3TE5A

Structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with nadh
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
167
structure length
138
Chain Sequence
DSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYIPDLMKMVIQLFQIETNNYLVDFKFDGWESFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 30
structure length 138
sequence length 167
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 3te5A01
2V92A 2ZFDB 4EAGA 1UL7A 3TE5A 2Y8QA 2V9JA 2V8QA 2Y8LA 3TDHA 1V5SA 4EAKA 2YA3A 4EAIA 2EHBD 2QRDA 4EAJA 2OOYA 4EALA 2OOXA 3T4NA 2QLVA 2QREA 3OSEA 2QRCA 2QR1A 4CFFA
chains in the Genus database with same CATH superfamily
1NVPA 2V92A 3KTUA 2H5AX 3ASMA 2HZMA 3OH6A 3NA5A 2HZSA 4ROCB 4EJZA 1UT4A 1B9KA 3TE5A 2VJ0A 5IYDP 1HU0A 1KYUA 5AN4A 1QTPA 1P5DX 2Z0FA 4ROEB 1KFIA 1VOKA 4EJYA 1NGMA 2NOZA 2O3OA 1TBPA 4RODB 4IL8A 3SNSA 1TGHA 3H1ZA 3OC3C 3D7QA 1M5Q1 2NOEA 3C04A 3D4VA 3RSMA 1YTFA 3IH7A 1N3AA 3UW2A 2QREA 1PZDA 1YQLA 1VKLA 3PMGA 2R5XA 1T6AA 2D0BA 1WQAA 1N3CA 1QN7A 1D3UA 2NOBA 3OSMA 2PWWA 1JFIC 1C47A 3CWSA 1M3QA 2JHJA 2NWVA 1CDWA 1EUVA 1M3HA 1MPGA 4Q11A 3CW7A 2G30A 1NH2A 5JMVD 1QNBA 2V9JA 2Y8QA 3DPTA 2Y8LA 1Q9UA 4WXAA 2XHIA 1PCJX 2HL9A 1QN8A 1PCMX 3EAYA 3TDHA 4I8OA 3F0ZA 5IYBP 4D7RA 1XSZA 1VTOA 1YQMA 2D0AA 1QN6A 5KL0A 2MJ7A 3CVSA 4EAIA 5IYCP 1LXTA 1UT7A 2QRDA 2NOIA 3OSTA 5BMPA 2FGTA 3F10A 4EALA 2F7LA 3T4NA 1KY6A 2IV9A 1K2YX 3HS8A 3KRMA 1LWVA 2Z8UA 3N89A 2DKDA 2FKMX 3PDKA 1P5GX 1QN3A 1TBAB 4D7QA 2DKCA 1KFQA 2YH5A 2DKAA 1KY7A 4EAGA 3CWTA 1N39A 4PY5A 2V8QA 3RPJA 1KO9A 3DPUA 1YTBA 1MP9A 1V5SA 4QG5A 4C7PA 2YA3A 4EAKA 3I0XA 1QTSA 1TUOA 1WJWA 2JHNA 3HS9A 4B0AA 1PCZA 2EHBD 3I3WA 5EPCA 1JDYA 4EAJA 1LWWA 3CWUA 1AISA 3ENCA 1E42A 1W80A 1VTLE 2NOFA 3OCIA 2JPIA 3EIKA 4WZSD 2HL8A 4WX8A 1QNCA 2HKPA 4DULA 1C9BB 1EBMA 1QNEA 1C4GA 5JN5A 2NOLA 3BKQX 3OGDA 4CFFA 1QN4A 2I5WA 2ZFDB 5F9CA 1UL7A 1LWYA 2LAEA 1DIZA 1K35A 1RM1A 2IV8A 3CWAA 2D0CA 4TPSA 4HJHA 1PVSA 2NLVA 1VOLB 1YQRA 3ENOC 2FKFA 2H4LX 1R4XA 1J3MA 2MZ8A 1KYFA 2OOYA 3OLPA 2FUVA 3ULXA 2NOHA 2OOXA 3I0WA 1YQKA 2QLVA 3VN5A 1FN7A 2NVMA 3CVTA 5BMNA 3OSEA 3OH9A 2QRCA 2QR1A 1QNAA 1QN9A 4MRQA 2JOIA 5HSHA 4BJUA 1QN5A 1KYDA
chains in the Genus database with same CATH topology
2V92A 2ZFDB 4EAGA 1UL7A 3TE5A 2Y8QA 2V9JA 2V8QA 2Y8LA 3TDHA 1V5SA 4EAKA 2YA3A 4EAIA 2EHBD 2QRDA 4EAJA 2OOYA 4EALA 2OOXA 3T4NA 2QLVA 2QREA 3OSEA 2QRCA 2QR1A 4CFFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V92 A;  2ZFD B;  4EAG A;  1UL7 A;  3TE5 A;  2Y8Q A;  2V9J A;  2V8Q A;  2Y8L A;  3TDH A;  1V5S A;  4EAK A;  2YA3 A;  4EAI A;  2EHB D;  2QRD A;  4EAJ A;  2OOY A;  4EAL A;  2OOX A;  3T4N A;  2QLV A;  2QRE A;  3OSE A;  2QRC A;  2QR1 A;  4CFF A; 
#chains in the Genus database with same CATH topology
 1NVP A;  2V92 A;  3KTU A;  2H5A X;  3ASM A;  2HZM A;  3OH6 A;  3NA5 A;  2HZS A;  4ROC B;  4EJZ A;  1UT4 A;  1B9K A;  3TE5 A;  2VJ0 A;  5IYD P;  1HU0 A;  1KYU A;  5AN4 A;  1QTP A;  1P5D X;  2Z0F A;  4ROE B;  1KFI A;  1VOK A;  4EJY A;  1NGM A;  2NOZ A;  2O3O A;  1TBP A;  4ROD B;  4IL8 A;  3SNS A;  1TGH A;  3H1Z A;  3OC3 C;  3D7Q A;  1M5Q 1;  2NOE A;  3C04 A;  3D4V A;  3RSM A;  1YTF A;  3IH7 A;  1N3A A;  3UW2 A;  2QRE A;  1PZD A;  1YQL A;  1VKL A;  3PMG A;  2R5X A;  1T6A A;  2D0B A;  1WQA A;  1N3C A;  1QN7 A;  1D3U A;  2NOB A;  3OSM A;  2PWW A;  1JFI C;  1C47 A;  3CWS A;  1M3Q A;  2JHJ A;  2NWV A;  1CDW A;  1EUV A;  1M3H A;  1MPG A;  4Q11 A;  3CW7 A;  2G30 A;  1NH2 A;  5JMV D;  1QNB A;  2V9J A;  2Y8Q A;  3DPT A;  2Y8L A;  1Q9U A;  4WXA A;  2XHI A;  1PCJ X;  2HL9 A;  1QN8 A;  1PCM X;  3EAY A;  3TDH A;  4I8O A;  3F0Z A;  5IYB P;  4D7R A;  1XSZ A;  1VTO A;  1YQM A;  2D0A A;  1QN6 A;  5KL0 A;  2MJ7 A;  3CVS A;  4EAI A;  5IYC P;  1LXT A;  1UT7 A;  2QRD A;  2NOI A;  3OST A;  5BMP A;  2FGT A;  3F10 A;  4EAL A;  2F7L A;  3T4N A;  1KY6 A;  2IV9 A;  1K2Y X;  3HS8 A;  3KRM A;  1LWV A;  2Z8U A;  3N89 A;  2DKD A;  2FKM X;  3PDK A;  1P5G X;  1QN3 A;  1TBA B;  4D7Q A;  2DKC A;  1KFQ A;  2YH5 A;  2DKA A;  1KY7 A;  4EAG A;  3CWT A;  1N39 A;  4PY5 A;  2V8Q A;  3RPJ A;  1KO9 A;  3DPU A;  1YTB A;  1MP9 A;  1V5S A;  4QG5 A;  4C7P A;  2YA3 A;  4EAK A;  3I0X A;  1QTS A;  1TUO A;  1WJW A;  2JHN A;  3HS9 A;  4B0A A;  1PCZ A;  2EHB D;  3I3W A;  5EPC A;  1JDY A;  4EAJ A;  1LWW A;  3CWU A;  1AIS A;  3ENC A;  1E42 A;  1W80 A;  1VTL E;  2NOF A;  3OCI A;  2JPI A;  3EIK A;  4WZS D;  2HL8 A;  4WX8 A;  1QNC A;  2HKP A;  4DUL A;  1C9B B;  1EBM A;  1QNE A;  1C4G A;  5JN5 A;  2NOL A;  3BKQ X;  3OGD A;  4CFF A;  1QN4 A;  2I5W A;  2ZFD B;  5F9C A;  1UL7 A;  1LWY A;  2LAE A;  1DIZ A;  1K35 A;  1RM1 A;  2IV8 A;  3CWA A;  2D0C A;  4TPS A;  4HJH A;  1PVS A;  2NLV A;  1VOL B;  1YQR A;  3ENO C;  2FKF A;  2H4L X;  1R4X A;  1J3M A;  2MZ8 A;  1KYF A;  2OOY A;  3OLP A;  2FUV A;  3ULX A;  2NOH A;  2OOX A;  3I0W A;  1YQK A;  2QLV A;  3VN5 A;  1FN7 A;  2NVM A;  3CVT A;  5BMN A;  3OSE A;  3OH9 A;  2QRC A;  2QR1 A;  1QNA A;  1QN9 A;  4MRQ A;  2JOI A;  5HSH A;  4BJU A;  1QN5 A;  1KYD A; 
#chains in the Genus database with same CATH homology
 2V92 A;  2ZFD B;  4EAG A;  1UL7 A;  3TE5 A;  2Y8Q A;  2V9J A;  2V8Q A;  2Y8L A;  3TDH A;  1V5S A;  4EAK A;  2YA3 A;  4EAI A;  2EHB D;  2QRD A;  4EAJ A;  2OOY A;  4EAL A;  2OOX A;  3T4N A;  2QLV A;  2QRE A;  3OSE A;  2QRC A;  2QR1 A;  4CFF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...