2PWWA

Crystal structure of abc2387 from bacillus clausii
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
115
structure length
115
Chain Sequence
SLKFPDTGLEEKEVAFSIVNHAAKSLGFIHVDQWDYERVMFDYKIVHHEGTFYLRVPAYAVKGEIPRPSTIVQIMTPILGKYYYPHGVEYEGETFPQAVIDKCNNKLALLAKTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of ABC2387 from Bacillus clausii.
rcsb
source organism Bacillus clausii
total genus 29
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2007-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08868 YugN YugN-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.100 Alpha Beta 2-Layer Sandwich TATA-Binding Protein YugN-like 2pwwA00
2R5XA 2PWWA
chains in the Genus database with same CATH superfamily
1KY6A 2FKFA 3ENCA 5BMNA 2HZSA 1UT7A 3CVTA 3ENOC 3F10A 3N89A 4WZSD 1QNAA 1JFIC 1M5Q1 2DKCA 3OSTA 1KYUA 2Z8UA 3TE5A 3OSEA 3DPUA 3OH6A 1N3AA 3CWUA 3ASMA 3H1ZA 4CFFA 3EAYA 4ROEB 3DPTA 3TDHA 1VOLB 1P5GX 2PWWA 2QRDA 4D7RA 1C47A 1MP9A 2Y8LA 4Q11A 2HZMA 1KYDA 3T4NA 3I0XA 2NOLA 3EIKA 5IYBP 2D0BA 2V8QA 3VN5A 3HS9A 4HJHA 4RODB 1PCZA 2QR1A 3KTUA 2FUVA 3SNSA 3OLPA 4IL8A 1LWVA 1AISA 1QNBA 2NLVA 3NA5A 1TBPA 1K2YX 2V9JA 3KRMA 3CVSA 2LAEA 1FN7A 1YQKA 1LWWA 2R5XA 4ROCB 3OH9A 4EAJA 2NWVA 3RPJA 1M3HA 1TBAB 3BKQX 2NOFA 1EUVA 2HKPA 2EHBD 1RM1A 2F7LA 4EAKA 2Y8QA 1QN8A 1UT4A 3HS8A 1W80A 4DULA 2D0AA 4PY5A 1QN6A 5BMPA 5HSHA 2IV8A 1E42A 2JPIA 4EJZA 5AN4A 2VJ0A 2OOXA 1TUOA 5JMVD 1VOKA 2I5WA 5IYDP 1QN3A 5IYCP 1NVPA 2MZ8A 2H5AX 2YH5A 1LWYA 1KYFA 5JN5A 1MPGA 4I8OA 1T6AA 1PVSA 1B9KA 1YTFA 1KY7A 3C04A 3CWAA 2NOHA 2NOEA 1YTBA 2NOZA 4EJYA 2NVMA 2XHIA 3D4VA 2FGTA 4WXAA 4C7PA 3CWTA 2JOIA 2QRCA 1LXTA 1JDYA 1PCJX 2O3OA 1QN5A 2DKDA 1V5SA 2V92A 1QNCA 1TGHA 1KFIA 4TPSA 3I0WA 2NOBA 2HL8A 1NGMA 3F0ZA 1NH2A 2QLVA 2D0CA 1R4XA 1VTLE 2QREA 4EALA 1VTOA 1QTPA 1QN4A 1YQMA 5KL0A 3CWSA 1Q9UA 1YQLA 1M3QA 4EAIA 1C9BB 3I3WA 1UL7A 1WJWA 3OSMA 1YQRA 5F9CA 2JHJA 3PDKA 1PZDA 2G30A 2FKMX 2H4LX 3RSMA 1N3CA 1J3MA 1N39A 4WX8A 1D3UA 2HL9A 1QN9A 1HU0A 3OGDA 4QG5A 5EPCA 4BJUA 1K35A 1KFQA 1DIZA 3OC3C 1KO9A 1PCMX 3ULXA 3CW7A 2OOYA 4MRQA 1QNEA 2Z0FA 1VKLA 2JHNA 1XSZA 1CDWA 2IV9A 4D7QA 1QTSA 1WQAA 4EAGA 2YA3A 2NOIA 2ZFDB 1EBMA 3UW2A 1C4GA 2DKAA 4B0AA 2MJ7A 3OCIA 3PMGA 3IH7A 3D7QA 1QN7A 1P5DX
chains in the Genus database with same CATH topology
2R5XA 2PWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5X A;  2PWW A; 
#chains in the Genus database with same CATH topology
 1KY6 A;  2FKF A;  3ENC A;  5BMN A;  2HZS A;  1UT7 A;  3CVT A;  3ENO C;  3F10 A;  3N89 A;  4WZS D;  1QNA A;  1JFI C;  1M5Q 1;  2DKC A;  3OST A;  1KYU A;  2Z8U A;  3TE5 A;  3OSE A;  3DPU A;  3OH6 A;  1N3A A;  3CWU A;  3ASM A;  3H1Z A;  4CFF A;  3EAY A;  4ROE B;  3DPT A;  3TDH A;  1VOL B;  1P5G X;  2PWW A;  2QRD A;  4D7R A;  1C47 A;  1MP9 A;  2Y8L A;  4Q11 A;  2HZM A;  1KYD A;  3T4N A;  3I0X A;  2NOL A;  3EIK A;  5IYB P;  2D0B A;  2V8Q A;  3VN5 A;  3HS9 A;  4HJH A;  4ROD B;  1PCZ A;  2QR1 A;  3KTU A;  2FUV A;  3SNS A;  3OLP A;  4IL8 A;  1LWV A;  1AIS A;  1QNB A;  2NLV A;  3NA5 A;  1TBP A;  1K2Y X;  2V9J A;  3KRM A;  3CVS A;  2LAE A;  1FN7 A;  1YQK A;  1LWW A;  2R5X A;  4ROC B;  3OH9 A;  4EAJ A;  2NWV A;  3RPJ A;  1M3H A;  1TBA B;  3BKQ X;  2NOF A;  1EUV A;  2HKP A;  2EHB D;  1RM1 A;  2F7L A;  4EAK A;  2Y8Q A;  1QN8 A;  1UT4 A;  3HS8 A;  1W80 A;  4DUL A;  2D0A A;  4PY5 A;  1QN6 A;  5BMP A;  5HSH A;  2IV8 A;  1E42 A;  2JPI A;  4EJZ A;  5AN4 A;  2VJ0 A;  2OOX A;  1TUO A;  5JMV D;  1VOK A;  2I5W A;  5IYD P;  1QN3 A;  5IYC P;  1NVP A;  2MZ8 A;  2H5A X;  2YH5 A;  1LWY A;  1KYF A;  5JN5 A;  1MPG A;  4I8O A;  1T6A A;  1PVS A;  1B9K A;  1YTF A;  1KY7 A;  3C04 A;  3CWA A;  2NOH A;  2NOE A;  1YTB A;  2NOZ A;  4EJY A;  2NVM A;  2XHI A;  3D4V A;  2FGT A;  4WXA A;  4C7P A;  3CWT A;  2JOI A;  2QRC A;  1LXT A;  1JDY A;  1PCJ X;  2O3O A;  1QN5 A;  2DKD A;  1V5S A;  2V92 A;  1QNC A;  1TGH A;  1KFI A;  4TPS A;  3I0W A;  2NOB A;  2HL8 A;  1NGM A;  3F0Z A;  1NH2 A;  2QLV A;  2D0C A;  1R4X A;  1VTL E;  2QRE A;  4EAL A;  1VTO A;  1QTP A;  1QN4 A;  1YQM A;  5KL0 A;  3CWS A;  1Q9U A;  1YQL A;  1M3Q A;  4EAI A;  1C9B B;  3I3W A;  1UL7 A;  1WJW A;  3OSM A;  1YQR A;  5F9C A;  2JHJ A;  3PDK A;  1PZD A;  2G30 A;  2FKM X;  2H4L X;  3RSM A;  1N3C A;  1J3M A;  1N39 A;  4WX8 A;  1D3U A;  2HL9 A;  1QN9 A;  1HU0 A;  3OGD A;  4QG5 A;  5EPC A;  4BJU A;  1K35 A;  1KFQ A;  1DIZ A;  3OC3 C;  1KO9 A;  1PCM X;  3ULX A;  3CW7 A;  2OOY A;  4MRQ A;  1QNE A;  2Z0F A;  1VKL A;  2JHN A;  1XSZ A;  1CDW A;  2IV9 A;  4D7Q A;  1QTS A;  1WQA A;  4EAG A;  2YA3 A;  2NOI A;  2ZFD B;  1EBM A;  3UW2 A;  1C4G A;  2DKA A;  4B0A A;  2MJ7 A;  3OCI A;  3PMG A;  3IH7 A;  3D7Q A;  1QN7 A;  1P5D X; 
#chains in the Genus database with same CATH homology
 2R5X A;  2PWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...