3TE5A

Structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with nadh
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
167
structure length
138
Chain Sequence
DSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYIPDLMKMVIQLFQIETNNYLVDFKFDGWESFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 138
sequence length 167
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 3te5A01
2EHBD 2ZFDB 1UL7A 2QRCA 2OOXA 2Y8QA 2QR1A 2QRDA 3TE5A 4CFFA 2YA3A 2V9JA 1V5SA 2V8QA 4EAKA 4EAJA 4EALA 2OOYA 2Y8LA 4EAIA 2QLVA 2QREA 3T4NA 2V92A 3OSEA 4EAGA 3TDHA
chains in the Genus database with same CATH superfamily
3HS8A 2O3OA 4B0AA 1UT7A 5F9CA 1YQLA 1QN4A 1YQRA 1UL7A 1KO9A 3ULXA 4EJYA 1JDYA 3OSTA 1R4XA 3DPUA 2FKMX 1YTFA 1KFQA 2OOXA 3VN5A 1TGHA 2Z0FA 2MJ7A 5KL0A 2NOIA 2DKDA 1LWWA 1KYDA 2Y8QA 2FGTA 3PDKA 2R5XA 3ASMA 1P5DX 2IV8A 1XSZA 1PVSA 3TE5A 1QN7A 1KY7A 3BKQX 1W80A 2V8QA 2HZMA 4EALA 1M5Q1 2JHJA 2Y8LA 1M3QA 3D4VA 5JMVD 4HJHA 5IYDP 1T6AA 2DKAA 4RODB 5JN5A 1CDWA 2HKPA 1K35A 2JPIA 3H1ZA 3UW2A 4D7RA 1TBPA 1KYUA 1Q9UA 4D7QA 1YQMA 1QNCA 1UT4A 1QTSA 3RPJA 3F10A 2FUVA 1HU0A 1QNEA 2H5AX 1YQKA 2NOZA 1TBAB 3I0XA 1C4GA 3HS9A 3OC3C 2QRCA 1QTPA 4MRQA 3CVTA 3OGDA 3OH6A 2D0CA 1C47A 1EUVA 3OH9A 4WX8A 1FN7A 3N89A 2YA3A 3PMGA 5BMPA 2D0BA 1K2YX 1V5SA 1EBMA 4EAKA 2NOHA 1M3HA 2OOYA 2NOFA 1PCJX 3IH7A 4EAIA 1QN9A 1C9BB 3T4NA 2V92A 4EAGA 3F0ZA 1QNBA 1RM1A 1KYFA 1QN3A 1PCZA 2EHBD 2ZFDB 1N3AA 3OSMA 4TPSA 5IYBP 4IL8A 4C7PA 2NOBA 4PY5A 2XHIA 2F7LA 2NVMA 4ROCB 1LWYA 1J3MA 1KFIA 2JHNA 1AISA 2QR1A 2QRDA 1E42A 1WJWA 1YTBA 4CFFA 1VTLE 3C04A 5IYCP 1PCMX 1NGMA 5HSHA 3NA5A 3KTUA 1QNAA 2YH5A 2HZSA 2QLVA 3ENCA 3I3WA 3CW7A 3OSEA 4BJUA 1N39A 3TDHA 2IV9A 1QN6A 1QN8A 3CVSA 3EAYA 2HL9A 4Q11A 1NH2A 3CWTA 3CWSA 4ROEB 3CWAA 1MP9A 1PZDA 3EIKA 4QG5A 5EPCA 1N3CA 2I5WA 2JOIA 2NOEA 4EJZA 1VKLA 5BMNA 1WQAA 2G30A 1KY6A 1P5GX 3DPTA 2NWVA 1LWVA 1VOKA 3OCIA 5AN4A 3D7QA 1VOLB 2FKFA 4I8OA 2DKCA 2HL8A 1NVPA 1QN5A 1TUOA 1LXTA 2V9JA 2H4LX 4DULA 3CWUA 1JFIC 2NOLA 2LAEA 2NLVA 2VJ0A 3OLPA 2D0AA 3KRMA 4WXAA 3RSMA 3ENOC 2PWWA 4EAJA 2MZ8A 1MPGA 1D3UA 3I0WA 1DIZA 1VTOA 2Z8UA 4WZSD 3SNSA 2QREA 1B9KA
chains in the Genus database with same CATH topology
2EHBD 2ZFDB 1UL7A 2QRCA 2OOXA 2Y8QA 2QR1A 2QRDA 3TE5A 4CFFA 2YA3A 2V9JA 1V5SA 2V8QA 4EAKA 4EAJA 4EALA 2OOYA 2Y8LA 4EAIA 2QLVA 2QREA 3T4NA 2V92A 3OSEA 4EAGA 3TDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHB D;  2ZFD B;  1UL7 A;  2QRC A;  2OOX A;  2Y8Q A;  2QR1 A;  2QRD A;  3TE5 A;  4CFF A;  2YA3 A;  2V9J A;  1V5S A;  2V8Q A;  4EAK A;  4EAJ A;  4EAL A;  2OOY A;  2Y8L A;  4EAI A;  2QLV A;  2QRE A;  3T4N A;  2V92 A;  3OSE A;  4EAG A;  3TDH A; 
#chains in the Genus database with same CATH topology
 3HS8 A;  2O3O A;  4B0A A;  1UT7 A;  5F9C A;  1YQL A;  1QN4 A;  1YQR A;  1UL7 A;  1KO9 A;  3ULX A;  4EJY A;  1JDY A;  3OST A;  1R4X A;  3DPU A;  2FKM X;  1YTF A;  1KFQ A;  2OOX A;  3VN5 A;  1TGH A;  2Z0F A;  2MJ7 A;  5KL0 A;  2NOI A;  2DKD A;  1LWW A;  1KYD A;  2Y8Q A;  2FGT A;  3PDK A;  2R5X A;  3ASM A;  1P5D X;  2IV8 A;  1XSZ A;  1PVS A;  3TE5 A;  1QN7 A;  1KY7 A;  3BKQ X;  1W80 A;  2V8Q A;  2HZM A;  4EAL A;  1M5Q 1;  2JHJ A;  2Y8L A;  1M3Q A;  3D4V A;  5JMV D;  4HJH A;  5IYD P;  1T6A A;  2DKA A;  4ROD B;  5JN5 A;  1CDW A;  2HKP A;  1K35 A;  2JPI A;  3H1Z A;  3UW2 A;  4D7R A;  1TBP A;  1KYU A;  1Q9U A;  4D7Q A;  1YQM A;  1QNC A;  1UT4 A;  1QTS A;  3RPJ A;  3F10 A;  2FUV A;  1HU0 A;  1QNE A;  2H5A X;  1YQK A;  2NOZ A;  1TBA B;  3I0X A;  1C4G A;  3HS9 A;  3OC3 C;  2QRC A;  1QTP A;  4MRQ A;  3CVT A;  3OGD A;  3OH6 A;  2D0C A;  1C47 A;  1EUV A;  3OH9 A;  4WX8 A;  1FN7 A;  3N89 A;  2YA3 A;  3PMG A;  5BMP A;  2D0B A;  1K2Y X;  1V5S A;  1EBM A;  4EAK A;  2NOH A;  1M3H A;  2OOY A;  2NOF A;  1PCJ X;  3IH7 A;  4EAI A;  1QN9 A;  1C9B B;  3T4N A;  2V92 A;  4EAG A;  3F0Z A;  1QNB A;  1RM1 A;  1KYF A;  1QN3 A;  1PCZ A;  2EHB D;  2ZFD B;  1N3A A;  3OSM A;  4TPS A;  5IYB P;  4IL8 A;  4C7P A;  2NOB A;  4PY5 A;  2XHI A;  2F7L A;  2NVM A;  4ROC B;  1LWY A;  1J3M A;  1KFI A;  2JHN A;  1AIS A;  2QR1 A;  2QRD A;  1E42 A;  1WJW A;  1YTB A;  4CFF A;  1VTL E;  3C04 A;  5IYC P;  1PCM X;  1NGM A;  5HSH A;  3NA5 A;  3KTU A;  1QNA A;  2YH5 A;  2HZS A;  2QLV A;  3ENC A;  3I3W A;  3CW7 A;  3OSE A;  4BJU A;  1N39 A;  3TDH A;  2IV9 A;  1QN6 A;  1QN8 A;  3CVS A;  3EAY A;  2HL9 A;  4Q11 A;  1NH2 A;  3CWT A;  3CWS A;  4ROE B;  3CWA A;  1MP9 A;  1PZD A;  3EIK A;  4QG5 A;  5EPC A;  1N3C A;  2I5W A;  2JOI A;  2NOE A;  4EJZ A;  1VKL A;  5BMN A;  1WQA A;  2G30 A;  1KY6 A;  1P5G X;  3DPT A;  2NWV A;  1LWV A;  1VOK A;  3OCI A;  5AN4 A;  3D7Q A;  1VOL B;  2FKF A;  4I8O A;  2DKC A;  2HL8 A;  1NVP A;  1QN5 A;  1TUO A;  1LXT A;  2V9J A;  2H4L X;  4DUL A;  3CWU A;  1JFI C;  2NOL A;  2LAE A;  2NLV A;  2VJ0 A;  3OLP A;  2D0A A;  3KRM A;  4WXA A;  3RSM A;  3ENO C;  2PWW A;  4EAJ A;  2MZ8 A;  1MPG A;  1D3U A;  3I0W A;  1DIZ A;  1VTO A;  2Z8U A;  4WZS D;  3SNS A;  2QRE A;  1B9K A; 
#chains in the Genus database with same CATH homology
 2EHB D;  2ZFD B;  1UL7 A;  2QRC A;  2OOX A;  2Y8Q A;  2QR1 A;  2QRD A;  3TE5 A;  4CFF A;  2YA3 A;  2V9J A;  1V5S A;  2V8Q A;  4EAK A;  4EAJ A;  4EAL A;  2OOY A;  2Y8L A;  4EAI A;  2QLV A;  2QRE A;  3T4N A;  2V92 A;  3OSE A;  4EAG A;  3TDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...