1QTPA

Crystal structure of the ap-2 clathrin adaptor alpha-appendage
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C)
publication title Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly.
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 1999-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1qtpA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qtpA02
1MP9A 1QNBA 2D0BA 4BCXA 2A7BA 1PCZA 2G30A 4ROCB 1QNEA 2D0CA 3MNMA 4PY5A 1PZDA 1QNCA 1W80A 1OM9A 3ZHFA 4RODB 1GYWA 1QN9A 1KY6A 2DWYA 1TBAB 3H1ZA 1CDWA 1P4UA 2MJ7A 5CN2A 2IV9A 1QTPA 1NVPA 1NA8A 2IV8A 1R4XA 4ROEB 3HS8A 1QN4A 1KYDA 1B9KA 3ZY7A 1VTLE 1TBPA 1VTOA 1QN6A 1NH2A 1RM1A 1C9BB 1TGHA 1IU1A 3VN5A 3OCIA 4B0AA 1QTSA 5IYBP 1KY7A 1QN3A 1JFIC 5IYCP 3EIKA 1D3UA 3HS9A 5IYDP 2D0AA 1QN8A 1QN5A 2YMTA 2DWXA 2VJ0A 1QN7A 3ASMA 3OC3C 1YTBA 2E9GA 4WZSD 1VOLB 1GYUA 1NGMA 5CN1A 1E42A 1GYVA 1KYFA 1AISA 1YTFA 2Z8UA 1KYUA 1VOKA 1QNAA
chains in the Genus database with same CATH superfamily
1U6AL 2PKDA 2FIKB 3CVTA 1QLFB 5I75C 1U8NB 2X4OB 4AXWB 4P2OB 4MQXC 3V0IA 4LSPL 3MBEC 3VJ6B 2WWMD 1DQTA 1X5XA 2X53A 5T5FL 4L9DA 1H15B 3WE6B 2WLJA 3GSNB 4RWYL 5CD3A 1UVQA 2ZF8A 3E6FB 5KSAD 4PIBA 1KXTB 2QADD 5BW7C 2DIEA 1ZT4A 5DMKA 2UUDH 5HHXL 4P4KB 5KUMA 2F1EA 2G5BB 1LILA 3GMRB 3JTSA 4MYPA 3S3DB 3O6FC 4W9LC 1G9EA 2WWMC 4HT1L 1A5FH 4CILA 2IDSA 1SHMA 2PWEA 5DS8A 1E43A 3N0PB 1W6WA 5KSAC 3BYYA 1NAKH 2Y1ZA 5F1NA 2QADC 3V0AC 2BFVL 4A6YH 3EYFB 2ZYHA 3T4YA 5C0IA 1SJHA 3DXAB 1L9QA 4KMLB 4WY7L 3IAGC 3S4SB 1E4XL 3VXUA 4WI2A 2IV9A 3DRTB 3EOTH 3BQUB 5IMLA 1KCLA 1W91A 1N70A 2K70A 4AE0A 3I9GL 2KBGA 4XMKL 4CMMA 4PBWD 4X7SL 4CDGC 3LRGA 3CZFA 4YDKL 2ICEC 3MREA 1AXIB 1YYLH 3MV7D 4EBQH 2Y8QA 5TGBB 2HN7B 1SDDA 3OR6A 4GXUM 4HS3A 5LBGA 1NGXA 3QDGB 3FZUC 4ZUVA 3ZHLA 4FG2A 5CZVH 2VDPB 4UOW0 1HXYB 2IG2L 3O11A 4O02A 4V1DB 4ZW8A 1S6NA 1MKFA 2X4SB 1Z9LA 1OLLA 1SBSH 2GITA 3OKEA 4XPBL 1X7SA 3Q5YA 2CXGA 3D25A 3OJMB 3LKSB 3O2WH 3PREA 4UTBL 3AMKA 3ZIMA 3JQOB 3FT4A 2PTTB 5I1JH 2EDRA 1CGSH 2NNAB 4PVNA 1S5IL 4FQ2L 3IVKB 2H4LX 3EO1A 4EDXA 1LDPL 1OAQH 2EEFA 5AVYB 1BZ7B 1D6EB 4KHXH 2HA1A 3TFBA 1YG9A 3TZVD 2ZYSA 4IYKA 3AU1B 4MQSB 1NH6A 1BJMA 2FB4L 5ENWA 1DANT 4XP4L 3FU3A 4ZMXA 3VW3H 4XVUD 1DUYB 4M7KL 3ECBA 4QTIL 3ARFD 5AUMB 4HMDA 3MJ8A 3S3SA 1JNLL 1NGQH 3TZVC 2MCAA 1RSYA 2DBLH 3EFFA 4HYTB 4ZUWB 5AL0A 1VLXA 2DL9A 4JY4A 2BWQA 1A3ZA 4XVUC 3KPSB 2BVEA 1A3RH 4LCUB 4U33A 3DTXB 4HPYH 3ARFC 1S9XB 1SEBB 1XCQA 2DQEH 2E9IA 3D85D 3DBSA 4KXCA 4QTHA 2HUHA 4W4OC 3REVA 5E2VH 3V5HA 2FWSA 4JFOA 4RMRA 1FHNA 1I9IL 1F1GA 3N85L 5L4JA 3KLQA 2NY1D 3LNEA 2CRMA 2VXQL 3IBEA 4DJMA 2UY6B 1R3KA 1WE5A 2O5YH 4NCDA 4TNGA 2ADFH 4N8VA 4C57C 1LWYA 4PJXE 4FQQB 5CP3A 3GXMA 1FG2A 5HYQB 4H8WH 4BSWB 5HYFA 1V55B 4J39A 2OAAA 2NY1C 1XF5B 3ZE1E 4S1SL 4X4ZA 4Y16D 2LU7A 3F7LA 2KDYA 4NQTA 4FZEH 3RDJA 4OCRH 3EUUA 3QG6B 1J1PL 2J6EL 5KAQF 1S7QB 4GIAA 4EPSA 5CEXB 3X3GL 4AGMA 1SMDA 1NDTA 2CSPA 2CJUH 4L3ED 3D0LB 2EE3A 4AIXA 5K9JL 3RA7H 1ZHLB 4AIEA 3MOBH 4Y16C 3TYGH 2FAUA 2MTPA 1ZAGA 3MLVH 5BRPA 1UD4A 4LE8A 3U7AA 2IAAC 2ZX6A 2JQMA 2O5XH 5KN5A 3BVNB 1RMFH 1USQA 4KK9D 4L8BA 5HHPA 1N4XH 2I24N 4RAHA 2BVQA 3TP4A 1W9XA 3NFPA 1OQOA 4GH7B 4U1KB 3AS1A 2WXKA 3J27A 3TURA 3ARXA 4PRHD 2WN2A 1AGBA 4HWBL 1BQHG 3L6FA 3MUZ1 5CINL 2XZAL 4NAQA 1TETL 1XBDA 1ZS2A 3HS9A 4DZBB 1ORQB 2KZBA 1BGXH 1DCEA 4KK9C 4UQIM 1QFWM 4MCYA 4R97C 4TNEA 2WZ0A 1PZ2A 1I3VA 3DI2B 3K2MC 1JNNH 1AANA 3CWGA 3VYPA 2IQ9H 2TRYA 2X6MA 3PGCB 2GJZB 2DYPA 3L4WA 3DGDA 4PJXA 4XN7A 2GBTA 2R7EB 3G6JB 4H25A 5AQ0A 3LY6A 4PJ6A 4N2IA 1I1AD 3OB0H 4D2NA 1I7RB 3M7OA 5JA8B 2OP4L 4TULH 2J56A 3OMAB 4AEIL 2EDOA 3BVWA 5DZJA 3BX7C 4JRXD 4B9FA 4X6BA 3MBWA 3IN0A 1RI8A 4NZRH 1VOKA 3ULXA 5EIIA 4LO9A 5F9WC 1U8MB 3ZDZE 1J5IA 2KT6A 5EPCA 4WRLA 5K33A 2Z3FA 1MSPA 4OI9A 4EAEA 5JHLA 3Q3GA 1L5GA 4G6FB 4HW6A 3JWNG 2OK0H 2IGFL 4GQQA 5SX5H 4Q0XL 5GQBA 3S7GA 1MWOA 2XXMB 3II1A 4MCNA 4QOKE 1KN4L 3LIZL 5TQ2L 2IQAA 1S3RA 2YQ3A 3PDKA 1YVLA 2BHUA 2VISA 1FCCA 4JAMA 3B37A 4NO0A 1QSEB 5A16B 4FQIH 1Z0NA 1NINA 4ES9A 1A8ZA 2YRZA 4LOUD 4K5MA 2AQRA 2JJSC 3QUMA 1EXGA 4LCWD 3G08A 2OPCA 4FQXB 1KXHA 4X42A 3UZVB 1XSOA 4HG4K 2QGDA 5DCCA 2EIZA 5HJBA 3RAJH 6TAAA 1NVPA 1RVFL 3HC3H 1NEUA 2PP9A 3FB5B 5CP7A 1BCIA 2AEQL 4JFFE 3MLUL 1FZKB 3H3BC 1LE5B 3VMPA 4XBGA 3KH3A 5JXED 4TNWK 4QAMB 1WCBA 3SGDI 1HQ4B 4JG0H 1WBYB 1JBJA 4YGVA 2NOFA 1ANUA 3N1QC 3HBQA 3LXAA 2VJXA 2CLVA 3S36H 2HLEB 3OKLA 2ZAHA 1BM3L 1JGDB 1OCWH 3KL3A 3V0DA 4I89A 5GRVL 3W0WB 3BIBX 3LMJL 1CXHA 1UB6A 5DGRA 1E7VA 5IB5B 1QLEH 3SDAD 3MNDA 4AGOA 35C8H 4MGXA 4P5TA 2J8UF 2F7RA 4YHOH 1QASA 2WP3O 1QN8A 5KSVA 5JPNB 1UJ3B 3VXOB 2IAMB 1I3GL 3NJIA 4NOBA 3D4GA 3KLAA 4OKVB 4QOKA 5IJKC 4F33B 5JOPE 3WEAA 1I1CA 8FABB 3IRPX 5E9DD 3SDAC 1KGIA 2NOLA 4X5RA 2PPAA 2QSCL 3HRZA 2WLYA 5BZXA 4L8CB 1NCUA 4KKAD 4HG4J 3FUEA 2ZXGA 3ZYOA 4U6YB 2D03L 1WISA 2FKFA 3GXPA 2JQZA 4F3FB 2X4RB 5L6YH 3DX8B 3ZL4H 3C6SA 4H0LC 4JO2L 5LAPA 4DK5A 4Y4KA 3X14B 3CMOL 4OCSH 1MCHA 5IB4A 1CI3M 2DQTL 3DX4A 4TSBL 3MOAH 4DW2L 3DROB 1VFMA 1NSNH 2HX8A 5E1IA 43C9A 5ERWB 5GSVA 4JO3H 1M6OA 3QYCA 1MIEH 3FUKA 4JFFA 4GPVA 3RWFA 3VA6A 4XMZA 5ITFB 3IJEA 5FYLD 1FGVH 1D7BA 3N44B 1M57B 4G7QB 3E1F1 2VZUA 4AMWA 5LDUA 1B4TA 1E9OA 2QVFB 1W0WA 4FFYL 3GSUA 5AVVB 4CN1A 5F7EL 4AYSA 4HKXB 5HGAB 2HH0H 2YLKA 3KPNB 6FABL 4OT1L 1HU0A 4BKTC 5DD5H 4HK3J 2H8PB 3H3PL 1BYPA 1PS3A 3MRNA 3QR0A 5CP3H 3MCKA 5ESAB 1JUFA 1OXYA 4NERA 5FYJL 4ZMVA 5I71C 4L8SB 4YIQA 2ZUSA 4MMZA 4UT7L 1IAIH 1MRFH 4JJHA 2WXQA 3LH2H 1AZNA 2CLRA 1IAOA 2Z7ZA 2GUYA 1E4WL 2MJ7A 3GNML 4HUUA 2R0ZH 3Q6FB 2Y7OA 4ZOBA 4ELDA 5SWQB 1PTZA 1E3FA 4PJ7E 1HI6B 2FWOB 4DUWA 1EGJH 4MZ3A 3ZTDC 4CSTA 4GMTL 1AC6A 2BSSB 1KGXA 2VUOA 2W38A 3QNZB 4JPIA 3RI5K 3DSFL 4GUPA 2QGBA 3IJSA 5FHBL 1OTUD 5HDQH 2EDLA 2NXZB 3BXNA 3LKQA 1GAFL 1TQBB 1YECH 2IANE 4H40A 3U79A 4BM7A 3LRKA 3RG1C 3NIFF 3OAUH 5DK3A 4NP4L 4JDVA 2CR3A 4JFXB 1OZUA 4B5ZA 4FXLA 2Q7YA 5DLMH 4JVUA 1RZKC 4NQCD 4MNGE 1UXWA 1XF4A 3EYOB 1DQLH 1OTUC 4JFEB 1T1ZB 5FUZL 2HMID 4G7SB 4GIOA 3MLYH 1MQKH 3PWJB 3PFUA 5F7YC 1M7XA 1T2JA 4K2UL 4XXDB 3G6AB 5E1HB 1HSBA 4G43B 2EDTA 5EDXA 5GXBB 2VQTA 2JK5A 1E6OL 4LL9A 5KL0A 5BXFB 4GXFA 1NJ9A 4BZ1L 1D9KB 5E5MB 3ZSTA 3EF7A 4GQZA 4CU7A 4AVIA 2HMIC 4FQJH 3VRIB 2GI7A 3GB7B 4JG1H 4W6WB 2JIXB 1OE2A 4GSQA 3IPBA 5B1KA 1GGUA 3ME0A 5JDSA 1GOHA 3KPRB 1TCRA 4GQPH 3F5WA 3DVNA 4KK5D 3S3BB 1W0VA 2PPFA 4C56E 2BM3A 2X4TB 1FE8H 3RX8A 1T1YB 3S37X 2MIZA 3IU4L 2GI0A 2VQ1A 3QRGH 1T3FB 3MRIB 1FZMA 3ROOB 5HGHA 1EFQA 2X6CA 1H8OA 3U2SA 15C8L 2MMXA 4L29A 5JO5B 3CC5B 2AXFA 1N6QH 4KK5C 4PJ7A 2FT7A 1AGDA 4N0YH 5I76A 2PXYB 3SPIA 2HKHH 4FULA 1D5MA 4JKLA 4P06A 5E8PA 3RY6C 3SPGA 1LEKB 3ZT7A 3GKWL 4LARL 3C6LD 3G9AB 4PJBB 4R4ND 5JHLH 2JFCA 1H5BA 1JZ3A 1Z32X 2ZZUT 1HIML 1UM4H 2C7UA 3V4PB 3JV6B 2IANA 3K8MA 4QXVA 3U9PH 4KRMB 4QLRA 1A8JH 4HCGA 1DP0A 4NBYB 3RB7A 1R0AH 2P26A 2ALWA 3T0ED 1K3ZA 3OC5A 1AGEB 3C6LC 2ZKYA 4R4NC 3WFBL 1FJ1B 3EYSL 4MNGA 2G3XA 1MPAH 2QHRL 1MJJA 4I3RL 1UD2A 2B1AL 4NC0B 2IPKA 1PDKA 2C3GA 5TFSL 3QXVA 4Y19D 2ZYRA 3QIUC 2PTVA 4N0FA 1DBJL 5JR1H 4KKZA 4H1LG 3GSNL 1R4XA 1JHTA 4GAFB 2WWKO 3I6LD 5EU6B 4RX4D 1AXTL 2WCSA 4XNYH 3IF1B 4GRMB 2CA3A 2ZWKA 1MCKA 5GRJH 1WTGT 1W15A 5ITBL 4YHMH 1VTLE 4NT6A 2DI7A 4MXWL 4H5SB 2FSEB 5IJVB 5DEZA 1ASOA 3HS0A 2ZX5A 4EO5A 4HXAL 3U82B 3NSYA 1G6VK 5ANHA 4EVNB 1CLCA 4X5LA 3BE1L 4PWIA 4ADIA 4E41B 3ZZQA 1DN2A 4NUMA 5IKCB 3HZKA 4QCIB 5D6DA 3PQYB 1EMTL 1KJMB 2AF2A 2ZXCA 2FK9A 3Q6GL 4KKBD 3WU1A 3DGGB 4L0YA 3JVFC 5FECA 2WLIA 4LP8A 3H2WA 1AKPA 5E56A 3E9TA 2XKSA 3AREA 4R2GD 2DMBA 3HG1E 3WJJC 2VH5L 3IFLH 5DWUL 5EOQH 4XGZB 5JHDA 2NZ1A 1U42A 4KKBC 2Y6TE 4GFTB 3QUKA 4RFOH 2GSMB 2EDEA 4FHBD 3RDTA 1MFCL 4L3AA 2AXGB 1I1FA 4R2GC 3B5HA 3F6IA 3BH4A 1BQSA 3PP3K 2DQUL 4RAVB 4YLBA 5JPMC 1H3GA 3CK0L 3RUGB 2P7TA 3VI3B 3FUIA 2PR9A 1SLWA 2XI9A 4I0PD 2XDHA 3APDA 5EBWA 2D2CC 5T1KB 2LFEA 2NZ9D 2NX5E 1LP9B 1RU9H 5GRUH 3M8OH 2J5LC 3FCGA 3FK3A 4BUQA 4EOWH 3UERA 4PGEB 1UZGA 3BWUF 3WDHA 1ZK9A 4I0PC 2NDFA 3OKMB 4PVMA 2DKUA 3UFIA 4N3TA 4XNUH 2HZMA 5IFHL 4M6ML 3STZB 4HK0A 3BJ91 2NZ9C 4LFHG 5C7ZA 3E2HB 1MXDA 1U8KA 2CDGB 3ZKSD 3NZ8A 4QXUL 5BPPA 3CVHA 2Z0BA 1H3PL 2DZEA 3LQMA 1G7MB 2W59A 2EIKB 3UDWA 1F4WH 1Q0XH 2K6YA 3H9SB 1UWFA 4DT2A 3GRWL 4YEEA 3FONA 5LN4A 4XVJL 5FB8A 3IAQA 2OMVB 4TQEH 2J25A 2Z92B 3X11A 4GXVH 4YK4B 2B1HL 4JCLA 5DD6B 4OGYH 4BKLA 3HG1A 4XCEA 1AS6A 3Q9PA 3I74A 1CD9B 1FZOB 2D0FA 3OSTA 1CL7I 2MEJB 3ZOAA 3VGDA 3KRMA 2JKJA 4MD5B 5H37A 2W81C 3DOSA 4L48A 1OF2A 2R2BA 2UXGA 1T1WB 2CKBB 4BYHA 3VXTB 3UAAA 3Q8FA 3FQRA 3F65A 1KCSH 3AWGA 5AZ2H 1XGUB 2FUQA 2XTJD 1HU8A 1RJCA 3ZTCC 3FQUB 1I9JL 2ZXEB 1JXDA 2NX5A 1YEJH 1J12A 5L88H 1AR1B 5E4IA 2ZP8A 2WPGA 1YJDC 1V10A 4MMYA 1A7NH 5BNXD 3T1FA 3GLZA 1H19A 1WYJA 4Y1AD 3KNBB 4J12A 2XTJC 3BT2H 4AENA 1NBCA 3P3YA 4WHYH 2QRCA 1QPXA 1JOIA 5D7JD 4KPHH 1N12A 4S0TD 1EJ6A 3VA2C 1RUKL 3DHPA 3N40F 3EFDH 1DLFL 1ONQA 2R1WB 2YQBA 3T77B 4KVNH 1B88A 4DH2A 4AH2A 3NA5A 1MG3C 2WO4A 5D7JC 4O58H 4LHUA 2ZOTA 3GJFH 1N67A 4EZJA 4WHTA 1CGUA 1LO4L 5I17B 3EYUL 3EGDA 4KVPA 3D7QA 1YNTB 2CMRH 3MRGA 3NTCL 3AQDA 3BW9B 3WN6A 4PJ9B 4KUCD 4B9CA 3FOLA 4CADB 4LLUA 4G8FA 1WRFA 3WFDL 2A74C 3UL4A 1I8LC 3LPGA 3QXDB 4XO9A 4Y5VA 5AB2A 3E3QC 4U31A 5KYYA 2OMZB 5L4IA 4FNUA 1V7ML 3O6LL 2PUQT 1EVUA 1RIVL 3Q5TA 2ZE0A 3VFMB 4P2QE 4EF3A 5AW0B 3KPLA 2NY2D 5D1ZD 3FCTB 1P84K 3VNZA 4XP1H 1EFXB 4G7YL 3EJSA 3H4FA 1MJ8H 1HE7A 3TCLB 1TSHA 4D7RA 4FCHA 1PY4A 3BOVA 2SEBB 4XVSL 1PD1A 1ZHNA 2IALA 1FVDA 1KCUL 4Z3IA 3HLAB 2DWYA 4ODVL 1NGYB 2NY2C 4GS7C 5D1ZC 4U0RB 1AVAA 3MRRA 1CE1L 3ULUF 4XE5B 3SGEH 3OJVC 1OK8A 1FV1B 3QJUB 3VXSB 3WLBA 1MJ7L 1KEGL 4MCZA 1OGAB 1JWMA 5TE7H 5T1MA 3H2QA 4KMTL 4HU8A 1RUQL 5K9KB 2GTQA 1XV8A 4LSRL 4B3VA 3T8MA 4U7MA 1U92B 3RRQA 4AQ8A 4UMSA 1HHJB 3CFUA 1KLUB 4GIPD 5A7BA 1P7QA 1IGTA 1ZTXL 2PWFA 5AW6B 1MN4A 2A73A 2WSKA 5D7HA 3KYNA 3Q44A 1BJ8A 4EI6B 3LEYL 2AANA 5D1QE 3SDCC 1G6RL 1QLRB 4IRJB 4IQHA 3IT8D 1HK6A 3TJPA 4N6RB 1Q9LB 1TJIH 4O2CA 4TSCL 3MRQA 1YQVL 12E8L 1P84J 3HMXH 5DUPL 2V3DA 1NEZG 4G80A 4PWFA 4GNKB 2RHEA 5AVQB 2YKKA 2OSYA 3MGTA 2CUIA 1JE6A 1RZGA 3D4ZA 4P2QA 1PFCA 1C7TA 2Q7AA 3MRJB 4CNIA 3QHFH 2R4SH 3IDIB 2ADJA 1EEYB 4WZ9A 5DQDL 5C0FB 3FN3A 2WD0A 1N8ZB 4L3FA 2JKLA 3SQBB 4YHYC 1NIDA 2IMNA 3GPSA 4KKQA 3W2DL 3FL7A 3NCMA 3X1GA 2NPLX 5DK0B 4LSSH 3UP1A 2YUXA 3T3PF 4H8UA 1C5CL 1U2YA 3C8DA 4P46D 2HL8A 3QJRB 4LVHB 1NMAH 3FS9A 2QLYA 1YQMA 2J8UE 3CN3A 4EIBA 2XV0A 5LWYL 2UYLA 5AOKA 4GW4B 5KOVC 2WLKA 3OGCA 4IDJH 2A83B 4AIZB 1N6UA 2C34A 4XR8C 3VGAC 3GSRB 3QCTL 4NUJB 4ZNEE 3GSOB 2PN5A 3ECVA 5E2TL 2NZIA 4AQAB 3W37A 3ASNB 4FLSA 4P3CL 1CFMA 1Q1JL 3ZMRA 1WAPA 4NKMB 4AEFA 4APQA 4YPGA 5I1EH 4FA7B 3DPTA 4H88H 1WD9A 2IH1A 1F0LA 1TPXB 1G7HA 3WL9B 5FO9B 3OHMB 2VAJA 5D1QA 1LO3H 4L1BA 4GP8B 3T0AA 2G60L 3BKJL 1VFBA 1G94A 3I6GB 3ZE0F 1IGCL 4L4TD 4ECNA 2Z0UA 5FWQA 3HI6L 4R96B 1CDWA 1FNFA 4JGUA 5D1XD 3CPLA 1S9YB 5C0DA 1YY8B 1X4YA 4LSTH 4K7PX 3ATBA 3NESA 4IS6A 4DWHA 3VCLB 1F3JB 5CFHA 4Y2DA 3QZWA 4WO4B 3HAEA 4KROB 3S5YA 2AW2A 1YPZB 4GSDL 2FO8A 4KV5F 2GFBB 3GMOA 4PMFA 4WNJA 2O6DA 5H37H 1FAIL 3S37L 4BFRA 1SN5A 4ORGA 3GXDA 4DO6A 1ID2A 3DDGA 5FV2A 4PV9A 2KPNA 2XA3A 5AKTA 3PXLA 4PU2A 4LSUH 4BH7A 3GEWB 3IRZA 2EYTA 1E90A 3X1EA 2X1PA 2R8SH 2YEZB 2QT6A 2VDRL 4FZ8L 4IGBB 4JQVC 2DQGL 3D5OF 2EIBA 5AOMA 5D2NE 3JWDL 3UYPA 2J8UA 4YBHA 5DRXA 3NIGB 5MEPB 4CA4A 2P5WE 3DJZA 4LVNC 3MRHB 4MKMA 1WSST 3FHQA 1E2ZA 4G8IB 1E30A 1CICA 5FGCB 1M2VA 2VXVL 4LF3A 4U1JA 3SSGA 4ZNEA 3ZMEA 4HX1A 1JPTL 2CHXA 2LOEA 3MRCB 4HDIB 4LDCA 3TBYA 3LEVH 2HUEA 4Z95L 3CFBB 1KCVL 4KBPA 3LHPL 5AAMC 2WVVA 3GI9L 1AE6H 4ZX5A 2DQFB 1BZ9A 2GY7B 2H0PA 4XPGL 1MEXH 5SWSB 3SQOL 5L9DL 3WY2A 1DE4B 1XBRA 4HQQL 4FFZH 3MUUA 3ZRCC 4NRXA 2NY3D 1CFVL 5CCJA 4HJHA 2WXOA 4X7TA 4M4RA 1MWAA 4HSQA 3CDFA 3MRBA 4YDLB 4Y9GA 4R3SB 4DP1X 3ARDB 3L5XH 3ESPA 1IGJA 3B9DA 1TZOA 1UWXK 1GYCA 4QRPE 2LTQB 2I9TB 2NY3C 4DOHE 1LEIA 1YEKL 1E4HA 3U0PB 3UJIL 3H6AA 5GGSA 4A37A 1CC3A 1KBVA 3T1WA 5HHNA 3RZCA 4BA8A 4IEFA 4PJ8A 2OSXA 2ERJB 2X6UA 2C3VB 4JFQB 1PCXA 3V4VA 4G83A 3FPYA 3R4DA 1GGCL 3G5YB 5J5EA 1AD0A 1M1XA 1QBLH 1OGPA 4XCCH 4GP5B 1GHFH 4PGDA 1JIBA 2IO5A 2Y7QB 5DVPA 5IG7B 3MV8D 2IBGA 2COVD 1KB5B 5D2NA 2R4RL 1G5GA 4R0LB 2YXFA 1CQYA 1H3VA 2QEJA 1Q9OB 3WFCL 4BQ6A 2P5WA 3BWAA 4PGBA 4MDJB 2GVYA 2E5EA 4QHKJ 4BXVA 1I7UA 1U8JA 3RBSA 5EUKB 1CDYA 3QFJB 4BK5C 3MR9A 2CU9A 3QA3B 5G4OA 1IJ9A 4JPKL 4OUUB 3FOMB 4DTGH 4JY5H 2Z31D 2W92A 1AGFB 4X5XB 4DAGH 2ORBH 3LHAA 3AQXA 5HGBB 3C2AL 3INUH 3QDAA 4J1UA 1MHPL 1AHMA 1S78D 3V4PL 2ID5A 5DMIH 1ETJA 5F3BB 3CSGA 3ULAB 1MLCA 5FS5A 1WT5C 5T3XH 5AOZA 4LPWA 4G3YH 4E9XA 4GLRH 2Z31C 4ZTPL 4JFZL 1PVHA 1U93A 5LNEA 2A3TA 4BZ2L 1AS7A 3DPBA 5D5MB 1S78C 2FX7L 2ZPKH 5F6IC 1U91A 5AD0A 1KY7A 4TPRH 1T1XB 3UBXB 1NBZB 3UTTD 1SHSA 3CBRA 3PWPD 4QRPA 1OO2A 1RQ5A 2H2PD 3C9NA 1BVKB 4MJID 5IF0B 5IVXA 3EIKA 1MRCH 3JVGC 1XF3A 2KUTA 1HILB 1HC1A 1DVXA 1UOVA 1XGQB 2F8VA 2YD6A 4MD4A 3STLA 3VFVA 2BSTA 3MLRH 3H7BA 4PJIB 1P4IL 3QI9D 4WO0A 5CEZE 2CCVA 1FNAA 2MOGA 3QWQB 3DIDA 4FQHA 3MLTB 2QV4A 4KJQD 1M7UA 4ONGH 1DJZA 5GGTL 5KW9L 2H2PC 3B9KD 2IDUA 1LLAA 3P2BA 5F7AA 5A43C 1HL4A 4JANB 2BNRE 3SY0B 4UQ2A 1UM5H 4IBWA 1TKWA 3KE0A 1ET5A 3G9VA 3N55A 1VFAB 3MUHL 3OJDB 3QI9C 2P24A 5DURD 1B0RB 4BUHA 4Z3TA 1JZHA 3GS4A 5C86A 1T80A 1QACA 4FP8H 4MS8C 5D4IA 4KJQC 2WNGA 5B22A 3B9KC 1JP5A 5BRZB 3CTTA 3HE7A 4PY7B 4K7FB 2WBXA 3NFNB 4DVBA 3CN1A 1WQAA 3AB0C 1N3NA 3K74B 1AO7B 4AJWA 1J8HB 1RZJL 4G6AD 1MHCB 2K6WA 4X50A 3TC9A 3F7YB 3JZYA 3NA4A 1TTFA 2NY6D 2Z9TA 4J6IA 5D7SH 2H2SD 3QQ9D 4IK7A 1UD5A 4U1GB 2P49B 1RZIB 4PS8A 1F90L 1OANA 3CN0A 3F6LA 4MAYD 5LGHH 3SDXB 5TD4A 1PKOA 4R4BB 4G6AC 4Y4HB 1EAJA 3KYMA 4WTZA 3RWEB 4HZAA 1O6SA 2NY6C 2FQFA 3ZHFA 2H2SC 3QQ9C 4YC2B 4BHUI 1SOSA 4I13B 1GYWA 5C07E 4CC4C 5I8OH 5BV7B 3EIFA 1H0DA 5EIVA 1SY6L 5AL8A 1NEPA 1ES0B 1F6FB 1P4UA 1YEFL 4B9JA 3NZHL 5GRXG 4XHQA 3AJ7A 3LKOB 1YAZA 5I8KL 1AIFA 1A2YB 3VFSA 5LAXB 3L3OC 3OHXB 2R29H 3OZKA 1JWUB 2DLEA 2BNRA 4OCXL 1W72A 5I6KA 2BSED 4I9XA 1TNNA 4NS0A 4QHNA 1XF2B 4ISVB 4WK2B 5IVZA 1BQLH 4OIBA 1OCCB 5CGYD 4ZPVA 5HHQB 3RWDA 2F19H 1A66A 2PLTA 4ICWA 4W93A 4GEJA 2DI8A 2NTSP 2PCPA 1EO5A 2JKTM 2UWEB 3FSVA 3G5XA 5GISH 2RFXB 1CBVH 2KZKA 2ED8A 2ZKWA 3DUHA 2BERA 3LPOA 2XV3A 4FMFA 5KVDH 5CGYC 3UAJD 3R1GL 3MN8A 4HUXB 4LIQL 2NW3B 2ZCLL 4QYOB 3RVXD 4H26B 4O2EB 3WENA 5IESL 3FQWB 5C6TL 2FR4A 5FEBA 2WVTA 2EH7L 3GZKA 1AZZC 1N39A 1TJGH 1QVOA 5FF6B 5I0DA 3BDXA 2ZUTA 1IM9A 2X05A 3RVXC 2ZOOA 3CHSA 4AYBA 2XZCL 4MB5A 1UZ8A 4QRQA 4DP8X 5E6IC 4QO1A 2W9EH 5C07A 4PCTA 4JK0D 5CILH 2YN5A 1GH7A 5ICXA 3FHAA 4E9WA 2OTWB 1CGYA 5I6PA 3VH8G 2GTZA 4ZUSB 4XMTA 5IM7A 1JG9A 5SWZB 2Y72A 3UTZA 2O6EA 4NUGL 4YHZH 3TO4A 5E5LA 1F02I 4WHCA 1UYWL 4NKDA 2EABA 4DEWA 3UBXI 5AW2B 3NG5A 1ZPLA 4HMCA 5I2IA 4IIQC 5JOEA 4H7VA 3TTSA 5G5DA 2P4AB 3VXRE 4A6YB 2BCKA 4NZTL 4F2EA 1PCZA 4KHTH 3SDDA 3TVMA 2BIOA 1F4YH 4HJ0D 1FNSL 5DVKA 5CLWA 3LNDA 2RBLA 2NTFB 3JTTB 5DRZA 4GRLC 1A4KA 3BWZA 5K39B 3PIQB 4IRSD 5E7BA 1ZA6B 3O9WA 4DULA 4KOBA 4LXFA 3RFZC 2EXTA 5D7KE 3ZXAC 1KZYA 5KG9B 4BWUA 3C5ZD 5DS2A 3PXHA 4QRRB 1AZRA 5K9QG 4Z3FA 4HJ0C 4LESA 2HX7A 2P1YA 1TEGA 1KTLB 3KXFE 4HKJA 1QHQA 1OE1A 5EFIA 2RALA 1XGRA 3VD5A 4IRSC 4UT6L 3QJHA 4JEGB 5KBPA 1YQLA 4K3EL 4J3SA 1MI5E 1S3KL 3ARSA 3FTGA 5SX5K 3IFOB 4OV5A 3C5ZC 2GUOB 3ZO9A 5I66A 2WJ7A 3L95B 1X7TA 5IQ9A 1VDGA 4PRBB 1G4RA 5I73C 3ULVD 5FO8A 1TTUA 4LMQI 3HPLB 4M61A 1MCDA 4G59C 3FYEB 1Z9NA 2BRRL 1CXKA 1OB1A 1EBMA 4QI3A 3BPCB 3MV01 3D08A 3N5AA 1A7RH 5FXCH 4ZW3A 3IDXL 2CBPA 1RV6X 3VSUA 4BWWA 2YA0A 3PL6B 2MKWA 2WXRA 5AAWA 2O26U 1IVTA 1T5XB 1JHKH 4FNTA 4DGVH 5KVGH 5HHOB 4LSDA 1QP1A 2ATPA 3NQKA 2D7TL 4OFPA 5IMOA 3HFMH 3KCPA 4RZCB 5HGDB 2QR1A 2XQYG 2AJ3B 4G6MH 1JFQH 3VXUD 1QFPA 4JG5A 4D8PA 3S0PA 3ULUE 1DN0B 2E7LA 1PQZA 2XWRA 3LPPA 4BBWA 3ARGA 1CIUA 5CU9A 4XWOC 1JZFA 1G1KA 3VXRA 1I82A 1HWGB 5JHBA 3II3A 5ACMA 1LWHA 1KYOK 2HRPL 4TVPL 3VSTA 4QHKI 5HTSA 1HDMB 1I8UA 3CX5K 2WUCH 2E6JA 3WTTA 2ZT9C 4X6FB 5C70A 2OMWA 5F89B 5I0VA 1QZ1A 4K7PL 4TVSa 1MFBL 2XIBA 4BQBA 4ZAKC 4UT9H 5FR3A 2H9GA 4KO6A 2PW2B 2F68X 2QKIC 1C5DB 2WGNB 2FYYB 3QG7H 4JFPB 1I8IB 3KXFA 5DJZA 5ADOH 2IBZX 1W8NA 7FABL 3MRMA 4PMEA 3PDGA 1XH0A 1FH5H 1CXEA 1MI5A 5CHNA 5CJXC 1D5BA 1J18A 4HKZA 5IV2A 5DQ9B 3FTVA 1ZT7B 3KL5A 1HZHL 2VC2H 3A0OA 4ZW7A 3T2LA 4OF7A 4IMLB 4N1CA 4P4RA 4N2DA 3GMMA 3Q2CA 1N6VA 4TUJA 1TZGH 4EAJA 4AKQA 5ESQB 3UO1L 3ZT5A 1R5IA 3D51A 2OCFD 1I8MB 5EZJA 2F53B 4YH6A 1DIZA 2HYMA 1VGEL 3LVEA 3B7UX 3FH7A 3O45B 2JCCB 1K8IB 4OZGB 3E6HA 3RGVB 1M7DA 5EPMB 2DQIL 3CFEB 5ADPL 3T3PE 1MW3A 4Y0GA 5LXVA 5EOTB 1L9PA 5HYSA 3KWUA 1KYOJ 3V10A 3ZHKA 1OSPH 4U6TA 4Q74A 1IZKA 1P4BH 5DVLA 5M94B 4JDTL 3CX5J 4OW6A 5AOLA 3CZUB 3RTQA 1HE8A 1VIWA 2J7LA 2B9AA 2GSGA 2XG5A 5TTRA 2NLJA 3JYBA 2FGWL 3D48R 2W65A 4Y1TA 4J3OG 1KXQE 2VITA 4A2HA 1A7OL 3C08L 4NNXA 4U1SB 5DSCA 2NYZA 3L1EA 3U48A 4GMSL 1EEZB 4OLVL 2CRIA 1MFUA 4PLNC 4JRYB 4WDIA 4DFIA 5CUSH 4YWGH 4BQ8A 4N2LA 2Q6WA 4AQ1B 4DN3L 2RA1A 2P3YA 1LWRA 1FAKT 1VTOA 1QRNB 3ETBF 4B0MB 1JGVH 3ZE0E 1QSFB 2BJML 4TTDD 1WZLA 2LU3A 1BLNA 5JUEL 2BS8A 5JIMA 3U1SH 4KKCD 1DCLA 3NP4A 4H0GA 4JHVA 1K3IA 1HEZA 2XWJB 3RHWK 3WEMA 2W95A 1JK8B 3HVNA 3B83A 1OAXL 1YEGL 32C2B 3O4LB 4PLOB 3MRPB 3QORB 4PJCB 3T6VA 3BAEH 4KV5E 2F5BH 3A6OA 1TZIA 3VD7A 1N5AB 1FDLH 2YAQA 5IOKA 3U46A 4RMQA 4KTDL 4KKCC 3FUFA 4JZJA 5DD3L 5E2UL 1SLUA 3LS4H 4UTAA 5L2KB 2H32B 2KZ1B 4UB0L 5IMMA 1OZTG 3DK0A 3GO1H 3X2QB 3G6JF 3FQNB 1QSVA 3EADA 5E00B 4ABQA 3NPZB 1I9EA 2WK2A 4MAZA 3QEUA 4OVVA 2V33A 3DETD 3LS5L 4AYDC 3TV3L 3VVVA 1GYVA 1PIFA 4WW2F 3BP4A 1AKJB 1OPGH 2Z8UA 3L3KA 2B3IA 3JWNE 3UX9B 2ZOUA 4MA7L 5JNYB 5F1OB 3MJ9L 3P4LA 3X13B 2DLFL 1NC4A 4PRNB 3DOIA 1I1YB 4GAGL 2XCMC 3MBEB 4N26A 4FJZA 4OZ4A 5IK3B 3DETC 1BQ5A 1KIPB 1T21B 4MNHA 1NPJA 4FMVA 1RSFA 5F7KC 3VD3A 1T03H 4K94H 5IEKB 1J9CT 1JV2A 4ZXBD 3HZYA 3VFUA 1RIUH 4ZFOL 4QRSB 3HE6C 3O6FB 4L37A 2BMKA 4UUJA 4ONFL 3O0LA 5I5IA 2ESVE 3ALXA 1PJWA 3PDOA 2W1NA 2YKLH 3GBNH 1MHHA 5KSAB 2BS9A 2QADB 1YSOA 3BHBA 5DUML 4XT1C 2OMTB 4WV1C 4GAYB 4G9DA 4ZXBC 4GW5A 2DPKA 4NM4H 1J9TA 4PG2A 3L7FB 1KFGA 5I6XB 5JOFA 2QVIA 3KYKL 3L1GA 4BSVB 3MNVB 5CU5A 3FT2B 4TUUA 3RWCB 4AYMC 3UZQB 1AQKL 3WFEL 3NJMA 3MLWH 1Y1DA 4CBZA 4PP1C 4X7FC 3CSFA 3NCCB 2NNFA 4NKIH 1MH5B 1SHXA 4LRNH 1U8CB 4HBCH 3OF6A 2YD2A 3QHZH 4I0KA 2ICEB 1R3JA 2H0FA 4F9PA 3HS8A 2EEAA 2BWDA 2FD6H 2JE8A 2CJ3A 4NO0D 3ZW3A 3V79C 3ZHDA 3OKDB 3VXPA 5E8EA 3U6XA 4RGNE 3GSXA 4XODA 1U0QA 5B8CA 1UB5B 3ZYIA 4B3EA 3B5GA 4JRFA 1ZA3B 4D9QE 3PJNA 2DEYX 5E2WH 2FJFB 1XIWA 1CU4L 4JPVL 1EO7A 3OB8A 5I1CL 1TVDA 3BVDB 4Y2NA 5ACZB 3O2DL 1U6AH 4ODSL 3FCUB 1BLIA 1Z5HA 4JZOB 5C2BL 3FB6A 1AD9A 1X6NA 4OFYA 3EXJA 4LSPH 5T5FH 2EXWD 2VN7A 5ID0B 4ZX3A 1PY0A 3ARQA 4RWYH 1I7TB 1KV7A 3PWLA 1NUNB 3O8XA 3LIZA 2F7IA 2L7EA 4LCCA 5IGXL 2OMYA 1MFMA 2ARWA 1TVHA 1FP5A 2V5TA 2HCZX 5IB3B 4OBRA 4KI5D 1D3CA 4QF1B 4HT1H 1WA2X 1N8OE 1IT9L 3WLWD 2J1KA 3VTTA 2BNQA 1P1VA 4NSKB 1EEQA 5I1HL 2BFVH 1ZS8A 1LGVA 3EYVB 3KHOA 1CFNA 1OOWA 4WJ5B 5EC2B 2CLZA 4EZLA 2HLAA 2W0FA 3IKCB 2PW1A 3GXNA 4L4VB 2PWDA 4WY7H 2M26A 2XN9E 3U9UA 4KI5C 4B95C 1QA9A 3EH1A 3ARFB 3PJSA 4N5ED 4EI5D 3UW2A 3L16A 3WLWC 2BH0A 4QOKD 2ZP9A 1E28B 3L45A 3EO0A 4NHCL 1KTRL 3I9GH 4XMKH 4X9BA 2JXMA 4X7SH 1VAHA 3UG5A 1GJUA 4KQ3L 3K6FA 3LV3B 4Y7MA 4D7PA 4EUPG 1CDJA 4YDKH 5DMJB 2D0HA 3N44F 4PTTB 3CVIL 4EI5C 2ZOLA 4HIIB 2OI9C 4N5EC 4DK3A 3OMIB 1S9WA 4XI5D 1PPIA 1WIOA 2BVOB 2IG2H 2OTPA 3HIZA 2OXGB 4I2XB 1QNCA 1XGTA 4Y4KD 2YPLE 3CDGB 3QWOB 5F7UA 2HJKB 3E9UA 2JJTA 1T7VA 2FBOJ 4XPBH 2E7CA 3C75A 5CS7A 3D3VE 2AJVL 3K4ZA 1HHGB 1DJXA 1E5AA 1ZV2A 4XI5C 4ORZC 4JFFD 4UTBH 1YMMD 2BC4A 5JLZB 3HW7A 2JJWA 3Q2LA 2VLME 3L9RB 4Y4KC 4N90E 3D9AL 4LHQB 5CSZA 1S5IH 1SYVB 4FQ2H 1BFOB 4I18A 1LDPH 3FRPB 4N2OA 1R47A 4HVBA 2NSQA 2FTAA 3EOAA 4Y16B 4IRZL 4UYQA 5ALCL 2GCYA 4LEXL 1KF9B 2NCMA 2W5PA 4OKDA 4XP4H 5CSBA 1EZUA 1NAMA 1C08A 1U8LA 5IQ7L 3IFNL 1S5HA 2QQLL 2NYYD 1YNLL 2C1PB 3BH9B 4M7KH 2JWYA 5KBNC 5MERB 1UXSB 4QTIH 4JQXA 5L8KB 5C6WH 3BZEA 3ZE2F 4PRPE 4JUTA 3LDBC 1IL1A 4P5KA 5D9SB 5B38G 4BQ9A 2IIJA 2JTYA 2XN9A 1QN3A 1IEBB 2NYYC 1WTLA 2MCPL 5JOPD 5C0EA 2B5IB 4NX0A 4MMZC 3S88L 1JDAA 4XNZB 1LM8V 3HZMB 2MH4A 3QNYB 2ITDB 2XYBA 4XMPL 1XGYL 1M3QA 5K59F 2PTUA 1I9IH 1OVZA 3N85H 3U0TA 4RZKA 4WU7A 5CAYB 3KR3L 3EGSB 1V3MA 2VXQH 2J1XA 1LYQA 1XQ4A 1CTNA 1ETA1 2OL3B 3TASA 3FN0L 1YEEH 2YPLA 1YC8A 4L2LA 2R0KL 1WJ3A 4Q14A 3RB5A 3BGFC 4AM0B 4G9FE 2F5AL 3X1NA 5AW4B 3D3VA 3MSPA 4Y1SA 3PHOB 4M5SA 3N1PC 3QWNA 4S1SH 4XO4A 1FC1A 5F9WB 4HC1L 5ESVA 1D7CA 2X5PA 1I7ZB 1J1PH 2AK1L 2QQKH 2J6EH 1OM3L 1AS8A 1JZ6A 2DQHL 4Z7VF 2VDQL 2C4FT 2LGNA 4TNWF 1M05B 1KTCA 2EE2A 3KBHE 3IDYC 5K9JH 5FV1L 3B6SB 3WEXB 4G5ZL 1AQDA 4K55A 2Q86A 4PJBF 2A9DA 4O5LL 1F18A 2FKMX 5F7WC 3GJFK 2X4PA 2N3JA 1CDHA 3UCQA 4JR9L 4E9TA 4XNMA 3RNKA 3B2VL 2OA9A 2VABA 4HWNA 1OAKH 4X8JA 4XPTL 2OJZL 4PRPA 4J8RB 2UXFA 3EAYA 3A4EA 4N0UB 2WXNA 1YUHA 3GBEA 1KIQB 1SZNA 5GJTL 2HPTA 3P9WB 1XMWA 4HWBH 4NQSB 1BBJA 5CINH 1MXGA 2DMKA 2XZAH 5A6LA 4HD5A 3BPLC 2ZSWB 1TETH 2AKRA 3OQRA 4RDQG 3SKOA 2OR8A 4HIEA 4ODUB 3WXWL 4NQEE 1ADWA 1Y7VA 3GSWA 2V7NA 1KGYE 1U41A 2IAND 2VL5B 3GSVB 3D2UD 3K6NA 1JNHA 3WUWG 5AN4A 1CLVA 2WMPA 2EYRA 4BXSV 2V2WA 3PV6B 4M03A 2X1OA 2AERT 2PCFB 1JPFA 2EXYD 2OMXB 5DHVA 4RFNC 2ADGB 4G9FA 2D3NA 4XOBA 3HHSB 3FO1B 3KTUA 4JM2B 1BAFL 2OP4H 3FBQA 5I16B 4AEIH 2Z35A 4L9LA 2GC7C 4TL5A 3S3PA 3N9GL 1ZY9A 1GRWA 2EXYC 3QARA 2CO6A 4HWEL 3IETA 1J9SA 4D9RE 1KJ3L 3MRDB 3BZ4B 2L4OA 2A4CA 1OGTA 3TIEB 3EFOA 2D4DA 1J5DA 1NUFA 5EH1A 1B0GA 3IDGB 1C8QA 2IGFH 3QDGE 4Q0XH 4C56D 3SDAB 3QJTB 4P2YA 1KN4H 3LIZH 5D6CB 5TQ2H 1HHKB 4OJYA 4ONOA 3BRFA 3GUFA 1A14L 3AG1B 2BSCA 2EAEA 3LRSA 3G5ZB 4PJGB 2Z4QA 4FXKA 3WDIA 4EJ1C 4P59L 2E76C 3O3UN 3W38A 2GK2A 1CMOA 3HI1A 1XH3A 4HAKA 5HSFA 5K93A 1L6ZA 3PJLA 3N50A 3ARED 1U8NA 2X4OA 3DX7B 1JZJA 3FU6A 4AXWA 4P2OA 4CGUB 1Y6MR 4N2FA 1OPOA 4XTRD 3VYNA 4TOYL 5D6DC 3TEXA 2XACC 3GHBL 4X5PA 1EK3A 1P6WA 2NDGA 5B39G 3WE6A 3E6FA 4NQEA 4RMBA 3DHUA 4F7KA 1KXTA 4ZBJA 1RVFH 2ZUQC 2H6UA 4L5FE 3RDTD 3RI5F 1YNKL 2DJ4A 4P9HC 2AEQH 3MLUH 2N0MA 4P4KA 3ZX1A 1IKFL 2G5BA 3AREC 3WIFB 3F0ZA 3GMRA 2MHAB 2IPTL 1AJ7L 4ROCB 4OZHB 1M3HA 3DPUA 1N2RB 3CGTA 1SFDA 3WAKA 5DZOA 5CLXA 2DW5A 3ARWA 3EYFA 3RDTC 5I28A 2EDMA 2C3HA 3IYLW 1KBKA 5I71B 1BM3H 2V4LA 4LLVB 3S4SA 3A67L 3IDNB 4NO5B 3LMJH 2VQ4A 3DRTA 3BQUA 3VI4F 1ZHKB 3KPSE 3IM1A 2OLDA 5CIPH 5FOJA 2OULB 3QRLA 4F2FA 3KGUA 1H8LA 5L8LB 1I3GH 1OEZW 2HN7A 5TGBA 2HP4A 4Q2ZB 5TE4L 3QDGA 3W82A 1FI8C 1HXYA 2ODHA 3HI5L 3N1FC 3VWJC 2OW7A 4R7DB 1VEMA 4V1DA 2V9UA 5D70L 1ZLSL 2PYED 3V0WL 2X4SA 4ABVA 2CBMA 5K1VA 4FEMA 5HDBB 3RL1B 3BAKA 1TBPA 2QSCH 4LSVL 4MSWA 1BZQK 5F3HB 4D0CB 3IXTA 2V5RA 4AV5A 2D03H 7PAZA 4QR7A 2P5ED 1EHAA 3LKSA 3QH3B 4BDVB 1A6VL 3UDWC 3HG1D 2ZKHL 4ZTOL 3BAXA 3QSKB 4JO2H 1L7TL 2PTTA 3CMOH 1U3NA 3WFZA 2D7MA 1RPQA 1TFHA 2DQTH 4NO2A 2NNAA 4TSBH 5HYJE 4DW2H 3IVKA 1K2YX 3GS7A 1EJFA 1AMXA 4MX7B 1A6WL 1BZ7A 1D6EA 5DLLA 3L5WB 3GJFB 3SKNB 2HAZA 3AU1A 3AAZB 3C8KB 2FHFA 3SZKC 2XJLA 3QIWB 3VXQB 5BZDB 1DBML 3T0VA 2WQXA 4DO5A 4FFYH 3NPSC 5F7EH 5AUMA 4ENZA 1OB0A 2EADA 3QFGA 6FABH 2H3XC 2FHBA 2DMCA 2NX5D 4OT1H 4Y9CA 2ZNWA 4ZUWA 3GI8L 1COBA 3CMGA 5DO8A 3H3PH 2VM9A 1IGFL 3FCSB 2JB6B 5CLTA 5FYJH 3CSYB 3KPSA 1YTFA 4LCUA 3DTXA 4ZMTA 2XHIA 4NZ8A 4ZPTA 1S9XA 1GCFA 1YNTF 4UT7H 4A1RA 2XT1B 1ADQA 1CYXA 3C12A 1PAZA 1E4WH 3A47A 3GNMH 1WK0A 1T04B 4M43L 1GCYA 5TQ0L 1NMCC 4I9WE 3M17A 4JMXA 2UY6A 4F93B 4JO1L 4GMTH 3DJTA 4XCYB 1XEDA 4F7MB 5KVMC 2IDTA 3B7SA 4NZUH 1NM4A 3V4LA 3DSFH 3G6JE 3RX9A 4FQQA 4LHUD 1I85C 1LO0L 5FHBH 1GAFH 4HLZH 1NLDL 1X7QB 5BZWB 4TNVF 4BSWA 1MNUH 1W80A 3C6LB 3ZPDA 1FYTB 1XF5A 4NP4H 4HGWB 5KVFE 3UGUA 2N1KA 4WKXA 4OJEH 3NAAL 3QG6A 2DJUA 1S7QA 4XMUA 5CEXA 2B7DT 3CH1B 2E9WA 2DMGA 5FUZH 4ZD3L 4Z7NB 4GKOA 3QIUB 3RKDD 1EAPB 3EBAA 3D0LA 1IJNA 1ZHLA 2X89D 4MAUL 5CZRA 1X5GA 2OSWA 3P40A 1XD1A 4G11A 1DANU 2VL4A 3WMPA 1E6OH 5J6HB 4DN4L 2K7QA 3IWUA 5SX4I 1SYSB 4Y19B 3RKDC 1KBWA 3TNNA 3BVNA 3OPZL 2MQCA 4R26L 1URZA 1BEYL 5DHVH 4B5EA 4YQXL 4U1KA 1B3JA 3OZLA 5H4ZA 1REIA 4XX1E 4JDZB 4N2KA 3IU4H 1QTSA 4DZBA 4XNBA 1QPPA 1ORQA 4BRJA 6PAZA 2HJLB 3ABGA 3X17A 2D9QB 15C8H 5TK4A 5EHFA 1SVZA 2VW6A 4FG6C 2VDLB 1JXGA 4NQXA 4L0PB 4LLQB 3HUJB 5GZOC 5AW3B 5FO7B 4Y9FA 3PGCA 4Z23A 3JUYA 3KM1A 4Y9BA 2GJZA 3GKWH 3SE9L 5J4MA 3RIKA 3CLWA 4FS0A 4AEEA 3VD0A 2R7EA 3G6JA 1JZGA 1F8TL 1HIMH 4RMUA 4A63A 4R2GB 1P7QD 2EH8L 2VMDA 3F3HA 1YEWA 1WLHA 2Z8SA 3Q0HA 1E9QB 3COOA 4R9HA 4WW2A 5JPMB 4LPUA 4Z7QB 5MP6L 3WFBH 3PMGA 3EYSH 2DLIA 4J3OF 5DT1L 3OC8A 1AZUA 4PR5A 4GKLA 2HJFB 2QHRH 3W0WE 4AQ8C 4M6OL 1U8MA 4ETQB 1C12B 5EBLB 2G2PA 1WZ1H 1VADB 2B1AH 2J5LB 3V95A 4JBSA 2UZXB 5TFSH 3T2QA 5HYEA 2HKPA 1DBJH 2WW8A 3LQZB 1WZKA 3EOYG 4P2QD 5K9OB 3GSNH 3TBWB 3DURB 4XBMA 2W80C 1AXTH 3LX9A 5F9AC 2RTTA 4YFLI 5EMYA 4NQVB 3FO9B 2G30A 3UYRH 3NK3A 5ITBH 1IEAB 3L3HB 3P4NB 5A16A 5AVUB 3U36B 3VNYA 1F4AA 5CZKA 2BZCA 5E7FA 1F1DA 4HXAH 5DTFB 5IBUG 3PYCA 3Q8AA 3SBWC 4L8DA 4A38A 3BE1H 4FQXA 3UH8A 4UZUA 4GI6A 1BG1A 4CVXB 3UZVA 2OJ1A 4H0HB 1EMTH 1H3TA 3Q6GH 2BXZA 5JQHC 1E3XA 3FB5A 1BZOA 3TF7C 4MDIB 4HGMA 3W1ZA 4HH9A 1A9BB 1LE5A 2NOEA 5DWUH 4IMKC 4PGJA 3FB7B 3D0VB 2IV8A 1YPZF 3SOBH 3VDBA 3Q5OA 1IKNC 1TXKA 5DR5L 2V6HA 2FEDD 1S8DB 5BQDA 3TPKA 1HQ4A 3LXBA 1WBYA 3SO5A 1PBYA 4NWUL 1TEYA 1MFCH 4UQCA 2FX8L 4N8VG 1M7IB 1KJ2B 5A2BA 3GTNA 3ZGIA 3ENCA 4LGRB 1MZYA 2X42A 4YZFE 4WFHE 2DQUH 1A4JB 3F12B 3CK0H 4N68A 1WS7A 3W0WA 3SGEI 2ARJQ 5JPNC 4UIKL 3BSZA 3MO1B 4TXVB 1LVEA 5EOCL 1Q8MA 3QAZB 5IB5A 5J0BA 4TUOB 4X80L 4Y2DD 2AQ2A 3I0WA 3NIGF 3OLGA 3S48A 2KC0A 5HVGB 5JPNA 1QUPA 1UJ3A 1BVLB 3SPVB 3VXOA 2W88A 3QR2A 2XTJB 3DV4B 4YSPA 4FF9A 4OKVA 4F33A 3QXUA 3MX0B 8FABA 2QKSA 4Y2DC 2E7DA 5AYTA 5IFHH 2EVJA 4M6MH 2J1WA 4L8CA 2G75B 2UZPA 3AY2A 4QXUH 2QR0A 2XPGA 2YPVL 3OBAA 4Y1AB 4IBLT 5I1LB 1HL8A 4U6YA 1H3PH 1I9RL 2X4RA 3DX8A 5D7JB 3GRWH 1D2OA 3X14A 4HP5A 4J23A 2VMFA 1FFTB 3WS6A 4XVJH 3NIDB 2F54D 1T6AA 4BUGA 2ZUWA 3DROA 5LKNA 2APBA 1VZIA 2WBJD 4JFEE 1R24B 2B1HH 4BELD 2XZZA 1ZDQA 1MCFA 1KBGL 3EJYD 1G9MH 2A74B 4G7VL 2NRDA 5GIRB 5LB1A 1SM3L 1RD6A 5MEOA 4V11A 4HPOL 3P3SA 1I4FB 1JVLA 3QFDB 5K59E 5ETUB 1KCRH 1AZBA 2WBJC 3HCVB 4HKXA 5HGAA 4D9LL 4WJG3 3JWDC 4LCYB 5LG1A 1TFPA 1G0YR 3BPOC 2OL3L 2JJUA 3HJ0A 3KPNA 4A7UA 5AAPA 3EJYC 1S9VB 3K8KA 1DVTA 2ZX9A 3DI3B 2H8PA 4HCRA 3V8CA 1FFNA 5ESAA 1X9RA 3Q1EA 3CFTA 2CJTA 1DQDL 3LH8A 2NNRA 2VR3A 1CDCA 1K4CB 3SE8L 2K7PA 1I9JH 5G4MA 5EIIG 4DO4A 5D1ZB 4GS7B 4Y5XA 1CCZA 4MA8L 5EF1A 2CGYA 3Q6FA 5SWQA 1K6QL 3BAWA 1G7QB 4YN3A 4HFWB 1HI6A 1HJBC 1UD6A 4PJ8D 2FWOA 2YRLA 1UASA 4N87A 3ZIYA 4DKAA 2BSSA 4Q56A 4UV4H 2V7HB 4PJBE 2GT9A 3QXTA 2WTRB 3QNZA 3VFNA 4AUJA 1QX1A 1OALA 3MRFB 1OAJA 1CK0L 1JGEB 3ZHNA 3CPUA 3LTVA 4OF5A 4JY6B 4XMVA 2EDNA 4JFXA 1G0DA 4UNTA 1RM1A 4W9CC 1CFTB 4Q9CA 1HSAB 3EYOA 5C9JB 4JFEA 1KFAL 1T1ZA 1LO4H 3SDCB 3HR5B 3SPJA 3C09C 2NT0A 3EYUH 3PWJA 3UZEA 1ZJBA 2V9TA 3K5RA 4M1DL 3NTCH 4XXDA 4DK6A 3F58L 3NCYS 3ZTJG 4U1LB 1RUAL 5BXFA 4XMWA 1RP8A 3L7EB 2BZ7A 1D9KA 4DHLA 5EU6E 4XO5A 5E5MA 3MJ6A 3AWFA 1PMYA 1VGKA 3FTYA 1MF2L 3VRIA 3GB7A 2JIXA 5HJ3B 4WI8A 1V7MH 3O6LH 1DVFD 2WVSA 1HHIA 5I5JA 1RIVH 3K2IA 4KDTA 4XZUB 2Y1YA 3MCG1 1PX8A 5FDYA 2K8MA 2X4TA 5AFAA 4G7YH 2AAVA 4E41E 4NGHL 1OT4A 3MRIA 3ROOA 3THML 4QRPD 2O72A 1KCWA 4UINL 5KVFH 5IWLC 3L1FA 2FLBT 2VW7A 1DVFC 3JV4B 2N01B 4LDOB 4L1TA 2GB2A 3BKCL 2P80A 3UG4A 2VMEA 5CKAA 5KBDA 5T33L 5JO5A 1FSKC 4POUB 1RURL 3CC5A 4Y8DC 4ODVH 1R46A 3MYJB 1CE1H 1GZQB 3CLFL 1LNUB 2PXYA 4J27A 3S96B 2MJWA 2VLJB 1WICA 3FKUS 1LEKA 5KWYC 4PJBA 2EZ0D 4ZMNA 2X28A 3VGAB 2G2RB 1T7XA 1MJ7H 1KEGH 1CS6A 3H2PA 4P2RB 3V4PA 4KMTH 1RUQH 4M6AA 2JI3A 3QUXD 4K9JA 4N1EA 4LSRH 2Y07H 5F7LB 3SDXF 2APXA 4JB9L 1AGEA 2YBRB 1FJ1A 2EZ0C 2VWEE 4M62L 1T4WA 5E9NA 3WHE1 1SXNA 1ZTXH 3T0DA 5LUMA 2WCPA 5KYXB 1QQDB 3QUXC 5DJ8A 5E51A 3K1DA 3LEYH 4XP5L 4OB5H 2HRHA 1G6RH 1EXUB 3I6KB 1WP6A 2BW5A 3NGBC 2JKSA 3MACL 5DC0A 4B6ZA 1SJXA 4TSCH 2CK0L 5EU6A 1QBBA 5DUPH 1UM6L 2EVFA 4BGLA 2BS71 3NABH 4KX9A 1NIEA 3S8FB 5E0FA 1J1OL 3MRLB 3OLDA 3EXLA 1TU2B 4L4TB 4UQDA 4ZFGL 1C9SA 2NOZA 1M9WA 2WYTA 5TF0A 1O9ZA 4H5SA 3KGSA 2FSEA 5IJVA 4X4XB 4ZW6A 5BS0D 2XQ0A 1UC6A 2FQDA 4OCWL 1R3HB 5DQDH 2H6OA 2OX5B 3CXDL 3CWSA 3IE9A 3H9SE 3CXFA 2HG5B 5FYLL 2FHCA 3GMLB 3SE3A 4E41A 4QCIA 5IKCA 2YA2A 5EDSA 1KJMA 3DGGA 4MB1A 4S1QL 4FLOA 1U3ZA 2NXYD 2UWEF 3O6KL 1KWKA 2LW3A 1C5CH 3QQNA 5C3TA 4LVNB 1D6VL 3VI4E 5CEZD 1UGNA 3GKZA 1J8SA 1KGUA 3TCTA 5LWYH 1RJLB 4N2EA 4MHHG 2VRQA 1X5HA 3RILA 3BUBA 4A7QA 4E42B 4W6YB 3O2VL 5TF1L 4NJ9L 5D1ZI 2BNRD 5EZOL 2YD8A 3QCTH 1TF4A 2AXGA 3EYQD 1IC4L 4M8VA 1G1OA 2DTML 5E2TH 1CI5A 3JYCA 1J86A 4RAVA 4P3CH 4EDWL 1Q1JH 3JWOC 3RUGA 3VI3A 1HOCB 3NUKA 1TQSA 3BO8B 5LNDA 2X0VA 2DEXX 1RZKL 4KK8D 2EICA 4OCNC 3CLEL 2EIDA 4RDQF 3EYQC 2Q8BL 5T1KA 1HQRA 1HEHC 2G60H 3BKJH 3U0WL 3WCYA 2I9LA 4K3GA 1IGCH 5C0BB 5BCAA 3WN5A 3HI6H 3WHE0 4UQEA 3FN9A 1ZHBB 3ABKB 4AM0Q 2X70A 4PGEA 3MZGB 2XWBB 5C0AB 3OKMA 3POHA 1ZD6A 4J2QA 4LLMB 3MBXL 5E2JA 4KK8C 2Y5QA 3NJVA 3NOIA 3STZA 2FBRA 5HY9A 1QRKA 3VU2A 4OU3A 2WZAA 4Y2LA 1IM9D 1TYRA 1WC7A 1GC1L 4PAZA 3T04D 1OW0C 1FAIH 1LO2L 2GJ6E 3S37H 1V7NL 2OFQA 4ZG1A 3H9SA 5C07D 4R4FH 3GIVB 2K45A 5DVMA 4AQOA 2OMVA 4OJDH 5JTWA 2Z92A 4WFEE 3HTLX 4AUUA 1GKOA 4FZ8H 2VDRH 3U7YL 3VI4A 4PLJD 5DD6A 4XAWL 2DQGH 2H4EA 4B27A 3CIQA 3TO4D 3JWDH 3MJ7B 3MU3A 3VWKC 1U9KA 1XSJA 1FZOA 4C58B 4JQIA 4PG9B 3RE0A 1N59B 3FXIC 4MD5A 4P9ML 1WHPA 4PLJC 4ZS7L 1A02N 1XL4A 1T1WA 1JPTH 5AALA 2CKBA 3OZ9L 2ZUVA 3MKKA 4Z95H 3VXTA 1KCVH 2UZYB 3HG0A 3LHPH 4PH8A 1XGZA 2HKFL 3PAVA 3GI9H 4AIOA 3OKKB 4XPGH 3HZVB 5L9DH 5LCVA 3SQOH 2EDFA 1XGUA 1YY9D 2WIIB 5AKRA 2Z31B 4HQQH 3TPUB 4ATTA 4YDVB 3LNFA 3L17A 3FQUA 1L9NA 4KK6D 2KLTA 1AR2A 3BVVA 4QXTB 5F6IB 1V3JA 4ENED 2XPZA 3L2MA 3DGCR 4AT6B 3BSHA 4B0AA 3PUCA 1XTLA 1NKRA 3K1KC 1YY9C 3KNBA 4A67A 4YHKL 1KTKE 2ATKB 1MW2A 4TRPL 3KW8A 1OD9A 1Z2KA 4X9FA 1FFOB 5DO2D 1YEKH 4KK6C 4WKZA 5ICYB 1FVEA 1N0XL 5G2NA 4NJAL 3UJIH 4M93C 4ENEC 4UYPA 1OGAE 3N1MC 4NQQA 3UTTB 4L1SA 4D0BB 3PWPB 4MJIB 2R1WA 5KANG 3T77A 4ZUUB 3P9MB 2YUWA 1GGCH 3R06B 3VXNB 3WGUB 1BHGA 1UWEH 3ASMA 5DO2C 1F97A 2NMSA 4RIRB 1JI1A 1BFTA 2V8MA 1CXLA 5I82A 1THCA 5CD5D 3VQ1C 1RULL 1YNTA 2R4RH 3B9KB 1IBBA 3BW9A 3ARGD 4PJ9A 4R83A 4KGLA 3WFCH 4CJ1A 1KYFA 4CADA 2XWXA 1G7PB 3OGOE 1A6UL 1BOGB 1CL7H 3OLPA 3AB0B 3CH8A 4PCYA 3AUWB 5IY5B 5DURB 3QXDA 4Z5RA 2VDLL 1INEH 4M48L 5CD5C 4JPKH 1HOEA 2VR9A 2E7LC 1IC1A 1N0LB 1MHEB 3ARGC 4HIHB 3V4UL 3HKFA 4W9ZA 3VFMA 4HAGA 2RACA 1MHPH 4JPQA 1F6LL 2WQRA 3FCTA 4HKBB 3V4PH 4ELMF 5C0JB 5KS9F 4PJAF 2Z1KA 2BOLA 3FAWA 3WIHA 3KM2A 4TV3A 1FFPB 3TCLA 3MV11 1CD8A 5LGKA 2UXVA 3KXFD 2JJVA 1F42A 2NY6B 2JCCF 2SEBA 3FRUB 4JFZH 4ZTPH 3S3CB 4ZMPA 4OLZL 4BZ2H 1P4LB 2NY4D 4TM9A 1NGYA 2FX7H 2DWDB 4WTXA 3K6DA 1G1CA 4KTYA 2J71A 5IR1B 4QY8A 4LPXA 3AY4C 1FV1A 4D0DB 2OKMA 2YPKB 1TG8A 3E7JA 4M8QB 5DD1L 2FJSA 4RA3A 3WJMB 1GS8A 1OGAA 3BH8B 3SKJL 3NEEA 5K9KA 3BZFB 3QUHA 2JELL 5B21A 4F57H 3TGXA 3GK8L 4H8VA 5KW9H 2A77L 5GGTH 2OTUB 3IGKA 1U92A 2YUZA 1V54B 2JPIA 1HHJA 4BE6A 1G4MA 1KLUA 2XA8L 5T3ZE 1GY2A 4P5MB 5EZIL 1N26A 4HHGA 3VFRB 5F0JB 1QHOA 3ULUD 4EI6A 3QUYD 1U4FA 4R8WL 4IRJA 1QLRA 4P5SA 4F27A 3RTQD 3CFKB 4N6RA 1Q9LA 3GC3A 4TUKH 1T83A 1JD7A 2EYSB 3QCVH 3FB8B 3DHJA 3ULUC 3WBDA 2ZWNA 2COQA 2X88A 4XE0A 4YE4L 1RZJH 1L3NA 3QUYC 5HHMD 3DBXB 4XO8A 2HL9A 2R5XA 1YPZE 5H37G 5CFAA 4PJCF 4OFKA 3RTQC 5LGJB 3MRJA 3IDIA 5C0FA 4WIQA 4PW4A 1N8ZA 3SQBA 1Z3RA 2ED9A 3LN4A 5JXAL 2ODIA 1UHVA 2R69A 4GINA 5DK0A 5E6IB 5EO1A 3NJLA 1K5WA 1UACL 1RKRA 2F58L 2FWUA 4RH4A 2ICES 1DDHB 4YDNA 3ZQ9A 4OIFA 4EMZA 1EAQA 1CVRA 3GM0A 5I1KH 5F7BA 4JM0A 3TLRA 2YEVB 4Q52A 1WCQA 3QXAB 2X6AA 3NIGE 2A99A 4XXWA 2QDWA 4GW4A 3WYRA 4WUUB 3T6ZA 1CFQB 1YEFH 2A83A 3H9HB 4AIZA 3NZHH 4KNTA 3G5VB 4F9LA 3L13A 5EBGA 5FGCE 2AXJA 4NUJA 3GSOA 4IIQB 3R4RA 3KBEA 5I8KH 4AQAA 3LRHA 4NI6A 3P4MB 3ESUF 5KVEE 3B2UC 3BIKB 1JPSL 5GS0L 3KWTA 4OCXH 4NKMA 3P11L 4GRLB 3L4ZA 3Q1SL 3FPXA 2Y23A 3WL9A 4MTMA 2AEPL 2F61A 1AHWC 3I6GA 4JZJC 4URTB 5INCB 4PRAA 2AC0A 4R96A 5E5UB 1S9YA 1YY8A 5AG9A 1U8HA 3GF8A 3AACA 1F3JA 3ATEA 3OWEA 4W70A 3VCLA 1D7DA 1I3UA 4IRSB 5EORH 1PKQB 4JHBA 1KXVA 2ROXA 2C4XA 4M3KB 4WO4A 4DQOL 1JAEA 2CGRL 4JKMA 3V7AE 4G8GD 3R1GH 4HFUL 2J3SA 1BWMA 5I18L 1YPZA 3C5ZB 4LIQH 1X5JA 3JV0A 4HJUA 3FMGL 1KN2L 5IESH 2GFBA 5C6TH 5AB0A 5I73B 3PNWB 4JM4L 2OJEB 1ZLUK 2EH7H 4KZ0A 4AL8H 3WFHA 4X2UA 4TF4A 5JMVD 4PD4K 3U6RB 3POCA 3NCEB 4NQUA 4XVOA 4K5NA 3ZY7A 2XZCH 2DQJH 1ZT4B 2YEZA 4PW9A 4ALAC 5FYKE 5LCVH 1QFWI 3STBA 4AJYV 2MSPA 3TIDB 3QC6X 1U30A 2UVEA 4QT5B 5DEGB 3BAJA 3TEZA 4JHWL 4UM8B 3MRHA 5FAAA 2BSBA 1I8KA 5GGRB 2P8MA 1PZAA 1UT2A 5F1KC 4NI3A 1JZ7A 4I7ZC 2DMHA 3GD1C 1HX0A 4G8IA 4NKOB 3D06A 1A21A 4NUGH 3T4YB 1JTOA 2ZCHH 3MRCA 1UYWH 1ZK5A 2AP2A 3OF6D 1P7BA 2CHWA 5ID1B 3CFBA 2BLFA 3BKQX 1PIGA 1XR8B 4FJ6A 2DQFA 4NZTH 5SWSA 4A66A 2I7SA 4OFQA 4KH2A 1DE4A 3OXSB 5TK2A 1A0QL 1FNSH 4LLWB 4JFDB 5C0CB 5ABZA 1A1OB 1UKSA 1F4HA 4OD1L 1GGIL 1M71B 4ZAKB 4F9PC 1SDDB 1XIWD 2QKIB 2PP7A 5AVZB 4R3SA 4FC3E 5D5ME 3ARDA 4OM1L 1VERA 1DVYA 3ISRA 1I8AA 5FKPB 2I9TA 4A7GA 2O61B 5H35B 3SGJC 1UEMA 3SQRA 4UNUA 3OKEB 2Z34A 3NN8A 3T6XA 3U0PA 4PD4J 4UT6H 1BMWA 3OSEA 3NCFB 3AQZA 4K3EH 6PCYA 2WXFA 2APTA 3JWNC 4W9DC 1JDYA 4PJIE 2DQ6A 3DVFA 3JUZA 1MFAL 2J5WA 2C3VA 4FAAB 5EEWA 4WVRA 2CUHA 4XPFL 1NFAA 4FKHA 5DD0L 2ESVD 2HRGA 3G5YA 5D93C 1RPUA 4N8PA 2WLZA 3SCMD 4CDHA 2J88H 4H4NA 2BRRH 2B4CC 4N2AA 4WHDA 4KAQL 3INOA 2Y7QA 1BD2E 4WNQA 3IDXH 1DSFL 2FSDA 2Q5BA 5IG7A 1OQXA 1Y0LB 1KB5A 1ZVNA 2G3ZA 4R0LA 1E5ZA 2WOYA 4HHAA 1FF5A 4WEUD 5CWSA 2OR7A 4MDJA 1NL0L 1Q90A 2D7TH 2YRPA 1C8PA 5BRZE 5EUKA 1RJYA 3SCMC 3ECBB 3C2SA 3BISA 4OR1A 3QFJA 2V9RA 3TBVB 4UMGA 4PGCB 4ZPTB 1G5AA 1OP9A 4HIXH 1GOFA 1AO7E 3ILDA 3D39D 4OUUA 3H8NA 5CGTA 4DVRL 1AGFA 3FFDA 5HGBA 3VE0A 1ZKAA 7TAAA 4CVWA 1TO5A 3TBTA 3IGAB 1QTPA 3AG3B 4FXGA 5F3BA 1FO0L 2HRPH 2CJSA 4TVPH 1ZV9A 2FUTA 5MEQB 2RIKA 3SDXE 3TV8A 2N7BA 3UMTA 4YDIL 4FEIA 1YEHL 4JFOB 4YSRA 1KFQA 2VSKB 4K7PH 5D5MA 5GRVK 1A3LL 3BAIA 4UU9B 3HR6A 4P2CG 1T1XA 3NRFA 1NBZA 3F10A 3ZN6A 1NMBL 1CF8L 1T7YA 2CO3A 4Z7AA 5IF0A 5IW6B 2CBOA 2DM3A 3V7MA 4ZSOB 4XC1L 7FABH 1BVNT 4JX0A 1HILA 4F8NA 1F1AA 3QDJE 2HVBA 4PJIA 3PE9A 2CK2A 2Z7WA 3S2AA 3MLTA 4K5LA 1HZHH 2XIDA 1ZSDA 3LQAC 3E1ZA 5F9OL 4GG8B 4EKXA 1L3WA 3WHXB 4J3BA 1WITA 4JANA 3F7PC 3SY0A 5B4MD 3ZZ1A 2VN3A 3ZE1F 4CVZA 3UO1H 1KELL 4J4PA 2EEXA 3OJDA 1B0RA 4E5XB 4MA1C 4MMXB 4MKTA 1VGEH 2YGOA 1ZEAL 3TA3C 1SUHA 5CGMA 4L18A 1CFBA 2GHZA 3P3TA 5BRZA 4PY7A 1JDCA 1GZHC 1AFVL 2XN9D 4K7FA 3NFNA 5EIQA 5ADPH 2UWEE 1WBZB 5B4MC 1Q0YL 5F0MB 4ODXB 5C1MB 2LR4A 1AO7A 1H6EA 3ZDXF 1B2WL 1CLYL 4JDTH 4D94A 2OYLA 2BVQB 1MHCA 3F7YA 2FGWH 4OIIL 5JZ7D 3EG9B 3W81A 1AGBB 5IQNA 1RZIA 3C08H 3RURA 4N2MA 2C9QA 4GMSH 3SDXA 4OLVH 4F1SA 4R4BA 5E8DL 3NZUA 2BPBA 3GHEL 4Y4HA 3HE6B 4H20L 3MLZL 1J48A 3RWEA 3VO0A 3BGMB 4DN3H 5JZ7C 2P44B 1G7JB 4EJYA 3D3VD 2WXPA 4N2NA 2R59A 3TJEH 5FCUL 3K4AA 1N10A 3HC4H 4PJXB 4WV1B 4KO9A 4ZXBB 1E4XI 1AY1L 2C3XA 3SB3A 4XBEL 1ES0A 2VLMD 5C9KA 3DARA 2A9CA 3QDJA 5SWZE 2BJMH 4N90D 1E67A 3J2PA 1BF8A 3VMNA 3LKOA 4JW3A 2WXJA 2E86A 2YO3A 1A2YA 2QRDA 3ATFA 4X7CC 5HDOA 4XVTL 3OHXA 5LAXA 5C92A 1OAXH 1YEGH 2ZCZA 2WANA 2R23B 1JWUA 4A68A 3SJVE 4BSJA 1O6TA 1P9MC 4ISVA 1XF2A 4PB9L 5HHQA 2WQ8A 4KTDH 2E7HA 5DD3H 4PRPD 5E2UH 4X9YA 2BIIA 2WB7A 4UB0H 1J5CA 5J9PB 1DQIA 2IJ0C 3FO0L 4DERA 5BVPL 5BQ7B 2UWEA 1BJ1J 4QRRE 2OSLB 1MELA 2VISB 2BY1A 3LS5H 4JM2F 2MPVA 3TV3H 1RY7B 4GSRA 2X7LB 4QYOA 3FC8A 1FL6B 1AYOA 2NW3A 4H26A 4O2EA 3FQWA 4MA7H 2XXFA 3MJ9H 2DLFH 4B9PA 4GAGH 3G08B 4OCYL 2IBZY 4YXKH 3DO4A 2LABA 3LSOB 3QJQB 2ALAA 2LU4A 2Y6SD 3WD5L 2H1LM 2WINB 2ZX8A 4HETA 5FF6A 3I0XA 3TONA 1AQ8A 2H1XA 1X5AA 1WIUA 4G9FD 4JDEB 3IJ8A 2M83A 1KLGA 3HG3A 4ONFH 4OZIF 2OMBA 1R5VB 3MXVH 2Y6SC 2OTWA 4U6XB 5HHOE 4ZUSA 1NOLA 5DUMH 4FG0A 2VDNB 3QEHB 5SWZA 1NAKL 2ZWYA 2XETA 2BZDA 3ZQWA 4C8XA 2CLVB 4JN1L 2MQGA 5DQJB 3TT1L 3TYFB 1QR1B 2IWKA 1AQKH 4M00A 3NT0A 5JQ6L 1WZAA 4A6YA 1UB6B 4AG4L 5F7FA 1KB3A 3ZDZB 1F11B 4GP4B 3SJVA 4HXBL 2CA4A 2NTFA 1OAYL 3JTTA 4FHJA 3PS6A 4JL1A 5K39A 3PIQA 5DJYB 4EI5B 1F3RB 2OI9B 2EVIA 4OZHF 2CM5A 3K5SA 5KG9A 2HG0A 1X3DA 2BP0B 4KNUA 4QRRA 1G0XA 4IHBA 1FNGB 1KTLA 3M7FB 1P1ZB 4P2OD 4F5CE 3IMRA 1CU4H 2E6QA 4JPVH 4GB9A 5I1CH 4FXKC 3IJYB 5CXPA 3IFOA 4NQED 4LQFL 1VACB 2GUOA 3GZOA 3O2DH 4KJWD 3AM8C 4ODSH 4WWPA 1UFGA 5C09E 3W57A 3L95A 5C2BH 1EZVY 4LDLB 4Y4KB 4PRBA 4MDRA 4P4KD 5TDNB 5E95B 3HPLA 4ANUA 4P2OC 2C3WA 3L3GB 3MROB 2NOIA 5GSVB 3WY4A 1QFWL 3BPCA 5ILTL 4ELME 4JLRA 2CRZA 2XX1A 2YGNA 4PJAE 4JFFB 5AYUL 5KS9E 4Z8FL 1YMMB 4KJWC 3FFCB 1DLHA 2F53E 2Z6FA 2JKWA 4IOIB 4BFBD 1T5XA 1IARB 5HHOA 4P4KC 2JCCE 2WO3B 3OD3A 5HDBF 1JYNA 4RZCA 5D7LE 2IDCA 4HLJA 1W0WB 4WXAA 3GSUB 2AJ3A 3S5LB 4U2YA 2YBGA 4DETA 1DN0A 2AJZB 2DY2A 4D9RD 3ZL1A 1SUJA 3CBJB 1EUVA 2P8LB 4UWQB 5ECGA 3P69A 2C9UA 3K2UL 2FRGP 3MCKB 2L7QA 2YS4A 3QCUL 4Q89A 1T6VN 2ZAIA 3QDGD 5T1LA 4MMZB 3GRBA 1HDMA 4JUSA 4NHCH 1IM3D 2VR5A 1YQRA 2TSAA 4XPHL 4OLWL 5CR8A 4EXKA 4JRYE 4X6FA 3GJEB 1X5FA 3MNZB 2RCSL 3QK0A 2RJMA 2K3HA 1ZTMA 2ZUUA 4RDBA 2VERA 3CVIH 4BCYA 4G2AA 4BINA 1QRNE 4QRUA 4IKLA 2DH3A 3VRLF 2VGLM 5C0RH 4JFPA 2EC9T 1I8IA 3V6ZA 3BCDA 5CBAB 1DVQA 3ILPA 2VDOL 4LFHD 1BIIB 4F5CA 5AW5B 1A6TB 1G7LB 3BXNB 1QSFE 4MXQC 3RQ3A 3FQ2A 5DQ9A 2CDEB 1ZT7A 2AJVH 2R2EA 5JHMA 2C1OA 2NUTB 5C09A 4QD2E 3M07A 3ZRSA 4Z76B 2XFXB 1O9VA 3QE5A 4M9PA 1GYAA 2Q7YB 2PPCA 4BJUA 3F85A 3RWIB 3O4LE 1MOEA 4PJCE 5IT2L 4IMLA 3D9AH 3IAPA 4QXWA 3IDYB 5ESQA 2I85A 5E1GA 4ZTEA 1I8MA 4FQCL 1K8DB 2F53A 4IRZH 4NFDA 4XP9L 1VB9A 3FUJA 2CAKA 5ALCH 3QZNA 5I6OA 4L05A 1KLFB 3O45A 1NPUA 1K8IA 2IXQB 2JCCA 4OZGA 5FYKU 3IDMB 3RGVA 5D7LA 5EPMA 3CFEA 5IQ7H 3IFNH 5EOTA 4N8UA 2QQLH 1YNLH 2WXHA 4L1LA 2I07B 1T0OA 1HTYA 3KPSD 5ABAA 3T8XB 4Z7OB 1RMFL 4WI0B 4CN4A 4PB0L 3N41B 3SPHA 4QXGL 4BFIB 4Q97A 3CVDA 3BPLB 5CMAB 3VFTB 3NSFA 5FPIA 2XX0A 4Z7NF 3QJOA 2MCPH 1LXMA 2Y3NA 1EEZA 2GPZA 1JWSB 3BAYA 4K73A 3LKNB 3Q8BA 3V55A 3ZMNA 4JRYA 1ZV5A 3S88H 4WI3A 1BVZA 3N42B 5BMNA 2AXFB 2YSSB 1O0VA 2DWSA 4XMPH 1IQDB 2ARJA 2R0LH 1XGYH 2IQ9L 1WHOA 1QRNA 2QFPA 3KR3H 3O41B 4J5VA 1CN4A 3VFWB 3KDPB 2B39A 4RFNB 4AUYA 4NDMB 3FN0H 2AQSA 1P7KB 5I26A 3F7RA 3C8HA 5GS2H 2C7UB 2R2HB 4LCIL 3DUSA 1X5YA 1HN1A 3GS0A 1QSFA 1ET7A 2IANB 2R0KH 2CQVA 2NY5L 3D2UB 5DHEA 5DHYA 5HYJD 1S7TB 3WTVA 2F5AH 1QFHA 4U6VL 4CUCA 3KWVA 1H3UA 1UA3A 4KXZI 3AMLA 3O4OC 2XWJA 3VX1A 3EJTA 5IIEB 3O4LA 1NFKA 32C2A 3MRPA 3QORA 4PJCA 1H9VA 3VSVA 5K69A 1SQMA 3UTSB 4FJYA 2AK1H 1XMEB 1OM3H 5D7IB 2J43A 1N5AA 1OT1A 2J73A 3ALWA 3RY4A 1GTFA 3L8QA 4QHMB 2Q8AL 2VDQH 3PRZA 3TJHD 3HUJF 4ZO9A 3E80A 4FQ1L 3DECA 2VN6A 3FF7A 1EHNA 1PNDA 4XOCA 4AYEC 2JOIA 2D3VA 2O1AA 4G5ZH 2H32A 2YGPA 3KL0A 4JKPH 4O5LH 4P23D 1OTSC 5D8JL 5L2KA 2ENJA 4MWFB 1ZPUA 4ADGA 4JR9H 5E00A 1IUZA 3B2VH 1QFOA 4YL9A 3ULVL 5E0QA 4NT6B 4XPTH 3CZLA 3TJHC 3CWTA 2OJZH 1AKJA 2OXHB 1NKGA 4ANXA 4QIRA 3VAEA 3L1OL 4P23C 4C56B 5JNYA 3X13A 3N06B 1I1YA 5GJTH 4PRIE 4JN2B 3TFKD 1ZT1A 3MBEA 3TBSB 4I9WD 2NR6D 4X7DC 5IK3A 5E4OA 3I9AA 1KIPA 1T21A 1T6WA 4CGTA 3QJVB 1X44A 5BW7A 5IEKA 3FSAA 4ZNCD 2ZUQB 4AJ0A 1R19A 4PWKA 3WXWH 5EV7A 3SKUD 3U30C 3AREB 5A7EA 4QRSA 3TFKC 2J20A 3O6FA 5F70A 5HVWA 1F3DH 3U4EA 2NR6C 2V17H 3DKHA 4AMXA 1PYWB 1KGJA 2FYVA 1TSRA 3I2CL 4MRCA 5KSAA 1NWOA 5MEND 4JG0L 3C60B 1TZAA 2OMTA 4GAYA 1ZGLP 4BH8B 4EIUA 2GQHA 4O02L 1NCOA 2FECL 3L7FA 1DVZA 5GS1B 4BSVA 3T09A 2BNUB 5CM1A 2YC1B 3PWUB 5AW9B 3MNVA 1OM9A 3L54A 3SO3C 2J8HA 4WW2C 2ZCKL 3RWCA 5B3SB 3UZQA 2R56L 5IBLD 4L4VE 2YD9A 1OF0A 2Z0FA 4A55A 5EBWB 4NQDB 2VN5A 2P5PA 4HWEH 4P48A 1C47A 1AMYA 3GMQB 3MFFB 3L4CA 2DLHA 1U8CA 1KJ3H 1J10A 1WZMA 4U1MB 2ICEA 3AG2B 3OL2A 5CEYB 3WKML 2XNAB 1E5CA 5IBLC 3VB8A 5C0GB 3VDCA 3VWJB 3OKDA 1H6FA 3M6DA 3MXWH 1IGYB 4NP9A 1UB5A 3QHTC 3C04A 1FPTL 1ZA3A 4RNRB 2Y36L 1O5DT 1A14H 4HK0B 4FQXD 1GJWA 2JHJA 1KACB 3P77B 1LO5B 1U8KB 1Z1WA 3FAXA 3MA7B 1WA1X 4R7VA 5HYSG 4P59H 2FATL 3NJGA 4I88A 3IJ7A 4NKQB 1MFNA 1USZA 2B16A 2ENPA 4PRIA 5ACZA 5IZ7A 2A2QT 2PYEB 3IWVA 2J72A 4JZOA 3LRMA 4G8EA 5L0QC 2IBBA 1FIEA 3WO4B 4FQXC 2OW6A 3X11B 4TOYH 3GHBH 3DX9B 1D3UA 4NPKA 1I7TA 2P5EB 2ZNXA 1PG7W 1MIEL 3BFQG 4BKLB 4U1HB 2Z1PA 2PP8A 1JMZA 4LP5A 1YNKH 3SKMA 2DWTA 4M1CD 4UAOC 2IPTH 1AJ7H 1J1XL 5B1JC 3WTWA 3NPSB 1CZ8L 1ROCA 5HDRA 3WNLA 4XXCC 4FYQA 1Q9WA 2Y9RT 3GINA 3W0WD 3RL2B 4HSAC 2R2BB 3EYVA 2BVYA 4WJ5A 1HCVA 2X0UA 3AS0A 4J6RL 4KFMA 5EC2A 3HN5A 5FGRA 5BMFL 3IKCA 4M1CC 4L4VA 4NYLA 5EEZA 2VKXA 1NCJA 3ARFA 1XGPB 3A67H 3WNKA 1E28A 4JZNB 4ANKA 1UGKA 4DP4X 4HOXA 2CIKB 1LWJA 2B9BA 4YHIA 3LV3A 2PO6A 4PTTA 4QNPF 3U4KA 5TE4H 3APNA 3DUUB 4HIIA 3ZLQC 4A39A 2B1OA 4P99A 3BFOA 3HI5H 1ZLSH 5JIPA 3QIBA 4XX5A 5D70H 3V0WH 2KZWA 4DGIL 3QWOA 4N9GA 5HDLA 2HJKA 1EGJA