA 1HL8A 3L6FB 2X4OA 3FT9A 3EAYA 3ZT5A 1G6RB 3RAJH 5ANMB 5TQ0H 2PW1A 1I7TA 3HC0B 1HU8A 1MI5E 2CO2A 3F64A 1FFPA 4UAOC 2F53D 5TQ0L 3RAJL 4XNYH 1X7SA 3KLKA 4M1CD 2CKBH 2EH7H 4NENB 5F44A 3I3WA 4XNYL 3EJZD 1BVLB 2B1AH 1RK0A 2CKBL 2EH7L 4OFKA 5EB9A 4WZSD 2B1AL 4UU9B 1QNIA 4X0KA 4XVUC 1TIUA 3P9LB 4KAQH 5DZJA 5K9QG 4JL2A 2DWXA 4Y9BA 4AL8C 3N91A 4KAQL 3V8OA 2UX6A 4XGZA 1SXAA 3QEGH 3ZKNC 3KYMA 4PP2A 2JK5B 4Y8DC 1LP9E 3QEGL 4TLSA 3KPQB 1D6EB 3TO2A 5I6OA 4RFEA 3DTDA 4PRIB 4MB1A 4PREB 2PWGA 4P5MA 3AQDA 5A16A 4E36A 3DPTA 3NRFA 2QKSA 4P3WA 4W9CC 4BWWA 1KWGA 4XXDA 5LCVH 4NUJB 3FN9A 3MV7B 4FQXC 4G80B 2A6JB 4A2MA 4DZ8A 1AQ8A 5LCVL 4JKKA 2HB0A 3NAAH 5BJTA 3TVMA 1DQMH 1UM6H 4P2QE 3NAAL 2XG5A 4PGCA 1UM6L 1A4JA 3SO3B 3BKCH 4BUQA 4D9QD 3D0LA 3L5HA 3BKCL 1SXCA 5DGRA 5C0DA 3T6WA 2VLRA 5F9AC 3CFJB 4R7LA 4DERA 1V8HA 1NCJA 2YD7A 2MSPA 1FA4A 1DANU 2V3EA 4O9HH 4GG6B 3CK0H 5AOIA 3V2AR 2V92A 2HKHL 1RPKA 4O9HL 1TTRA 3CK0L 2XNAA 1BFTA 4RRPG 3C09C 5A3IC 5JOFB 1T1WB 5IM7B 2VN5A 4LASH 3IDYB 4IDLA 3CMOH 3GM8A 1JGUH 2O6PA 4LASL 4W81A 3CMOL 3NTCH 4GSQA 1JGUL 5DD6A 2VR4A 3NTCL 2BW4A 3E9UA 4RMRA 2HT3D 2QVIA 1ERNA 4G8FA 3O6LH 5IVZB 2CR6A 3GSWA 2VL4A 5DVKA 2IO5A 4RA0C 1HWWA 3O6LL 4PGEA 4O02A 4CADB 3UTSD 1TCRA 1C16B 2KPWA 5HI4C 1CTOA 3DIDA 2A6IA 1D7DA 5EU7E 4KZDH 3U1PA 3JZ7A 1MCCA 4KZDL 5TF1L 1N59A 4QHPA 3Q3GB 3FOLA 2JI2A 2NW2B 5F9WC 1BOGA 3QDGB 3QO1A 4KKPA 5I24A 1Q9OA 5KYNA 3C9NB 1KB3A 5B8CA 3PV7A 5FWRA 2XWRA 3FB5A 3C8KA 3JUYA 5E5MA 4AQZA 2AKRB 3T0XA 2ZX5A 4O5LH 2XV6B 3EJJX 4CJ0A 4I1PA 5F7NC 2WN3A 4DEPB 2HPTA 2R56H 4O5LL 2XWEA 5FFGA 5H2BA 3KNBB 3KPOB 5I1AB 3WEXB 4GUOA 4JQXC 2R56L 3ZZ1A 4MVBC 1CN4A 3VMOA 2CU9A 4MXWL 4MZ3A 5ID0B 4HOWA 1SN5A 3FFCA 4X99A 4PPTA 1RK1B 4L3AA 4ZBJA 5EF2A 4WNQB 1AR2A 3D2UD 4FQLH 2NX5A 4OCWH 1EAPB 3VVVA 4WQOA 4FQLL 4OCWL 2LR4A 3QXTA 2YQBA 1QUNB 4HT1H 2ZUYA 4QLWA 3ULUE 3RIAF 4QRPE 3V9FA 3MRHA 5KJ4A 4HT1L 2OMBA 2PP9A 4UM8A 1IBDA 2Q7YA 3M17A 4JFDE 4Q4IA 5IROA 4KJQD 3P69A 1DN0A 2AXFA 2IDSA 4FKEA 5L8LB 3EH1A 2VL5A 1I53A 3BVUA 2XWJA 3TASA 3FU7B 3TWYA 1EXUB 1NEZA 4S1SH 4ZNEE 2DJUA 1AXTH 1LQSR 4S1SL 4P48A 4XCYB 3F00A 3KPSE 5AL0A 1J8HA 4WNSA 2DEXX 1GOGA 4IOFD 2R5XA 4JRYE 3SE9H 5KSAD 4GAYB 4JJHA 2GSGA 1ASPA 1BGXH 3GTTA 3SE9L 1CIUA 1BGXL 2YKLH 2KZBA 3T0BA 1CI3M 4M7KH 5DFTA 5C07A 4QNPE 4YSEA 1CVRA 4B5EA 1MLBB 2YKLL 3N41F 1G7LB 5L88H 4M7KL 1D5XB 1GYAA 4ADJA 5L88L 5KYUB 1WITA 5GS3A 1B9ZA 5DVNA 1LO3H 2WLKA 4XCCH 2QRDA 1KYOK 1LO3L 4LLDA 4XCCL 3ZR6A 4Q6IA 5C0GA 3RWJB 2X3BA 2R59A 4OKVA 1D9KD 2JJWA 5C6TH 3IJSB 5DHDA 1PJ9A 2KHAA 3FFDA 3O41A 2HG5A 4KDVA 5DVMA 5C6TL 2A73A 3DGDA 4FQCH 5E6IB 2YAFA 3SBWC 4WO4A 4LEBA 4FQCL 3BVNA 5T5FA 3RSMA 4EDXA 1X5HA 2PCYA 3B7RL 4WSJA 3UJIH 2DBJA 5H35A 1R5IA 2W0PA 3SO3C 4H5SA 4LSTH