3D7QA

Crystal structure of a xisi-like protein (npun_ar114) from nostoc punctiforme pcc 73102 at 2.30 a resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
109
Chain Sequence
GMDKLNEYRTKVRQLLTKHLQYKGDVEVEQIFDEEHDHYQIISVGWNNQHRIYGPIMHLDIKNNKIWIQQNTTEADIALELMEMGIDKQDIVIGFHTPKMRQLSGFAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords XisI protein-like
publication title Site-specific recombination of nitrogen-fixation genes in cyanobacteria by XisF-XisH-XisI complex: Structures and models.
pubmed doi rcsb
source organism Nostoc punctiforme pcc 73102
total genus 30
structure length 109
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08869 XisI XisI protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.110 Alpha Beta 2-Layer Sandwich TATA-Binding Protein XisI-like 3d7qA00
2NVMA 3D7QA 2NLVA 2NWVA
chains in the Genus database with same CATH superfamily
1TGHA 2NVMA 3I0XA 3SNSA 1E42A 3OCIA 4I8OA 2Z0FA 1QNAA 1LWWA 3C04A 3CWSA 3IH7A 3OH9A 3I3WA 1KFIA 3ULXA 1QN9A 1LXTA 1CDWA 2V8QA 3CWTA 2EHBD 1QN3A 3OLPA 2OOYA 2LAEA 2JOIA 2MZ8A 3I0WA 3CWAA 3OSEA 3DPUA 1QN8A 3F10A 2D0BA 4D7QA 1K2YX 3ASMA 1QNCA 5IYDP 3ENOC 3OC3C 2HZMA 3BKQX 4EAGA 1C47A 4TPSA 1MP9A 2FKMX 1B9KA 1QN4A 1UT7A 2NOEA 2QR1A 4EAKA 1NVPA 5IYCP 1KY7A 2VJ0A 4EAIA 1EBMA 1KYDA 4EALA 2HKPA 2MJ7A 3NA5A 1HU0A 1KYFA 1PVSA 1KO9A 4RODB 1TBPA 2XHIA 5HSHA 1NH2A 1FN7A 1WQAA 3KTUA 5JN5A 1DIZA 4Q11A 1D3UA 2QLVA 3RPJA 1M3HA 2QREA 2NOHA 2V92A 1N3CA 4WZSD 2PWWA 1VOKA 3CW7A 2JHNA 4EJYA 2Y8QA 2YH5A 3UW2A 4PY5A 1YQRA 3DPTA 1JFIC 5JMVD 2DKDA 1QNBA 2H4LX 1TBAB 2QRDA 1UT4A 2FUVA 1MPGA 1WJWA 1PCMX 2R5XA 3KRMA 2NOFA 1JDYA 1LWVA 3HS8A 4IL8A 1AISA 1YQMA 2NOZA 1C9BB 2Y8LA 1QNEA 1P5DX 2HL9A 2ZFDB 3OSTA 2F7LA 1QN6A 3EAYA 2I5WA 2FGTA 3OGDA 4WXAA 1QTSA 2HL8A 5EPCA 1W80A 3PMGA 3TDHA 4EAJA 5F9CA 2H5AX 1XSZA 2D0AA 1YQKA 1YTBA 3ENCA 3D4VA 1N3AA 1C4GA 1QTPA 2IV8A 3OSMA 1QN5A 2FKFA 3OH6A 2JPIA 2QRCA 4C7PA 1VTOA 4CFFA 3EIKA 3F0ZA 4WX8A 1KFQA 4HJHA 1KYUA 3T4NA 2YA3A 2Z8UA 1T6AA 2NOBA 3CVSA 2NOIA 5AN4A 4D7RA 1EUVA 1NGMA 1TUOA 1N39A 1M5Q1 1V5SA 2NLVA 2IV9A 4BJUA 3HS9A 1R4XA 2G30A 2DKAA 1Q9UA 2DKCA 1LWYA 3RSMA 2HZSA 3N89A 1PZDA 4B0AA 2OOXA 2JHJA 3D7QA 3TE5A 1YQLA 5IYBP 1QN7A 2NWVA 2O3OA 3CVTA 1UL7A 5BMPA 4ROCB 5BMNA 1J3MA 2V9JA 1P5GX 3H1ZA 4MRQA 4DULA 3CWUA 4ROEB 1RM1A 1K35A 2D0CA 4EJZA 3PDKA 1KY6A 5KL0A 1VKLA 1VOLB 1M3QA 2NOLA 4QG5A 1PCZA 1PCJX 1VTLE 3VN5A 1YTFA
chains in the Genus database with same CATH topology
2NVMA 3D7QA 2NLVA 2NWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVM A;  3D7Q A;  2NLV A;  2NWV A; 
#chains in the Genus database with same CATH topology
 1TGH A;  2NVM A;  3I0X A;  3SNS A;  1E42 A;  3OCI A;  4I8O A;  2Z0F A;  1QNA A;  1LWW A;  3C04 A;  3CWS A;  3IH7 A;  3OH9 A;  3I3W A;  1KFI A;  3ULX A;  1QN9 A;  1LXT A;  1CDW A;  2V8Q A;  3CWT A;  2EHB D;  1QN3 A;  3OLP A;  2OOY A;  2LAE A;  2JOI A;  2MZ8 A;  3I0W A;  3CWA A;  3OSE A;  3DPU A;  1QN8 A;  3F10 A;  2D0B A;  4D7Q A;  1K2Y X;  3ASM A;  1QNC A;  5IYD P;  3ENO C;  3OC3 C;  2HZM A;  3BKQ X;  4EAG A;  1C47 A;  4TPS A;  1MP9 A;  2FKM X;  1B9K A;  1QN4 A;  1UT7 A;  2NOE A;  2QR1 A;  4EAK A;  1NVP A;  5IYC P;  1KY7 A;  2VJ0 A;  4EAI A;  1EBM A;  1KYD A;  4EAL A;  2HKP A;  2MJ7 A;  3NA5 A;  1HU0 A;  1KYF A;  1PVS A;  1KO9 A;  4ROD B;  1TBP A;  2XHI A;  5HSH A;  1NH2 A;  1FN7 A;  1WQA A;  3KTU A;  5JN5 A;  1DIZ A;  4Q11 A;  1D3U A;  2QLV A;  3RPJ A;  1M3H A;  2QRE A;  2NOH A;  2V92 A;  1N3C A;  4WZS D;  2PWW A;  1VOK A;  3CW7 A;  2JHN A;  4EJY A;  2Y8Q A;  2YH5 A;  3UW2 A;  4PY5 A;  1YQR A;  3DPT A;  1JFI C;  5JMV D;  2DKD A;  1QNB A;  2H4L X;  1TBA B;  2QRD A;  1UT4 A;  2FUV A;  1MPG A;  1WJW A;  1PCM X;  2R5X A;  3KRM A;  2NOF A;  1JDY A;  1LWV A;  3HS8 A;  4IL8 A;  1AIS A;  1YQM A;  2NOZ A;  1C9B B;  2Y8L A;  1QNE A;  1P5D X;  2HL9 A;  2ZFD B;  3OST A;  2F7L A;  1QN6 A;  3EAY A;  2I5W A;  2FGT A;  3OGD A;  4WXA A;  1QTS A;  2HL8 A;  5EPC A;  1W80 A;  3PMG A;  3TDH A;  4EAJ A;  5F9C A;  2H5A X;  1XSZ A;  2D0A A;  1YQK A;  1YTB A;  3ENC A;  3D4V A;  1N3A A;  1C4G A;  1QTP A;  2IV8 A;  3OSM A;  1QN5 A;  2FKF A;  3OH6 A;  2JPI A;  2QRC A;  4C7P A;  1VTO A;  4CFF A;  3EIK A;  3F0Z A;  4WX8 A;  1KFQ A;  4HJH A;  1KYU A;  3T4N A;  2YA3 A;  2Z8U A;  1T6A A;  2NOB A;  3CVS A;  2NOI A;  5AN4 A;  4D7R A;  1EUV A;  1NGM A;  1TUO A;  1N39 A;  1M5Q 1;  1V5S A;  2NLV A;  2IV9 A;  4BJU A;  3HS9 A;  1R4X A;  2G30 A;  2DKA A;  1Q9U A;  2DKC A;  1LWY A;  3RSM A;  2HZS A;  3N89 A;  1PZD A;  4B0A A;  2OOX A;  2JHJ A;  3D7Q A;  3TE5 A;  1YQL A;  5IYB P;  1QN7 A;  2NWV A;  2O3O A;  3CVT A;  1UL7 A;  5BMP A;  4ROC B;  5BMN A;  1J3M A;  2V9J A;  1P5G X;  3H1Z A;  4MRQ A;  4DUL A;  3CWU A;  4ROE B;  1RM1 A;  1K35 A;  2D0C A;  4EJZ A;  3PDK A;  1KY6 A;  5KL0 A;  1VKL A;  1VOL B;  1M3Q A;  2NOL A;  4QG5 A;  1PCZ A;  1PCJ X;  1VTL E;  3VN5 A;  1YTF A; 
#chains in the Genus database with same CATH homology
 2NVM A;  3D7Q A;  2NLV A;  2NWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...