1UL7A

Solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
GSSGSSGRFTWSMKTTSSMDPSDMMREIRKVLGANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Solution structure of the kinase-associated domain 1 of mouse microtubule-associated protein/microtubule affinity-regulating kinase 3
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 102
sequence length 102
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02149 KA1 Kinase associated domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 1ul7A00
1UL7A 3TE5A 2QR1A 2QLVA 2V8QA 2EHBD 2ZFDB 2OOYA 1V5SA 3OSEA 4EAIA 2V92A 3TDHA 4EAKA 4EAGA 2Y8QA 2QRDA 4EALA 2QREA 2V9JA 2Y8LA 4CFFA 2QRCA 2OOXA 2YA3A 3T4NA 4EAJA
chains in the Genus database with same CATH superfamily
3ULXA 2FUVA 1TBAB 3CVTA 3DPTA 1QN3A 4IL8A 4EJYA 1EBMA 2H5AX 3F10A 4Q11A 3RSMA 4ROEB 3CVSA 1N3AA 1QN5A 1KYDA 2HL9A 1R4XA 3PDKA 3SNSA 1PZDA 1VTLE 5KL0A 1FN7A 1C4GA 2ZFDB 2NOBA 1B9KA 4DULA 1QNCA 1PCZA 1K35A 1QN8A 2JHNA 2MJ7A 3HS8A 1YQRA 2NOLA 1QN6A 2G30A 4EAGA 2Y8QA 2DKAA 1C9BB 1M5Q1 1QN4A 2IV8A 1YTFA 4EALA 1LWVA 2HZMA 3OH9A 1LXTA 1D3UA 1QNAA 2I5WA 2H4LX 2YA3A 2YH5A 2JHJA 1QNEA 2HKPA 1P5DX 1WQAA 1P5GX 1YTBA 2NVMA 2FKMX 1K2YX 1UL7A 2IV9A 1MPGA 1KYUA 1M3QA 1KFIA 1PCMX 2HL8A 4EJZA 3N89A 3OH6A 2QLVA 3RPJA 1NGMA 1QN7A 2O3OA 5IYCP 1RM1A 3OLPA 3OSEA 1V5SA 3I3WA 2R5XA 2Z0FA 2NOIA 3CW7A 4RODB 1KO9A 5EPCA 3ENCA 4D7QA 5JN5A 2QRDA 3NA5A 1HU0A 2D0CA 1QN9A 1UT7A 1PCJX 2QREA 2NOHA 1LWWA 3OSTA 2Y8LA 2JOIA 4B0AA 4D7RA 3T4NA 1J3MA 1MP9A 5HSHA 4WZSD 3F0ZA 3OSMA 3BKQX 3EIKA 5IYDP 4WXAA 1VTOA 3TE5A 3KTUA 1QTPA 3HS9A 2QR1A 4WX8A 1YQKA 3EAYA 4HJHA 5BMPA 1YQLA 2EHBD 2FKFA 2PWWA 5F9CA 2OOYA 1YQMA 3ASMA 1KY7A 1W80A 2V92A 1VOLB 1Q9UA 3OCIA 3IH7A 4C7PA 1EUVA 4EAKA 3CWSA 1KYFA 4I8OA 2MZ8A 5IYBP 1KY6A 3I0XA 1QNBA 1XSZA 3C04A 2NOZA 2LAEA 1DIZA 3UW2A 3CWAA 1VOKA 1PVSA 2D0BA 2NWVA 3OGDA 2NOEA 2JPIA 1TGHA 1JDYA 1WJWA 5JMVD 4ROCB 1NVPA 3OC3C 2VJ0A 2D0AA 4TPSA 3I0WA 3KRMA 4BJUA 1LWYA 1AISA 2NLVA 2HZSA 2V8QA 1N39A 1UT4A 1C47A 4EAIA 4QG5A 2F7LA 3CWUA 1TBPA 2DKDA 3DPUA 3D4VA 1M3HA 1TUOA 2FGTA 3ENOC 3TDHA 4MRQA 5AN4A 3VN5A 2XHIA 4PY5A 1T6AA 2NOFA 1JFIC 1N3CA 3PMGA 2V9JA 1CDWA 3H1ZA 2DKCA 2Z8UA 1KFQA 1QTSA 2QRCA 4CFFA 5BMNA 3D7QA 2OOXA 1VKLA 1E42A 4EAJA 1NH2A 3CWTA
chains in the Genus database with same CATH topology
1UL7A 3TE5A 2QR1A 2QLVA 2V8QA 2EHBD 2ZFDB 2OOYA 1V5SA 3OSEA 4EAIA 2V92A 3TDHA 4EAKA 4EAGA 2Y8QA 2QRDA 4EALA 2QREA 2V9JA 2Y8LA 4CFFA 2QRCA 2OOXA 2YA3A 3T4NA 4EAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UL7 A;  3TE5 A;  2QR1 A;  2QLV A;  2V8Q A;  2EHB D;  2ZFD B;  2OOY A;  1V5S A;  3OSE A;  4EAI A;  2V92 A;  3TDH A;  4EAK A;  4EAG A;  2Y8Q A;  2QRD A;  4EAL A;  2QRE A;  2V9J A;  2Y8L A;  4CFF A;  2QRC A;  2OOX A;  2YA3 A;  3T4N A;  4EAJ A; 
#chains in the Genus database with same CATH topology
 3ULX A;  2FUV A;  1TBA B;  3CVT A;  3DPT A;  1QN3 A;  4IL8 A;  4EJY A;  1EBM A;  2H5A X;  3F10 A;  4Q11 A;  3RSM A;  4ROE B;  3CVS A;  1N3A A;  1QN5 A;  1KYD A;  2HL9 A;  1R4X A;  3PDK A;  3SNS A;  1PZD A;  1VTL E;  5KL0 A;  1FN7 A;  1C4G A;  2ZFD B;  2NOB A;  1B9K A;  4DUL A;  1QNC A;  1PCZ A;  1K35 A;  1QN8 A;  2JHN A;  2MJ7 A;  3HS8 A;  1YQR A;  2NOL A;  1QN6 A;  2G30 A;  4EAG A;  2Y8Q A;  2DKA A;  1C9B B;  1M5Q 1;  1QN4 A;  2IV8 A;  1YTF A;  4EAL A;  1LWV A;  2HZM A;  3OH9 A;  1LXT A;  1D3U A;  1QNA A;  2I5W A;  2H4L X;  2YA3 A;  2YH5 A;  2JHJ A;  1QNE A;  2HKP A;  1P5D X;  1WQA A;  1P5G X;  1YTB A;  2NVM A;  2FKM X;  1K2Y X;  1UL7 A;  2IV9 A;  1MPG A;  1KYU A;  1M3Q A;  1KFI A;  1PCM X;  2HL8 A;  4EJZ A;  3N89 A;  3OH6 A;  2QLV A;  3RPJ A;  1NGM A;  1QN7 A;  2O3O A;  5IYC P;  1RM1 A;  3OLP A;  3OSE A;  1V5S A;  3I3W A;  2R5X A;  2Z0F A;  2NOI A;  3CW7 A;  4ROD B;  1KO9 A;  5EPC A;  3ENC A;  4D7Q A;  5JN5 A;  2QRD A;  3NA5 A;  1HU0 A;  2D0C A;  1QN9 A;  1UT7 A;  1PCJ X;  2QRE A;  2NOH A;  1LWW A;  3OST A;  2Y8L A;  2JOI A;  4B0A A;  4D7R A;  3T4N A;  1J3M A;  1MP9 A;  5HSH A;  4WZS D;  3F0Z A;  3OSM A;  3BKQ X;  3EIK A;  5IYD P;  4WXA A;  1VTO A;  3TE5 A;  3KTU A;  1QTP A;  3HS9 A;  2QR1 A;  4WX8 A;  1YQK A;  3EAY A;  4HJH A;  5BMP A;  1YQL A;  2EHB D;  2FKF A;  2PWW A;  5F9C A;  2OOY A;  1YQM A;  3ASM A;  1KY7 A;  1W80 A;  2V92 A;  1VOL B;  1Q9U A;  3OCI A;  3IH7 A;  4C7P A;  1EUV A;  4EAK A;  3CWS A;  1KYF A;  4I8O A;  2MZ8 A;  5IYB P;  1KY6 A;  3I0X A;  1QNB A;  1XSZ A;  3C04 A;  2NOZ A;  2LAE A;  1DIZ A;  3UW2 A;  3CWA A;  1VOK A;  1PVS A;  2D0B A;  2NWV A;  3OGD A;  2NOE A;  2JPI A;  1TGH A;  1JDY A;  1WJW A;  5JMV D;  4ROC B;  1NVP A;  3OC3 C;  2VJ0 A;  2D0A A;  4TPS A;  3I0W A;  3KRM A;  4BJU A;  1LWY A;  1AIS A;  2NLV A;  2HZS A;  2V8Q A;  1N39 A;  1UT4 A;  1C47 A;  4EAI A;  4QG5 A;  2F7L A;  3CWU A;  1TBP A;  2DKD A;  3DPU A;  3D4V A;  1M3H A;  1TUO A;  2FGT A;  3ENO C;  3TDH A;  4MRQ A;  5AN4 A;  3VN5 A;  2XHI A;  4PY5 A;  1T6A A;  2NOF A;  1JFI C;  1N3C A;  3PMG A;  2V9J A;  1CDW A;  3H1Z A;  2DKC A;  2Z8U A;  1KFQ A;  1QTS A;  2QRC A;  4CFF A;  5BMN A;  3D7Q A;  2OOX A;  1VKL A;  1E42 A;  4EAJ A;  1NH2 A;  3CWT A; 
#chains in the Genus database with same CATH homology
 1UL7 A;  3TE5 A;  2QR1 A;  2QLV A;  2V8Q A;  2EHB D;  2ZFD B;  2OOY A;  1V5S A;  3OSE A;  4EAI A;  2V92 A;  3TDH A;  4EAK A;  4EAG A;  2Y8Q A;  2QRD A;  4EAL A;  2QRE A;  2V9J A;  2Y8L A;  4CFF A;  2QRC A;  2OOX A;  2YA3 A;  3T4N A;  4EAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...