4EALA

Co-crystal of ampk core with atp soaked with amp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
92
Chain Sequence
WHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDGSHTIEFFEMCANLIKILAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 5'-AMP-activated protein kinase catalytic subunit alpha-1
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 92
sequence length 99
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4ealA01
2EHBD 2V8QA 2Y8LA 3OSEA 2V9JA 4EAKA 3TE5A 2QLVA 2OOYA 2QR1A 1UL7A 2QRDA 2V92A 1V5SA 3TDHA 4EAJA 2QREA 4EAGA 2Y8QA 4EALA 4EAIA 2OOXA 2YA3A 4CFFA 3T4NA 2ZFDB 2QRCA
chains in the Genus database with same CATH superfamily
3OGDA 1LWVA 2Y8LA 2NOFA 1PZDA 2NOZA 4EAKA 2FKMX 3TE5A 1QN7A 4RODB 4C7PA 3RPJA 1KYFA 3CWTA 2DKDA 3OSTA 2LAEA 1VOLB 1JFIC 2YH5A 4QG5A 3F0ZA 1VTLE 1V5SA 3D4VA 1MPGA 1EBMA 1KY7A 3DPUA 1JDYA 1KY6A 4D7RA 4WXAA 5HSHA 3TDHA 5IYCP 4HJHA 3OLPA 1PVSA 4B0AA 2PWWA 4BJUA 5JMVD 1QN4A 3ENOC 4EALA 3CVSA 1M3HA 3C04A 1YTFA 2FUVA 1VOKA 1HU0A 1TUOA 1QN8A 1NVPA 3RSMA 2VJ0A 1YQKA 4CFFA 2Z0FA 5BMPA 2FGTA 2V8QA 1KFIA 2JOIA 5IYBP 1PCMX 1KYUA 2NLVA 2HL9A 1WQAA 3D7QA 1J3MA 2V9JA 1C47A 1P5DX 2DKCA 1VTOA 2NOBA 1DIZA 1D3UA 1UT7A 1TBAB 2QR1A 1KYDA 1E42A 1QTPA 4WX8A 4DULA 5KL0A 2G30A 5BMNA 3BKQX 2XHIA 4ROEB 3IH7A 5AN4A 1VKLA 2I5WA 1PCZA 3EAYA 2O3OA 3ENCA 3I3WA 3ULXA 1R4XA 4D7QA 1QN3A 3CVTA 4EJYA 1QN5A 1XSZA 2D0BA 1UT4A 1W80A 4PY5A 3SNSA 2OOXA 3NA5A 3HS8A 3T4NA 3CW7A 1YTBA 2EHBD 3OH9A 4Q11A 1QNAA 2MJ7A 1T6AA 2HL8A 2F7LA 1QNCA 2FKFA 2OOYA 3ASMA 1KO9A 1UL7A 1LXTA 1CDWA 3OCIA 2QRDA 4EJZA 2V92A 2JPIA 1TGHA 5IYDP 1YQLA 2JHJA 1YQRA 2NOIA 3OC3C 1LWWA 1K2YX 2IV8A 1C9BB 2D0AA 3OSMA 3VN5A 3PDKA 1EUVA 1N3AA 2H4LX 3OH6A 3DPTA 1M5Q1 3KRMA 1N39A 2NVMA 1LWYA 4EAIA 2Z8UA 2YA3A 2DKAA 3HS9A 5EPCA 2ZFDB 2QRCA 1RM1A 4WZSD 2IV9A 3CWAA 1K35A 3OSEA 1TBPA 1YQMA 1B9KA 4TPSA 2H5AX 1QN6A 2NOLA 1C4GA 2QLVA 3I0WA 1N3CA 2NOHA 2HZMA 3PMGA 4I8OA 4ROCB 3H1ZA 1QNEA 3CWUA 2R5XA 1MP9A 4MRQA 2D0CA 3KTUA 1QNBA 2NWVA 5F9CA 4EAJA 1NGMA 1AISA 3CWSA 3F10A 2QREA 3I0XA 1QN9A 4EAGA 2HKPA 2Y8QA 1M3QA 2NOEA 3UW2A 2MZ8A 3N89A 1NH2A 3EIKA 4IL8A 2JHNA 2HZSA 1FN7A 1Q9UA 1QTSA 5JN5A 1KFQA 1P5GX 1PCJX 1WJWA
chains in the Genus database with same CATH topology
2EHBD 2V8QA 2Y8LA 3OSEA 2V9JA 4EAKA 3TE5A 2QLVA 2OOYA 2QR1A 1UL7A 2QRDA 2V92A 1V5SA 3TDHA 4EAJA 2QREA 4EAGA 2Y8QA 4EALA 4EAIA 2OOXA 2YA3A 4CFFA 3T4NA 2ZFDB 2QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHB D;  2V8Q A;  2Y8L A;  3OSE A;  2V9J A;  4EAK A;  3TE5 A;  2QLV A;  2OOY A;  2QR1 A;  1UL7 A;  2QRD A;  2V92 A;  1V5S A;  3TDH A;  4EAJ A;  2QRE A;  4EAG A;  2Y8Q A;  4EAL A;  4EAI A;  2OOX A;  2YA3 A;  4CFF A;  3T4N A;  2ZFD B;  2QRC A; 
#chains in the Genus database with same CATH topology
 3OGD A;  1LWV A;  2Y8L A;  2NOF A;  1PZD A;  2NOZ A;  4EAK A;  2FKM X;  3TE5 A;  1QN7 A;  4ROD B;  4C7P A;  3RPJ A;  1KYF A;  3CWT A;  2DKD A;  3OST A;  2LAE A;  1VOL B;  1JFI C;  2YH5 A;  4QG5 A;  3F0Z A;  1VTL E;  1V5S A;  3D4V A;  1MPG A;  1EBM A;  1KY7 A;  3DPU A;  1JDY A;  1KY6 A;  4D7R A;  4WXA A;  5HSH A;  3TDH A;  5IYC P;  4HJH A;  3OLP A;  1PVS A;  4B0A A;  2PWW A;  4BJU A;  5JMV D;  1QN4 A;  3ENO C;  4EAL A;  3CVS A;  1M3H A;  3C04 A;  1YTF A;  2FUV A;  1VOK A;  1HU0 A;  1TUO A;  1QN8 A;  1NVP A;  3RSM A;  2VJ0 A;  1YQK A;  4CFF A;  2Z0F A;  5BMP A;  2FGT A;  2V8Q A;  1KFI A;  2JOI A;  5IYB P;  1PCM X;  1KYU A;  2NLV A;  2HL9 A;  1WQA A;  3D7Q A;  1J3M A;  2V9J A;  1C47 A;  1P5D X;  2DKC A;  1VTO A;  2NOB A;  1DIZ A;  1D3U A;  1UT7 A;  1TBA B;  2QR1 A;  1KYD A;  1E42 A;  1QTP A;  4WX8 A;  4DUL A;  5KL0 A;  2G30 A;  5BMN A;  3BKQ X;  2XHI A;  4ROE B;  3IH7 A;  5AN4 A;  1VKL A;  2I5W A;  1PCZ A;  3EAY A;  2O3O A;  3ENC A;  3I3W A;  3ULX A;  1R4X A;  4D7Q A;  1QN3 A;  3CVT A;  4EJY A;  1QN5 A;  1XSZ A;  2D0B A;  1UT4 A;  1W80 A;  4PY5 A;  3SNS A;  2OOX A;  3NA5 A;  3HS8 A;  3T4N A;  3CW7 A;  1YTB A;  2EHB D;  3OH9 A;  4Q11 A;  1QNA A;  2MJ7 A;  1T6A A;  2HL8 A;  2F7L A;  1QNC A;  2FKF A;  2OOY A;  3ASM A;  1KO9 A;  1UL7 A;  1LXT A;  1CDW A;  3OCI A;  2QRD A;  4EJZ A;  2V92 A;  2JPI A;  1TGH A;  5IYD P;  1YQL A;  2JHJ A;  1YQR A;  2NOI A;  3OC3 C;  1LWW A;  1K2Y X;  2IV8 A;  1C9B B;  2D0A A;  3OSM A;  3VN5 A;  3PDK A;  1EUV A;  1N3A A;  2H4L X;  3OH6 A;  3DPT A;  1M5Q 1;  3KRM A;  1N39 A;  2NVM A;  1LWY A;  4EAI A;  2Z8U A;  2YA3 A;  2DKA A;  3HS9 A;  5EPC A;  2ZFD B;  2QRC A;  1RM1 A;  4WZS D;  2IV9 A;  3CWA A;  1K35 A;  3OSE A;  1TBP A;  1YQM A;  1B9K A;  4TPS A;  2H5A X;  1QN6 A;  2NOL A;  1C4G A;  2QLV A;  3I0W A;  1N3C A;  2NOH A;  2HZM A;  3PMG A;  4I8O A;  4ROC B;  3H1Z A;  1QNE A;  3CWU A;  2R5X A;  1MP9 A;  4MRQ A;  2D0C A;  3KTU A;  1QNB A;  2NWV A;  5F9C A;  4EAJ A;  1NGM A;  1AIS A;  3CWS A;  3F10 A;  2QRE A;  3I0X A;  1QN9 A;  4EAG A;  2HKP A;  2Y8Q A;  1M3Q A;  2NOE A;  3UW2 A;  2MZ8 A;  3N89 A;  1NH2 A;  3EIK A;  4IL8 A;  2JHN A;  2HZS A;  1FN7 A;  1Q9U A;  1QTS A;  5JN5 A;  1KFQ A;  1P5G X;  1PCJ X;  1WJW A; 
#chains in the Genus database with same CATH homology
 2EHB D;  2V8Q A;  2Y8L A;  3OSE A;  2V9J A;  4EAK A;  3TE5 A;  2QLV A;  2OOY A;  2QR1 A;  1UL7 A;  2QRD A;  2V92 A;  1V5S A;  3TDH A;  4EAJ A;  2QRE A;  4EAG A;  2Y8Q A;  4EAL A;  4EAI A;  2OOX A;  2YA3 A;  4CFF A;  3T4N A;  2ZFD B;  2QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...