3OSMA

Structure of the kinase associated domain-1 (ka1) from kcc4p
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
KPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lipid binding protein
molecule keywords serine/threonine-protein kinase KCC4
publication title Kinase Associated-1 Domains Drive MARK/PAR1 Kinases to Membrane Targets by Binding Acidic Phospholipids.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 32
structure length 119
sequence length 119
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16797 Fungal_KA1 Fungal kinase associated-1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.220 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3osmA00
3OSTA 3OSMA
chains in the Genus database with same CATH superfamily
2JHNA 3IH7A 1N3CA 1QN8A 2JHJA 2EHBD 3I0WA 2Z8UA 1QN3A 1M3HA 3DPTA 4PY5A 2PWWA 3OSMA 1MP9A 2IV9A 1D3UA 4EALA 2XHIA 4C7PA 1VOKA 3H1ZA 2QRDA 3ENOC 5JMVD 1V5SA 1PCJX 1EUVA 5KL0A 1LWYA 2HL8A 3TDHA 3D4VA 3KRMA 1NVPA 2D0AA 3CVSA 2DKCA 3F10A 1RM1A 2QRCA 3KTUA 3CW7A 1C9BB 3ENCA 4ROEB 3VN5A 4ROCB 1N3AA 1YTBA 5EPCA 1QN6A 2NOFA 3CWTA 5IYDP 4EAGA 5HSHA 2MZ8A 4EAIA 2IV8A 1K35A 2HZSA 2D0BA 1JDYA 2Y8QA 2ZFDB 2NOLA 2NOIA 1C47A 1PCZA 1LXTA 3OH9A 1HU0A 3TE5A 2V9JA 5BMPA 2QLVA 1FN7A 1YQKA 3T4NA 3C04A 1NH2A 1W80A 1TBAB 4BJUA 3OH6A 3RPJA 3ULXA 1VKLA 1QNBA 1M3QA 1KYDA 2FUVA 1QN9A 2HZMA 1EBMA 1PZDA 1NGMA 4CFFA 1N39A 3PDKA 1QTSA 3OC3C 2V92A 1QTPA 3CVTA 4DULA 2O3OA 3I3WA 1XSZA 1VTOA 1VTLE 2NOHA 2H4LX 2NOBA 1C4GA 1JFIC 3CWSA 3HS9A 1YTFA 2NOEA 1KYUA 5JN5A 1DIZA 2NOZA 3I0XA 1KY7A 1TBPA 5AN4A 1T6AA 2D0CA 1YQLA 2R5XA 1QN7A 4D7QA 4WX8A 1QNEA 4EJZA 1M5Q1 1KFIA 1KY6A 1P5DX 1QNCA 2F7LA 1E42A 1WJWA 2NWVA 3UW2A 2LAEA 3OSTA 2DKAA 4IL8A 5IYCP 1B9KA 4Q11A 1YQRA 3N89A 3DPUA 4D7RA 3HS8A 1QNAA 3SNSA 4QG5A 1KFQA 3ASMA 2OOXA 1LWVA 1KYFA 2MJ7A 3BKQX 3EAYA 1TUOA 2V8QA 2YA3A 3CWAA 2FGTA 1CDWA 2FKFA 1R4XA 2QR1A 1VOLB 5F9CA 3NA5A 5IYBP 1WQAA 4TPSA 4B0AA 1AISA 2G30A 2JOIA 1QN5A 3OCIA 3F0ZA 4I8OA 3EIKA 3CWUA 1YQMA 3PMGA 1UL7A 4WZSD 4MRQA 4EAJA 1UT7A 1Q9UA 2HL9A 4RODB 2NLVA 1QN4A 2HKPA 2I5WA 1PCMX 2H5AX 1PVSA 1UT4A 4HJHA 2FKMX 3RSMA 3OLPA 1TGHA 4EAKA 2YH5A 3OSEA 1MPGA 2QREA 2DKDA 5BMNA 1K2YX 4EJYA 2OOYA 2Y8LA 3D7QA 2VJ0A 1J3MA 3OGDA 1LWWA 1KO9A 1P5GX 2Z0FA 4WXAA 2NVMA 2JPIA
chains in the Genus database with same CATH topology
3IH7A 1N3CA 1QN8A 4PY5A 1QN3A 3I0WA 2Z8UA 1M3HA 3DPTA 3OSMA 1MP9A 2IV9A 1D3UA 2XHIA 1VOKA 3H1ZA 1LWYA 3KRMA 1NVPA 2D0AA 3F10A 1RM1A 3KTUA 1C9BB 4ROEB 3VN5A 4ROCB 1N3AA 1YTBA 1QN6A 2NOFA 5IYDP 2MZ8A 2IV8A 2NOIA 2D0BA 2NOLA 1PCZA 1HU0A 1FN7A 1YQKA 1NH2A 1W80A 1TBAB 3RPJA 3ULXA 1QNBA 1M3QA 1KYDA 1QN9A 2HZMA 1EBMA 1PZDA 1NGMA 1N39A 1QTSA 3OC3C 1QTPA 4DULA 2O3OA 1VTOA 1VTLE 2NOHA 2NOBA 1JFIC 3HS9A 1YTFA 2NOEA 1KYUA 2NOZA 3I0XA 1KY7A 1TBPA 5AN4A 2D0CA 1YQLA 1QN7A 1QNEA 4EJZA 1KY6A 1QNCA 1E42A 2LAEA 3OSTA 5IYCP 1B9KA 4Q11A 1YQRA 3N89A 3DPUA 3HS8A 1QNAA 3SNSA 3ASMA 1LWVA 1KYFA 2MJ7A 2FGTA 1CDWA 1VOLB 1R4XA 5IYBP 4B0AA 4TPSA 1AISA 1QN5A 2G30A 2JOIA 3OCIA 3F0ZA 4I8OA 3EIKA 1YQMA 4WZSD 1UT7A 4RODB 1QN4A 2I5WA 1UT4A 1TGHA 2YH5A 4EJYA 2VJ0A 1LWWA 1KO9A 2HZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OST A;  3OSM A; 
#chains in the Genus database with same CATH topology
 2JHN A;  3IH7 A;  1N3C A;  1QN8 A;  2JHJ A;  2EHB D;  3I0W A;  2Z8U A;  1QN3 A;  1M3H A;  3DPT A;  4PY5 A;  2PWW A;  3OSM A;  1MP9 A;  2IV9 A;  1D3U A;  4EAL A;  2XHI A;  4C7P A;  1VOK A;  3H1Z A;  2QRD A;  3ENO C;  5JMV D;  1V5S A;  1PCJ X;  1EUV A;  5KL0 A;  1LWY A;  2HL8 A;  3TDH A;  3D4V A;  3KRM A;  1NVP A;  2D0A A;  3CVS A;  2DKC A;  3F10 A;  1RM1 A;  2QRC A;  3KTU A;  3CW7 A;  1C9B B;  3ENC A;  4ROE B;  3VN5 A;  4ROC B;  1N3A A;  1YTB A;  5EPC A;  1QN6 A;  2NOF A;  3CWT A;  5IYD P;  4EAG A;  5HSH A;  2MZ8 A;  4EAI A;  2IV8 A;  1K35 A;  2HZS A;  2D0B A;  1JDY A;  2Y8Q A;  2ZFD B;  2NOL A;  2NOI A;  1C47 A;  1PCZ A;  1LXT A;  3OH9 A;  1HU0 A;  3TE5 A;  2V9J A;  5BMP A;  2QLV A;  1FN7 A;  1YQK A;  3T4N A;  3C04 A;  1NH2 A;  1W80 A;  1TBA B;  4BJU A;  3OH6 A;  3RPJ A;  3ULX A;  1VKL A;  1QNB A;  1M3Q A;  1KYD A;  2FUV A;  1QN9 A;  2HZM A;  1EBM A;  1PZD A;  1NGM A;  4CFF A;  1N39 A;  3PDK A;  1QTS A;  3OC3 C;  2V92 A;  1QTP A;  3CVT A;  4DUL A;  2O3O A;  3I3W A;  1XSZ A;  1VTO A;  1VTL E;  2NOH A;  2H4L X;  2NOB A;  1C4G A;  1JFI C;  3CWS A;  3HS9 A;  1YTF A;  2NOE A;  1KYU A;  5JN5 A;  1DIZ A;  2NOZ A;  3I0X A;  1KY7 A;  1TBP A;  5AN4 A;  1T6A A;  2D0C A;  1YQL A;  2R5X A;  1QN7 A;  4D7Q A;  4WX8 A;  1QNE A;  4EJZ A;  1M5Q 1;  1KFI A;  1KY6 A;  1P5D X;  1QNC A;  2F7L A;  1E42 A;  1WJW A;  2NWV A;  3UW2 A;  2LAE A;  3OST A;  2DKA A;  4IL8 A;  5IYC P;  1B9K A;  4Q11 A;  1YQR A;  3N89 A;  3DPU A;  4D7R A;  3HS8 A;  1QNA A;  3SNS A;  4QG5 A;  1KFQ A;  3ASM A;  2OOX A;  1LWV A;  1KYF A;  2MJ7 A;  3BKQ X;  3EAY A;  1TUO A;  2V8Q A;  2YA3 A;  3CWA A;  2FGT A;  1CDW A;  2FKF A;  1R4X A;  2QR1 A;  1VOL B;  5F9C A;  3NA5 A;  5IYB P;  1WQA A;  4TPS A;  4B0A A;  1AIS A;  2G30 A;  2JOI A;  1QN5 A;  3OCI A;  3F0Z A;  4I8O A;  3EIK A;  3CWU A;  1YQM A;  3PMG A;  1UL7 A;  4WZS D;  4MRQ A;  4EAJ A;  1UT7 A;  1Q9U A;  2HL9 A;  4ROD B;  2NLV A;  1QN4 A;  2HKP A;  2I5W A;  1PCM X;  2H5A X;  1PVS A;  1UT4 A;  4HJH A;  2FKM X;  3RSM A;  3OLP A;  1TGH A;  4EAK A;  2YH5 A;  3OSE A;  1MPG A;  2QRE A;  2DKD A;  5BMN A;  1K2Y X;  4EJY A;  2OOY A;  2Y8L A;  3D7Q A;  2VJ0 A;  1J3M A;  3OGD A;  1LWW A;  1KO9 A;  1P5G X;  2Z0F A;  4WXA A;  2NVM A;  2JPI A; 
#chains in the Genus database with same CATH homology
 3IH7 A;  1N3C A;  1QN8 A;  4PY5 A;  1QN3 A;  3I0W A;  2Z8U A;  1M3H A;  3DPT A;  3OSM A;  1MP9 A;  2IV9 A;  1D3U A;  2XHI A;  1VOK A;  3H1Z A;  1LWY A;  3KRM A;  1NVP A;  2D0A A;  3F10 A;  1RM1 A;  3KTU A;  1C9B B;  4ROE B;  3VN5 A;  4ROC B;  1N3A A;  1YTB A;  1QN6 A;  2NOF A;  5IYD P;  2MZ8 A;  2IV8 A;  2NOI A;  2D0B A;  2NOL A;  1PCZ A;  1HU0 A;  1FN7 A;  1YQK A;  1NH2 A;  1W80 A;  1TBA B;  3RPJ A;  3ULX A;  1QNB A;  1M3Q A;  1KYD A;  1QN9 A;  2HZM A;  1EBM A;  1PZD A;  1NGM A;  1N39 A;  1QTS A;  3OC3 C;  1QTP A;  4DUL A;  2O3O A;  1VTO A;  1VTL E;  2NOH A;  2NOB A;  1JFI C;  3HS9 A;  1YTF A;  2NOE A;  1KYU A;  2NOZ A;  3I0X A;  1KY7 A;  1TBP A;  5AN4 A;  2D0C A;  1YQL A;  1QN7 A;  1QNE A;  4EJZ A;  1KY6 A;  1QNC A;  1E42 A;  2LAE A;  3OST A;  5IYC P;  1B9K A;  4Q11 A;  1YQR A;  3N89 A;  3DPU A;  3HS8 A;  1QNA A;  3SNS A;  3ASM A;  1LWV A;  1KYF A;  2MJ7 A;  2FGT A;  1CDW A;  1VOL B;  1R4X A;  5IYB P;  4B0A A;  4TPS A;  1AIS A;  1QN5 A;  2G30 A;  2JOI A;  3OCI A;  3F0Z A;  4I8O A;  3EIK A;  1YQM A;  4WZS D;  1UT7 A;  4ROD B;  1QN4 A;  2I5W A;  1UT4 A;  1TGH A;  2YH5 A;  4EJY A;  2VJ0 A;  1LWW A;  1KO9 A;  2HZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...