2QRCA

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and amp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
116
Chain Sequence
KWHFGVRCRGDAPEILLAVYRALQRAGAQFTVPKPVNGKYRSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSHDLKSSFPFLDLCAMLVCKLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 32
structure length 116
sequence length 126
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qrcA00
4EAKA 2QRCA 4EALA 3T4NA 2QREA 2V9JA 2V92A 1V5SA 4EAGA 4EAJA 2Y8QA 3OSEA 1UL7A 2QR1A 2QLVA 3TDHA 2Y8LA 2QRDA 4EAIA 2ZFDB 2EHBD 2V8QA 2YA3A 3TE5A 4CFFA 2OOXA 2OOYA
chains in the Genus database with same CATH superfamily
1M3QA 3ENOC 5KL0A 4MRQA 1FN7A 2JHJA 2MZ8A 2R5XA 3EIKA 3T4NA 4WZSD 5IYDP 1TUOA 3CVSA 5BMPA 1KYDA 3D4VA 3CWAA 1T6AA 2NVMA 3PMGA 1QNAA 2IV9A 4HJHA 5JMVD 1KFQA 2VJ0A 2DKAA 3NA5A 1D3UA 1HU0A 3OGDA 3KTUA 3UW2A 1QNCA 4TPSA 1P5DX 5F9CA 2JHNA 3N89A 2JPIA 3BKQX 4EAKA 1C47A 2QRCA 1LWVA 3ULXA 3HS9A 3D7QA 4BJUA 1TBAB 1V5SA 2PWWA 1QNEA 4EAJA 1VTLE 2YH5A 1YQRA 2FKMX 2NOLA 1UL7A 4I8OA 1P5GX 2HZSA 2G30A 2QR1A 3VN5A 1UT7A 1QNBA 2Z8UA 1KY7A 4RODB 3RPJA 1DIZA 1QTPA 3OCIA 5EPCA 2QRDA 3KRMA 2MJ7A 2ZFDB 4D7RA 4WX8A 1Q9UA 2FKFA 2FUVA 4QG5A 3TE5A 1KFIA 1J3MA 5AN4A 2NOBA 2DKCA 3PDKA 1KO9A 5HSHA 4PY5A 2OOYA 3RSMA 1QN5A 4EALA 1MPGA 3CWSA 1VOKA 1LWWA 4B0AA 5BMNA 2V9JA 1LXTA 3I0XA 1YQLA 1PCMX 3ENCA 4IL8A 2Y8QA 1CDWA 4Q11A 2HL8A 4D7QA 3OLPA 1YQMA 2QLVA 3CW7A 1YTFA 1RM1A 4EJZA 3TDHA 1M5Q1 1E42A 3DPUA 3OSTA 1KYUA 4ROCB 3ASMA 2H4LX 1JFIC 3F10A 2H5AX 4EAIA 2HZMA 1LWYA 2NOZA 3EAYA 1MP9A 3F0ZA 1NGMA 1VOLB 1KY6A 1PCZA 2XHIA 2EHBD 2V8QA 1PZDA 2YA3A 2FGTA 3DPTA 1QN8A 1UT4A 4CFFA 1XSZA 1R4XA 2NLVA 1VTOA 1N3CA 3C04A 3OH9A 5IYBP 1K2YX 1JDYA 1YQKA 4EJYA 2O3OA 2DKDA 1WQAA 2QREA 3H1ZA 1VKLA 2JOIA 2V92A 3OC3C 5IYCP 2LAEA 4EAGA 5JN5A 1QTSA 3OH6A 1NVPA 1QN3A 4WXAA 3OSEA 3IH7A 1AISA 3SNSA 2F7LA 1B9KA 2NOFA 1NH2A 2Z0FA 3I0WA 4DULA 2D0AA 4C7PA 4ROEB 1YTBA 2D0BA 3CWUA 2NOEA 2Y8LA 1TGHA 3CVTA 3CWTA 1QN4A 1QN6A 2NOIA 1N3AA 1QN9A 1PCJX 1EUVA 1PVSA 2NOHA 1K35A 1TBPA 2HKPA 2D0CA 1M3HA 1WJWA 3HS8A 2I5WA 2HL9A 2NWVA 1N39A 1QN7A 1W80A 3I3WA 1C9BB 2OOXA 2IV8A 1KYFA 3OSMA 1EBMA 1C4GA
chains in the Genus database with same CATH topology
4EAKA 2QRCA 4EALA 3T4NA 2QREA 2V9JA 2V92A 1V5SA 4EAGA 4EAJA 2Y8QA 3OSEA 1UL7A 2QR1A 2QLVA 3TDHA 2Y8LA 2QRDA 4EAIA 2ZFDB 2EHBD 2V8QA 2YA3A 3TE5A 4CFFA 2OOXA 2OOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAK A;  2QRC A;  4EAL A;  3T4N A;  2QRE A;  2V9J A;  2V92 A;  1V5S A;  4EAG A;  4EAJ A;  2Y8Q A;  3OSE A;  1UL7 A;  2QR1 A;  2QLV A;  3TDH A;  2Y8L A;  2QRD A;  4EAI A;  2ZFD B;  2EHB D;  2V8Q A;  2YA3 A;  3TE5 A;  4CFF A;  2OOX A;  2OOY A; 
#chains in the Genus database with same CATH topology
 1M3Q A;  3ENO C;  5KL0 A;  4MRQ A;  1FN7 A;  2JHJ A;  2MZ8 A;  2R5X A;  3EIK A;  3T4N A;  4WZS D;  5IYD P;  1TUO A;  3CVS A;  5BMP A;  1KYD A;  3D4V A;  3CWA A;  1T6A A;  2NVM A;  3PMG A;  1QNA A;  2IV9 A;  4HJH A;  5JMV D;  1KFQ A;  2VJ0 A;  2DKA A;  3NA5 A;  1D3U A;  1HU0 A;  3OGD A;  3KTU A;  3UW2 A;  1QNC A;  4TPS A;  1P5D X;  5F9C A;  2JHN A;  3N89 A;  2JPI A;  3BKQ X;  4EAK A;  1C47 A;  2QRC A;  1LWV A;  3ULX A;  3HS9 A;  3D7Q A;  4BJU A;  1TBA B;  1V5S A;  2PWW A;  1QNE A;  4EAJ A;  1VTL E;  2YH5 A;  1YQR A;  2FKM X;  2NOL A;  1UL7 A;  4I8O A;  1P5G X;  2HZS A;  2G30 A;  2QR1 A;  3VN5 A;  1UT7 A;  1QNB A;  2Z8U A;  1KY7 A;  4ROD B;  3RPJ A;  1DIZ A;  1QTP A;  3OCI A;  5EPC A;  2QRD A;  3KRM A;  2MJ7 A;  2ZFD B;  4D7R A;  4WX8 A;  1Q9U A;  2FKF A;  2FUV A;  4QG5 A;  3TE5 A;  1KFI A;  1J3M A;  5AN4 A;  2NOB A;  2DKC A;  3PDK A;  1KO9 A;  5HSH A;  4PY5 A;  2OOY A;  3RSM A;  1QN5 A;  4EAL A;  1MPG A;  3CWS A;  1VOK A;  1LWW A;  4B0A A;  5BMN A;  2V9J A;  1LXT A;  3I0X A;  1YQL A;  1PCM X;  3ENC A;  4IL8 A;  2Y8Q A;  1CDW A;  4Q11 A;  2HL8 A;  4D7Q A;  3OLP A;  1YQM A;  2QLV A;  3CW7 A;  1YTF A;  1RM1 A;  4EJZ A;  3TDH A;  1M5Q 1;  1E42 A;  3DPU A;  3OST A;  1KYU A;  4ROC B;  3ASM A;  2H4L X;  1JFI C;  3F10 A;  2H5A X;  4EAI A;  2HZM A;  1LWY A;  2NOZ A;  3EAY A;  1MP9 A;  3F0Z A;  1NGM A;  1VOL B;  1KY6 A;  1PCZ A;  2XHI A;  2EHB D;  2V8Q A;  1PZD A;  2YA3 A;  2FGT A;  3DPT A;  1QN8 A;  1UT4 A;  4CFF A;  1XSZ A;  1R4X A;  2NLV A;  1VTO A;  1N3C A;  3C04 A;  3OH9 A;  5IYB P;  1K2Y X;  1JDY A;  1YQK A;  4EJY A;  2O3O A;  2DKD A;  1WQA A;  2QRE A;  3H1Z A;  1VKL A;  2JOI A;  2V92 A;  3OC3 C;  5IYC P;  2LAE A;  4EAG A;  5JN5 A;  1QTS A;  3OH6 A;  1NVP A;  1QN3 A;  4WXA A;  3OSE A;  3IH7 A;  1AIS A;  3SNS A;  2F7L A;  1B9K A;  2NOF A;  1NH2 A;  2Z0F A;  3I0W A;  4DUL A;  2D0A A;  4C7P A;  4ROE B;  1YTB A;  2D0B A;  3CWU A;  2NOE A;  2Y8L A;  1TGH A;  3CVT A;  3CWT A;  1QN4 A;  1QN6 A;  2NOI A;  1N3A A;  1QN9 A;  1PCJ X;  1EUV A;  1PVS A;  2NOH A;  1K35 A;  1TBP A;  2HKP A;  2D0C A;  1M3H A;  1WJW A;  3HS8 A;  2I5W A;  2HL9 A;  2NWV A;  1N39 A;  1QN7 A;  1W80 A;  3I3W A;  1C9B B;  2OOX A;  2IV8 A;  1KYF A;  3OSM A;  1EBM A;  1C4G A; 
#chains in the Genus database with same CATH homology
 4EAK A;  2QRC A;  4EAL A;  3T4N A;  2QRE A;  2V9J A;  2V92 A;  1V5S A;  4EAG A;  4EAJ A;  2Y8Q A;  3OSE A;  1UL7 A;  2QR1 A;  2QLV A;  3TDH A;  2Y8L A;  2QRD A;  4EAI A;  2ZFD B;  2EHB D;  2V8Q A;  2YA3 A;  3TE5 A;  4CFF A;  2OOX A;  2OOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...