3D7QA

Crystal structure of a xisi-like protein (npun_ar114) from nostoc punctiforme pcc 73102 at 2.30 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
109
Chain Sequence
GMDKLNEYRTKVRQLLTKHLQYKGDVEVEQIFDEEHDHYQIISVGWNNQHRIYGPIMHLDIKNNKIWIQQNTTEADIALELMEMGIDKQDIVIGFHTPKMRQLSGFAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XisI protein-like
publication title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models.
pubmed doi rcsb
source organism Nostoc punctiforme pcc 73102
molecule tags Unknown function
total genus 30
structure length 109
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08869 XisI XisI protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.110 Alpha Beta 2-Layer Sandwich TATA-Binding Protein XisI-like 3d7qA00
2NWVA 2NVMA 2NLVA 3D7QA
chains in the Genus database with same CATH superfamily
2OOXA 1N3CA 2MJ7A 4WZSD 4EJZA 5IYDP 3CW7A 1N39A 3PMGA 2JPIA 1YQKA 3RPJA 3OGDA 2NOLA 3D4VA 1QNAA 3IH7A 3F10A 1KFIA 1QNEA 1C47A 1KY6A 1KYDA 4Q11A 4EALA 3CVTA 1M5Q1 2D0AA 2MZ8A 1PCMX 3DPTA 1AISA 3ULXA 1VKLA 1T6AA 4EJYA 2F7LA 1W80A 1KY7A 1QTPA 2QRCA 1P5GX 3ASMA 4ROCB 5BMNA 2FUVA 3I3WA 4PY5A 1PVSA 1YTFA 1JFIC 2HL8A 1QNCA 3KTUA 2JOIA 2FKFA 2R5XA 4IL8A 3OH9A 5JMVD 4D7RA 2QRDA 1XSZA 2NVMA 1C9BB 2Z8UA 3C04A 2NWVA 2YH5A 3F0ZA 1M3HA 1QN9A 1QN6A 1UT7A 2QLVA 4I8OA 3T4NA 1E42A 1VOLB 4C7PA 1N3AA 1LWWA 5KL0A 2EHBD 3H1ZA 3OLPA 2NOZA 3ENCA 2VJ0A 1K35A 1KYFA 1LXTA 1PZDA 3HS9A 1MP9A 4DULA 2NOBA 4B0AA 1Q9UA 4EAGA 1FN7A 1R4XA 4CFFA 1D3UA 1EBMA 2FKMX 2HZMA 3OC3C 3OSEA 1YTBA 4EAKA 1KFQA 1VOKA 2Y8LA 1LWYA 5IYBP 1RM1A 3I0XA 2QR1A 5IYCP 3OH6A 2IV9A 2V8QA 1J3MA 1QTSA 2DKCA 2OOYA 4EAIA 2NOHA 2O3OA 2ZFDB 4HJHA 2HZSA 5F9CA 2QREA 3ENOC 1QN5A 2H5AX 1NGMA 5AN4A 1QN3A 1TBAB 1VTLE 1M3QA 3CWAA 3KRMA 3I0WA 1PCZA 2V9JA 1UT4A 1MPGA 1WQAA 2H4LX 3DPUA 2HKPA 5HSHA 3CWTA 3TDHA 2G30A 1KYUA 1KO9A 2NOIA 1WJWA 2YA3A 3N89A 3CWSA 3OSTA 4D7QA 1UL7A 3UW2A 1NH2A 3OCIA 2DKAA 1B9KA 2D0BA 1TBPA 3TE5A 2I5WA 3OSMA 2FGTA 1C4GA 2D0CA 4QG5A 5BMPA 4BJUA 2DKDA 1LWVA 1VTOA 1YQMA 2NLVA 1NVPA 1PCJX 1YQLA 2V92A 2JHJA 4TPSA 3CWUA 1P5DX 2HL9A 3SNSA 4RODB 4WX8A 2NOFA 2IV8A 2JHNA 1CDWA 5JN5A 1K2YX 4EAJA 2PWWA 4ROEB 4WXAA 1QNBA 3PDKA 1TGHA 3BKQX 1QN7A 2LAEA 1DIZA 1QN8A 2XHIA 2Y8QA 3VN5A 3CVSA 3NA5A 1YQRA 1HU0A 1EUVA 1TUOA 2Z0FA 3EIKA 1V5SA 4MRQA 3EAYA 3D7QA 3HS8A 1QN4A 5EPCA 3RSMA 1JDYA 2NOEA
chains in the Genus database with same CATH topology
2NWVA 2NVMA 2NLVA 3D7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWV A;  2NVM A;  2NLV A;  3D7Q A; 
#chains in the Genus database with same CATH topology
 2OOX A;  1N3C A;  2MJ7 A;  4WZS D;  4EJZ A;  5IYD P;  3CW7 A;  1N39 A;  3PMG A;  2JPI A;  1YQK A;  3RPJ A;  3OGD A;  2NOL A;  3D4V A;  1QNA A;  3IH7 A;  3F10 A;  1KFI A;  1QNE A;  1C47 A;  1KY6 A;  1KYD A;  4Q11 A;  4EAL A;  3CVT A;  1M5Q 1;  2D0A A;  2MZ8 A;  1PCM X;  3DPT A;  1AIS A;  3ULX A;  1VKL A;  1T6A A;  4EJY A;  2F7L A;  1W80 A;  1KY7 A;  1QTP A;  2QRC A;  1P5G X;  3ASM A;  4ROC B;  5BMN A;  2FUV A;  3I3W A;  4PY5 A;  1PVS A;  1YTF A;  1JFI C;  2HL8 A;  1QNC A;  3KTU A;  2JOI A;  2FKF A;  2R5X A;  4IL8 A;  3OH9 A;  5JMV D;  4D7R A;  2QRD A;  1XSZ A;  2NVM A;  1C9B B;  2Z8U A;  3C04 A;  2NWV A;  2YH5 A;  3F0Z A;  1M3H A;  1QN9 A;  1QN6 A;  1UT7 A;  2QLV A;  4I8O A;  3T4N A;  1E42 A;  1VOL B;  4C7P A;  1N3A A;  1LWW A;  5KL0 A;  2EHB D;  3H1Z A;  3OLP A;  2NOZ A;  3ENC A;  2VJ0 A;  1K35 A;  1KYF A;  1LXT A;  1PZD A;  3HS9 A;  1MP9 A;  4DUL A;  2NOB A;  4B0A A;  1Q9U A;  4EAG A;  1FN7 A;  1R4X A;  4CFF A;  1D3U A;  1EBM A;  2FKM X;  2HZM A;  3OC3 C;  3OSE A;  1YTB A;  4EAK A;  1KFQ A;  1VOK A;  2Y8L A;  1LWY A;  5IYB P;  1RM1 A;  3I0X A;  2QR1 A;  5IYC P;  3OH6 A;  2IV9 A;  2V8Q A;  1J3M A;  1QTS A;  2DKC A;  2OOY A;  4EAI A;  2NOH A;  2O3O A;  2ZFD B;  4HJH A;  2HZS A;  5F9C A;  2QRE A;  3ENO C;  1QN5 A;  2H5A X;  1NGM A;  5AN4 A;  1QN3 A;  1TBA B;  1VTL E;  1M3Q A;  3CWA A;  3KRM A;  3I0W A;  1PCZ A;  2V9J A;  1UT4 A;  1MPG A;  1WQA A;  2H4L X;  3DPU A;  2HKP A;  5HSH A;  3CWT A;  3TDH A;  2G30 A;  1KYU A;  1KO9 A;  2NOI A;  1WJW A;  2YA3 A;  3N89 A;  3CWS A;  3OST A;  4D7Q A;  1UL7 A;  3UW2 A;  1NH2 A;  3OCI A;  2DKA A;  1B9K A;  2D0B A;  1TBP A;  3TE5 A;  2I5W A;  3OSM A;  2FGT A;  1C4G A;  2D0C A;  4QG5 A;  5BMP A;  4BJU A;  2DKD A;  1LWV A;  1VTO A;  1YQM A;  2NLV A;  1NVP A;  1PCJ X;  1YQL A;  2V92 A;  2JHJ A;  4TPS A;  3CWU A;  1P5D X;  2HL9 A;  3SNS A;  4ROD B;  4WX8 A;  2NOF A;  2IV8 A;  2JHN A;  1CDW A;  5JN5 A;  1K2Y X;  4EAJ A;  2PWW A;  4ROE B;  4WXA A;  1QNB A;  3PDK A;  1TGH A;  3BKQ X;  1QN7 A;  2LAE A;  1DIZ A;  1QN8 A;  2XHI A;  2Y8Q A;  3VN5 A;  3CVS A;  3NA5 A;  1YQR A;  1HU0 A;  1EUV A;  1TUO A;  2Z0F A;  3EIK A;  1V5S A;  4MRQ A;  3EAY A;  3D7Q A;  3HS8 A;  1QN4 A;  5EPC A;  3RSM A;  1JDY A;  2NOE A; 
#chains in the Genus database with same CATH homology
 2NWV A;  2NVM A;  2NLV A;  3D7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...