3TE5A

Structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with nadh
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
167
structure length
138
Chain Sequence
DSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYIPDLMKMVIQLFQIETNNYLVDFKFDGWESFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 30
structure length 138
sequence length 167
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 3te5A01
1V5SA 2V8QA 4EAIA 2QREA 1UL7A 4EALA 2QRDA 2YA3A 3TDHA 4EAJA 2EHBD 3TE5A 3T4NA 2QRCA 2OOXA 2V92A 4CFFA 4EAGA 2Y8QA 2Y8LA 2QR1A 2ZFDB 2V9JA 4EAKA 2QLVA 3OSEA 2OOYA
chains in the Genus database with same CATH superfamily
1E42A 2V8QA 1M3HA 1N3AA 2NOHA 4D7QA 1R4XA 1T6AA 2R5XA 4WZSD 1KYFA 1VTOA 1QNBA 3SNSA 1QNCA 3HS8A 3I3WA 5JMVD 4B0AA 1MPGA 1WQAA 2IV8A 3CWUA 3ENCA 1VTLE 1QTSA 1EUVA 2O3OA 1C47A 4EJZA 1P5GX 1K2YX 4DULA 1M3QA 4WXAA 1PCJX 2NOFA 3I0XA 1YQRA 5IYDP 1P5DX 3NA5A 1B9KA 1PZDA 3D4VA 4EJYA 3OC3C 1N3CA 1AISA 2HKPA 1TBPA 1UT7A 1KO9A 3EIKA 3UW2A 1YQLA 1C9BB 1QN8A 4HJHA 3RPJA 2NLVA 2NOLA 2QREA 1LWWA 3OSMA 1NGMA 1QNAA 2NWVA 4QG5A 1DIZA 1UL7A 1N39A 2QRDA 2I5WA 1QN6A 1KYDA 2HZSA 1Q9UA 1TUOA 2NVMA 2FGTA 2HL8A 3TDHA 4EAJA 5BMNA 3F10A 3OH6A 2G30A 3TE5A 3CWTA 2NOZA 1EBMA 1PCMX 1QN3A 2D0AA 3PMGA 4I8OA 3RSMA 1QN7A 3ASMA 3OCIA 1W80A 2Y8QA 1WJWA 2JPIA 2LAEA 3C04A 3IH7A 1TGHA 4ROCB 5HSHA 4EAKA 3KTUA 1NVPA 1CDWA 2JHJA 3OSEA 2DKAA 1JDYA 2H5AX 2OOYA 3KRMA 3CVTA 1V5SA 1VKLA 1VOLB 1YQMA 4EAIA 3OGDA 1PCZA 3CW7A 1QN5A 4WX8A 1YTFA 5JN5A 5AN4A 1K35A 2MZ8A 2H4LX 1JFIC 1QN4A 3EAYA 4C7PA 1PVSA 4EALA 1HU0A 2FKMX 3ULXA 2XHIA 4ROEB 2YA3A 2D0CA 4Q11A 3N89A 4BJUA 4IL8A 1QNEA 2JHNA 1QTPA 3HS9A 3D7QA 5IYCP 2Z0FA 2V92A 3OH9A 2YH5A 2Y8LA 1D3UA 2F7LA 2IV9A 1RM1A 2FKFA 1TBAB 2HL9A 2QLVA 3DPUA 2NOEA 2NOIA 2FUVA 2Z8UA 2PWWA 3CVSA 1M5Q1 1YTBA 3OLPA 3H1ZA 2D0BA 5KL0A 5EPCA 5BMPA 3I0WA 1KFIA 1XSZA 1MP9A 1UT4A 3CWSA 4RODB 2DKCA 1KY6A 5F9CA 3OSTA 2MJ7A 4MRQA 2EHBD 1YQKA 3VN5A 3T4NA 2QRCA 1KFQA 1C4GA 3DPTA 5IYBP 1NH2A 1J3MA 3CWAA 2OOXA 3ENOC 4CFFA 4EAGA 1LWVA 1LWYA 1FN7A 1LXTA 2JOIA 4PY5A 2DKDA 3BKQX 2QR1A 2ZFDB 2V9JA 3F0ZA 1KY7A 4TPSA 4D7RA 2NOBA 3PDKA 1QN9A 1KYUA 2HZMA 1VOKA 2VJ0A
chains in the Genus database with same CATH topology
1V5SA 2V8QA 4EAIA 2QREA 1UL7A 4EALA 2QRDA 2YA3A 3TDHA 4EAJA 2EHBD 3TE5A 3T4NA 2QRCA 2OOXA 2V92A 4CFFA 4EAGA 2Y8QA 2Y8LA 2QR1A 2ZFDB 2V9JA 4EAKA 2QLVA 3OSEA 2OOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V5S A;  2V8Q A;  4EAI A;  2QRE A;  1UL7 A;  4EAL A;  2QRD A;  2YA3 A;  3TDH A;  4EAJ A;  2EHB D;  3TE5 A;  3T4N A;  2QRC A;  2OOX A;  2V92 A;  4CFF A;  4EAG A;  2Y8Q A;  2Y8L A;  2QR1 A;  2ZFD B;  2V9J A;  4EAK A;  2QLV A;  3OSE A;  2OOY A; 
#chains in the Genus database with same CATH topology
 1E42 A;  2V8Q A;  1M3H A;  1N3A A;  2NOH A;  4D7Q A;  1R4X A;  1T6A A;  2R5X A;  4WZS D;  1KYF A;  1VTO A;  1QNB A;  3SNS A;  1QNC A;  3HS8 A;  3I3W A;  5JMV D;  4B0A A;  1MPG A;  1WQA A;  2IV8 A;  3CWU A;  3ENC A;  1VTL E;  1QTS A;  1EUV A;  2O3O A;  1C47 A;  4EJZ A;  1P5G X;  1K2Y X;  4DUL A;  1M3Q A;  4WXA A;  1PCJ X;  2NOF A;  3I0X A;  1YQR A;  5IYD P;  1P5D X;  3NA5 A;  1B9K A;  1PZD A;  3D4V A;  4EJY A;  3OC3 C;  1N3C A;  1AIS A;  2HKP A;  1TBP A;  1UT7 A;  1KO9 A;  3EIK A;  3UW2 A;  1YQL A;  1C9B B;  1QN8 A;  4HJH A;  3RPJ A;  2NLV A;  2NOL A;  2QRE A;  1LWW A;  3OSM A;  1NGM A;  1QNA A;  2NWV A;  4QG5 A;  1DIZ A;  1UL7 A;  1N39 A;  2QRD A;  2I5W A;  1QN6 A;  1KYD A;  2HZS A;  1Q9U A;  1TUO A;  2NVM A;  2FGT A;  2HL8 A;  3TDH A;  4EAJ A;  5BMN A;  3F10 A;  3OH6 A;  2G30 A;  3TE5 A;  3CWT A;  2NOZ A;  1EBM A;  1PCM X;  1QN3 A;  2D0A A;  3PMG A;  4I8O A;  3RSM A;  1QN7 A;  3ASM A;  3OCI A;  1W80 A;  2Y8Q A;  1WJW A;  2JPI A;  2LAE A;  3C04 A;  3IH7 A;  1TGH A;  4ROC B;  5HSH A;  4EAK A;  3KTU A;  1NVP A;  1CDW A;  2JHJ A;  3OSE A;  2DKA A;  1JDY A;  2H5A X;  2OOY A;  3KRM A;  3CVT A;  1V5S A;  1VKL A;  1VOL B;  1YQM A;  4EAI A;  3OGD A;  1PCZ A;  3CW7 A;  1QN5 A;  4WX8 A;  1YTF A;  5JN5 A;  5AN4 A;  1K35 A;  2MZ8 A;  2H4L X;  1JFI C;  1QN4 A;  3EAY A;  4C7P A;  1PVS A;  4EAL A;  1HU0 A;  2FKM X;  3ULX A;  2XHI A;  4ROE B;  2YA3 A;  2D0C A;  4Q11 A;  3N89 A;  4BJU A;  4IL8 A;  1QNE A;  2JHN A;  1QTP A;  3HS9 A;  3D7Q A;  5IYC P;  2Z0F A;  2V92 A;  3OH9 A;  2YH5 A;  2Y8L A;  1D3U A;  2F7L A;  2IV9 A;  1RM1 A;  2FKF A;  1TBA B;  2HL9 A;  2QLV A;  3DPU A;  2NOE A;  2NOI A;  2FUV A;  2Z8U A;  2PWW A;  3CVS A;  1M5Q 1;  1YTB A;  3OLP A;  3H1Z A;  2D0B A;  5KL0 A;  5EPC A;  5BMP A;  3I0W A;  1KFI A;  1XSZ A;  1MP9 A;  1UT4 A;  3CWS A;  4ROD B;  2DKC A;  1KY6 A;  5F9C A;  3OST A;  2MJ7 A;  4MRQ A;  2EHB D;  1YQK A;  3VN5 A;  3T4N A;  2QRC A;  1KFQ A;  1C4G A;  3DPT A;  5IYB P;  1NH2 A;  1J3M A;  3CWA A;  2OOX A;  3ENO C;  4CFF A;  4EAG A;  1LWV A;  1LWY A;  1FN7 A;  1LXT A;  2JOI A;  4PY5 A;  2DKD A;  3BKQ X;  2QR1 A;  2ZFD B;  2V9J A;  3F0Z A;  1KY7 A;  4TPS A;  4D7R A;  2NOB A;  3PDK A;  1QN9 A;  1KYU A;  2HZM A;  1VOK A;  2VJ0 A; 
#chains in the Genus database with same CATH homology
 1V5S A;  2V8Q A;  4EAI A;  2QRE A;  1UL7 A;  4EAL A;  2QRD A;  2YA3 A;  3TDH A;  4EAJ A;  2EHB D;  3TE5 A;  3T4N A;  2QRC A;  2OOX A;  2V92 A;  4CFF A;  4EAG A;  2Y8Q A;  2Y8L A;  2QR1 A;  2ZFD B;  2V9J A;  4EAK A;  2QLV A;  3OSE A;  2OOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...