1UL7A

Solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
GSSGSSGRFTWSMKTTSSMDPSDMMREIRKVLGANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Solution structure of the kinase-associated domain 1 of mouse microtubule-associated protein/microtubule affinity-regulating kinase 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 19
structure length 102
sequence length 102
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02149 KA1 Kinase associated domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 1ul7A00
4EAIA 2V8QA 3TDHA 4EAJA 2QLVA 2QR1A 3OSEA 4EAKA 2Y8LA 4EALA 2QRDA 2EHBD 2QRCA 3TE5A 1UL7A 1V5SA 4CFFA 2V9JA 2ZFDB 2OOYA 4EAGA 2OOXA 2QREA 2V92A 2YA3A 2Y8QA 3T4NA
chains in the Genus database with same CATH superfamily
2NOFA 1KY7A 2NLVA 4WXAA 1QN7A 1VTOA 3CWAA 2JPIA 3ASMA 1YTFA 3DPTA 1C47A 1KYDA 1P5GX 3OSEA 3UW2A 4EAKA 3I3WA 3CWUA 1QTSA 3OSTA 2QRDA 2EHBD 1C4GA 1N39A 4PY5A 1WJWA 1QTPA 1YQRA 2ZFDB 1FN7A 2YH5A 5BMPA 3KTUA 4IL8A 1NH2A 1QN4A 3OC3C 2QREA 2D0CA 2V92A 4D7QA 4ROEB 3CVSA 3D4VA 2F7LA 2YA3A 3EAYA 4BJUA 1NGMA 2D0AA 1PVSA 3F10A 1LWWA 3T4NA 1NVPA 1B9KA 4EJZA 2NOZA 1QNAA 1VOLB 4EAIA 3IH7A 2DKCA 2QLVA 1Q9UA 2MJ7A 2JHNA 2Y8LA 1VTLE 1TGHA 3HS9A 3RSMA 1UT7A 5EPCA 1PCZA 1EUVA 2QRCA 2LAEA 4WZSD 3OH6A 1YQKA 1PCJX 3CW7A 1V5SA 1K35A 4CFFA 5JMVD 1LWVA 1KFIA 1PZDA 2V9JA 1MPGA 2JHJA 1W80A 2NVMA 4Q11A 3OGDA 1QNEA 3CWSA 1YQMA 4EAGA 3C04A 1VOKA 2VJ0A 1E42A 4RODB 1T6AA 4WX8A 3H1ZA 1N3CA 4EJYA 2D0BA 2FKMX 2MZ8A 1TBPA 2XHIA 4B0AA 3SNSA 2DKAA 1M3HA 4TPSA 4HJHA 1R4XA 2JOIA 1M3QA 2HL9A 3OLPA 2NOLA 3TDHA 1VKLA 4D7RA 2G30A 1PCMX 1MP9A 3EIKA 1EBMA 2O3OA 3N89A 4EALA 4MRQA 1CDWA 5IYBP 2IV8A 3CVTA 1KFQA 3KRMA 2Z8UA 1AISA 3CWTA 1LWYA 3TE5A 3HS8A 1UL7A 1KYFA 5KL0A 5F9CA 2FKFA 2HKPA 3DPUA 1K2YX 2OOYA 2NOEA 1DIZA 2H5AX 3ULXA 4DULA 1QN6A 1QN5A 3PMGA 5IYCP 3OH9A 5HSHA 3VN5A 1TUOA 2PWWA 1QN8A 1YQLA 1QNBA 3PDKA 1KYUA 1N3AA 2FGTA 2IV9A 1RM1A 1HU0A 5IYDP 2V8QA 4EAJA 2NOIA 2HL8A 3OSMA 2QR1A 2NWVA 1C9BB 3F0ZA 1P5DX 1M5Q1 1UT4A 1J3MA 2HZMA 3ENOC 5JN5A 2I5WA 3ENCA 2DKDA 1QN9A 2R5XA 4ROCB 1KO9A 4C7PA 3I0XA 1WQAA 3BKQX 3NA5A 1YTBA 1LXTA 4I8OA 2HZSA 1QNCA 2NOHA 1JFIC 4QG5A 3D7QA 2OOXA 3RPJA 3I0WA 2Z0FA 5AN4A 1XSZA 1KY6A 2H4LX 2NOBA 5BMNA 1D3UA 2FUVA 2Y8QA 1QN3A 1TBAB 1JDYA 3OCIA
chains in the Genus database with same CATH topology
4EAIA 2V8QA 3TDHA 4EAJA 2QLVA 2QR1A 3OSEA 4EAKA 2Y8LA 4EALA 2QRDA 2EHBD 2QRCA 3TE5A 1UL7A 1V5SA 4CFFA 2V9JA 2ZFDB 2OOYA 4EAGA 2OOXA 2QREA 2V92A 2YA3A 2Y8QA 3T4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAI A;  2V8Q A;  3TDH A;  4EAJ A;  2QLV A;  2QR1 A;  3OSE A;  4EAK A;  2Y8L A;  4EAL A;  2QRD A;  2EHB D;  2QRC A;  3TE5 A;  1UL7 A;  1V5S A;  4CFF A;  2V9J A;  2ZFD B;  2OOY A;  4EAG A;  2OOX A;  2QRE A;  2V92 A;  2YA3 A;  2Y8Q A;  3T4N A; 
#chains in the Genus database with same CATH topology
 2NOF A;  1KY7 A;  2NLV A;  4WXA A;  1QN7 A;  1VTO A;  3CWA A;  2JPI A;  3ASM A;  1YTF A;  3DPT A;  1C47 A;  1KYD A;  1P5G X;  3OSE A;  3UW2 A;  4EAK A;  3I3W A;  3CWU A;  1QTS A;  3OST A;  2QRD A;  2EHB D;  1C4G A;  1N39 A;  4PY5 A;  1WJW A;  1QTP A;  1YQR A;  2ZFD B;  1FN7 A;  2YH5 A;  5BMP A;  3KTU A;  4IL8 A;  1NH2 A;  1QN4 A;  3OC3 C;  2QRE A;  2D0C A;  2V92 A;  4D7Q A;  4ROE B;  3CVS A;  3D4V A;  2F7L A;  2YA3 A;  3EAY A;  4BJU A;  1NGM A;  2D0A A;  1PVS A;  3F10 A;  1LWW A;  3T4N A;  1NVP A;  1B9K A;  4EJZ A;  2NOZ A;  1QNA A;  1VOL B;  4EAI A;  3IH7 A;  2DKC A;  2QLV A;  1Q9U A;  2MJ7 A;  2JHN A;  2Y8L A;  1VTL E;  1TGH A;  3HS9 A;  3RSM A;  1UT7 A;  5EPC A;  1PCZ A;  1EUV A;  2QRC A;  2LAE A;  4WZS D;  3OH6 A;  1YQK A;  1PCJ X;  3CW7 A;  1V5S A;  1K35 A;  4CFF A;  5JMV D;  1LWV A;  1KFI A;  1PZD A;  2V9J A;  1MPG A;  2JHJ A;  1W80 A;  2NVM A;  4Q11 A;  3OGD A;  1QNE A;  3CWS A;  1YQM A;  4EAG A;  3C04 A;  1VOK A;  2VJ0 A;  1E42 A;  4ROD B;  1T6A A;  4WX8 A;  3H1Z A;  1N3C A;  4EJY A;  2D0B A;  2FKM X;  2MZ8 A;  1TBP A;  2XHI A;  4B0A A;  3SNS A;  2DKA A;  1M3H A;  4TPS A;  4HJH A;  1R4X A;  2JOI A;  1M3Q A;  2HL9 A;  3OLP A;  2NOL A;  3TDH A;  1VKL A;  4D7R A;  2G30 A;  1PCM X;  1MP9 A;  3EIK A;  1EBM A;  2O3O A;  3N89 A;  4EAL A;  4MRQ A;  1CDW A;  5IYB P;  2IV8 A;  3CVT A;  1KFQ A;  3KRM A;  2Z8U A;  1AIS A;  3CWT A;  1LWY A;  3TE5 A;  3HS8 A;  1UL7 A;  1KYF A;  5KL0 A;  5F9C A;  2FKF A;  2HKP A;  3DPU A;  1K2Y X;  2OOY A;  2NOE A;  1DIZ A;  2H5A X;  3ULX A;  4DUL A;  1QN6 A;  1QN5 A;  3PMG A;  5IYC P;  3OH9 A;  5HSH A;  3VN5 A;  1TUO A;  2PWW A;  1QN8 A;  1YQL A;  1QNB A;  3PDK A;  1KYU A;  1N3A A;  2FGT A;  2IV9 A;  1RM1 A;  1HU0 A;  5IYD P;  2V8Q A;  4EAJ A;  2NOI A;  2HL8 A;  3OSM A;  2QR1 A;  2NWV A;  1C9B B;  3F0Z A;  1P5D X;  1M5Q 1;  1UT4 A;  1J3M A;  2HZM A;  3ENO C;  5JN5 A;  2I5W A;  3ENC A;  2DKD A;  1QN9 A;  2R5X A;  4ROC B;  1KO9 A;  4C7P A;  3I0X A;  1WQA A;  3BKQ X;  3NA5 A;  1YTB A;  1LXT A;  4I8O A;  2HZS A;  1QNC A;  2NOH A;  1JFI C;  4QG5 A;  3D7Q A;  2OOX A;  3RPJ A;  3I0W A;  2Z0F A;  5AN4 A;  1XSZ A;  1KY6 A;  2H4L X;  2NOB A;  5BMN A;  1D3U A;  2FUV A;  2Y8Q A;  1QN3 A;  1TBA B;  1JDY A;  3OCI A; 
#chains in the Genus database with same CATH homology
 4EAI A;  2V8Q A;  3TDH A;  4EAJ A;  2QLV A;  2QR1 A;  3OSE A;  4EAK A;  2Y8L A;  4EAL A;  2QRD A;  2EHB D;  2QRC A;  3TE5 A;  1UL7 A;  1V5S A;  4CFF A;  2V9J A;  2ZFD B;  2OOY A;  4EAG A;  2OOX A;  2QRE A;  2V92 A;  2YA3 A;  2Y8Q A;  3T4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...