1UL7A

Solution structure of kinase associated domain 1 of mouse map/microtubule affinity-regulating kinase 3
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
102
structure length
102
Chain Sequence
GSSGSSGRFTWSMKTTSSMDPSDMMREIRKVLGANNCDYEQRERFLLFCVHGDGHAENLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIASKIANELKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAP/microtubule affinity-regulating kinase 3
publication title Solution structure of the kinase-associated domain 1 of mouse microtubule-associated protein/microtubule affinity-regulating kinase 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 19
structure length 102
sequence length 102
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02149 KA1 Kinase associated domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 1ul7A00
2Y8QA 2V8QA 4EAIA 2QRCA 4EAGA 2ZFDB 3TE5A 2V92A 4EAKA 3T4NA 2YA3A 2EHBD 4CFFA 2QRDA 1V5SA 2OOXA 4EALA 2Y8LA 2OOYA 2V9JA 1UL7A 2QREA 3OSEA 2QLVA 3TDHA 2QR1A 4EAJA
chains in the Genus database with same CATH superfamily
1TUOA 1MP9A 2VJ0A 2NVMA 4D7RA 3CVSA 3OH6A 1DIZA 1PCZA 1QN9A 1NVPA 2JPIA 2PWWA 3CWUA 2HZSA 3ASMA 5AN4A 5EPCA 2Z0FA 1KY7A 2FKFA 2YA3A 1VTLE 2D0CA 2DKCA 4PY5A 2EHBD 3ULXA 4CFFA 1QNBA 1KY6A 5JN5A 3CWTA 2QRDA 3EIKA 1KFIA 1R4XA 1B9KA 1J3MA 1KO9A 1P5DX 2G30A 4BJUA 1QN3A 1LWVA 4MRQA 3HS8A 2Z8UA 3CVTA 2IV9A 1KYDA 3H1ZA 3PMGA 1Q9UA 2JOIA 1C4GA 1W80A 3OSEA 1K2YX 2NWVA 3F10A 3I3WA 2MJ7A 4RODB 1YQLA 1E42A 3DPTA 3OC3C 2IV8A 3OLPA 1HU0A 2JHJA 1KYFA 5HSHA 1QTSA 1YTBA 1JDYA 2QRCA 1PCJX 2F7LA 2ZFDB 1PCMX 5JMVD 2V92A 1D3UA 3T4NA 1M3QA 1K35A 1WJWA 3OCIA 1N3AA 1C47A 3I0XA 2DKAA 2NOIA 1YTFA 1N3CA 2HL9A 1QN8A 4B0AA 3OSMA 1YQRA 2V9JA 2NOHA 3DPUA 3D7QA 1CDWA 3D4VA 2DKDA 3NA5A 2QLVA 1EBMA 1LXTA 2QR1A 3PDKA 3KTUA 4TPSA 1TBAB 4Q11A 4EJYA 3OSTA 3BKQX 2HL8A 4WZSD 2NOLA 4EAIA 4HJHA 1QN5A 5IYBP 4I8OA 4IL8A 1VTOA 1QN4A 2XHIA 1LWWA 1MPGA 1C9BB 1P5GX 3UW2A 4EAKA 3HS9A 2FGTA 2YH5A 1T6AA 2I5WA 1UT4A 3CWAA 1PZDA 1QNEA 2FUVA 2H5AX 3N89A 1NH2A 1FN7A 2FKMX 2OOXA 1QN7A 3RSMA 3KRMA 1KYUA 2MZ8A 4D7QA 5KL0A 5IYCP 3OH9A 4ROCB 2NOZA 1RM1A 3TDHA 2NLVA 4QG5A 2NOEA 1VKLA 4C7PA 1TBPA 5BMNA 1YQMA 3I0WA 1LWYA 3CW7A 4EAJA 1UT7A 2HKPA 2LAEA 2H4LX 1EUVA 2V8QA 2Y8QA 2JHNA 3F0ZA 3IH7A 1JFIC 3OGDA 1QNCA 2O3OA 1N39A 4EAGA 3ENCA 3TE5A 3VN5A 1QTPA 5F9CA 3ENOC 2HZMA 1AISA 2D0BA 5BMPA 3SNSA 2NOBA 4WXAA 1M3HA 4WX8A 1QN6A 5IYDP 1VOKA 4DULA 1V5SA 4EJZA 1NGMA 3C04A 4EALA 2Y8LA 1VOLB 2NOFA 3RPJA 1M5Q1 1TGHA 2R5XA 2OOYA 1UL7A 2QREA 1PVSA 4ROEB 1XSZA 1QNAA 3CWSA 3EAYA 2D0AA 1WQAA 1KFQA 1YQKA
chains in the Genus database with same CATH topology
2Y8QA 2V8QA 4EAIA 2QRCA 4EAGA 2ZFDB 3TE5A 2V92A 4EAKA 3T4NA 2YA3A 2EHBD 4CFFA 2QRDA 1V5SA 2OOXA 4EALA 2Y8LA 2OOYA 2V9JA 1UL7A 2QREA 3OSEA 2QLVA 3TDHA 2QR1A 4EAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8Q A;  2V8Q A;  4EAI A;  2QRC A;  4EAG A;  2ZFD B;  3TE5 A;  2V92 A;  4EAK A;  3T4N A;  2YA3 A;  2EHB D;  4CFF A;  2QRD A;  1V5S A;  2OOX A;  4EAL A;  2Y8L A;  2OOY A;  2V9J A;  1UL7 A;  2QRE A;  3OSE A;  2QLV A;  3TDH A;  2QR1 A;  4EAJ A; 
#chains in the Genus database with same CATH topology
 1TUO A;  1MP9 A;  2VJ0 A;  2NVM A;  4D7R A;  3CVS A;  3OH6 A;  1DIZ A;  1PCZ A;  1QN9 A;  1NVP A;  2JPI A;  2PWW A;  3CWU A;  2HZS A;  3ASM A;  5AN4 A;  5EPC A;  2Z0F A;  1KY7 A;  2FKF A;  2YA3 A;  1VTL E;  2D0C A;  2DKC A;  4PY5 A;  2EHB D;  3ULX A;  4CFF A;  1QNB A;  1KY6 A;  5JN5 A;  3CWT A;  2QRD A;  3EIK A;  1KFI A;  1R4X A;  1B9K A;  1J3M A;  1KO9 A;  1P5D X;  2G30 A;  4BJU A;  1QN3 A;  1LWV A;  4MRQ A;  3HS8 A;  2Z8U A;  3CVT A;  2IV9 A;  1KYD A;  3H1Z A;  3PMG A;  1Q9U A;  2JOI A;  1C4G A;  1W80 A;  3OSE A;  1K2Y X;  2NWV A;  3F10 A;  3I3W A;  2MJ7 A;  4ROD B;  1YQL A;  1E42 A;  3DPT A;  3OC3 C;  2IV8 A;  3OLP A;  1HU0 A;  2JHJ A;  1KYF A;  5HSH A;  1QTS A;  1YTB A;  1JDY A;  2QRC A;  1PCJ X;  2F7L A;  2ZFD B;  1PCM X;  5JMV D;  2V92 A;  1D3U A;  3T4N A;  1M3Q A;  1K35 A;  1WJW A;  3OCI A;  1N3A A;  1C47 A;  3I0X A;  2DKA A;  2NOI A;  1YTF A;  1N3C A;  2HL9 A;  1QN8 A;  4B0A A;  3OSM A;  1YQR A;  2V9J A;  2NOH A;  3DPU A;  3D7Q A;  1CDW A;  3D4V A;  2DKD A;  3NA5 A;  2QLV A;  1EBM A;  1LXT A;  2QR1 A;  3PDK A;  3KTU A;  4TPS A;  1TBA B;  4Q11 A;  4EJY A;  3OST A;  3BKQ X;  2HL8 A;  4WZS D;  2NOL A;  4EAI A;  4HJH A;  1QN5 A;  5IYB P;  4I8O A;  4IL8 A;  1VTO A;  1QN4 A;  2XHI A;  1LWW A;  1MPG A;  1C9B B;  1P5G X;  3UW2 A;  4EAK A;  3HS9 A;  2FGT A;  2YH5 A;  1T6A A;  2I5W A;  1UT4 A;  3CWA A;  1PZD A;  1QNE A;  2FUV A;  2H5A X;  3N89 A;  1NH2 A;  1FN7 A;  2FKM X;  2OOX A;  1QN7 A;  3RSM A;  3KRM A;  1KYU A;  2MZ8 A;  4D7Q A;  5KL0 A;  5IYC P;  3OH9 A;  4ROC B;  2NOZ A;  1RM1 A;  3TDH A;  2NLV A;  4QG5 A;  2NOE A;  1VKL A;  4C7P A;  1TBP A;  5BMN A;  1YQM A;  3I0W A;  1LWY A;  3CW7 A;  4EAJ A;  1UT7 A;  2HKP A;  2LAE A;  2H4L X;  1EUV A;  2V8Q A;  2Y8Q A;  2JHN A;  3F0Z A;  3IH7 A;  1JFI C;  3OGD A;  1QNC A;  2O3O A;  1N39 A;  4EAG A;  3ENC A;  3TE5 A;  3VN5 A;  1QTP A;  5F9C A;  3ENO C;  2HZM A;  1AIS A;  2D0B A;  5BMP A;  3SNS A;  2NOB A;  4WXA A;  1M3H A;  4WX8 A;  1QN6 A;  5IYD P;  1VOK A;  4DUL A;  1V5S A;  4EJZ A;  1NGM A;  3C04 A;  4EAL A;  2Y8L A;  1VOL B;  2NOF A;  3RPJ A;  1M5Q 1;  1TGH A;  2R5X A;  2OOY A;  1UL7 A;  2QRE A;  1PVS A;  4ROE B;  1XSZ A;  1QNA A;  3CWS A;  3EAY A;  2D0A A;  1WQA A;  1KFQ A;  1YQK A; 
#chains in the Genus database with same CATH homology
 2Y8Q A;  2V8Q A;  4EAI A;  2QRC A;  4EAG A;  2ZFD B;  3TE5 A;  2V92 A;  4EAK A;  3T4N A;  2YA3 A;  2EHB D;  4CFF A;  2QRD A;  1V5S A;  2OOX A;  4EAL A;  2Y8L A;  2OOY A;  2V9J A;  1UL7 A;  2QRE A;  3OSE A;  2QLV A;  3TDH A;  2QR1 A;  4EAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...