2QRCA

Crystal structure of the adenylate sensor from amp-activated protein kinase in complex with adp and amp
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
126
structure length
116
Chain Sequence
KWHFGVRCRGDAPEILLAVYRALQRAGAQFTVPKPVNGKYRSDMYTIKSRWEIPHCKREGKNTYAYIELQLYEVMPGCFMLDVKSNGYKDIYSHDLKSSFPFLDLCAMLVCKLFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNF1-like protein kinase ssp2
publication title Structural Insight into AMPK Regulation: ADP Comes into Play.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 32
structure length 116
sequence length 126
chains with identical sequence C
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2qrcA00
2EHBD 4CFFA 2QRCA 2QRDA 1V5SA 2QLVA 2Y8QA 2OOYA 2QREA 4EALA 2V9JA 3TE5A 2OOXA 4EAKA 2ZFDB 3TDHA 4EAGA 4EAJA 2V8QA 3OSEA 3T4NA 1UL7A 2QR1A 2YA3A 2V92A 2Y8LA 4EAIA
chains in the Genus database with same CATH superfamily
1NGMA 3D4VA 1J3MA 1VKLA 4CFFA 4QG5A 3H1ZA 5BMNA 3OSMA 2NOEA 1EBMA 1MP9A 1PCMX 5KL0A 2G30A 3VN5A 1M3QA 1M3HA 1QN5A 1PVSA 4ROEB 1QNCA 3KRMA 3OLPA 3OC3C 3OSTA 3SNSA 1P5GX 3HS9A 1TUOA 4WZSD 3UW2A 1UT4A 3OH6A 1CDWA 1LWWA 1QN8A 4MRQA 4B0AA 3CW7A 3T4NA 2HZMA 1FN7A 2JHNA 2NWVA 3ENOC 5IYCP 3RPJA 4WXAA 1KY6A 2R5XA 2Z0FA 1EUVA 1XSZA 2NOLA 1TBPA 2IV9A 1JFIC 1KY7A 1KYUA 2NLVA 1P5DX 1C9BB 2DKAA 4RODB 2I5WA 4EJZA 2Y8QA 4HJHA 2QREA 3OH9A 4EALA 2FGTA 1WQAA 3TE5A 1YQMA 2FKFA 1W80A 2JOIA 2NOZA 4C7PA 2YH5A 2NVMA 2HKPA 3EAYA 2JPIA 1C47A 1C4GA 2IV8A 3ENCA 1AISA 2ZFDB 1QNBA 1KYDA 2FUVA 1LXTA 3CWUA 1QNAA 3DPTA 1PZDA 1TBAB 1PCZA 3CVTA 2DKCA 4D7RA 1M5Q1 5AN4A 4D7QA 2V8QA 3IH7A 2VJ0A 1UL7A 1T6AA 3ULXA 2QR1A 2YA3A 2HL9A 3EIKA 2V92A 4WX8A 2EHBD 2FKMX 3CVSA 1YQLA 2HZSA 1V5SA 4IL8A 3PDKA 1VOLB 2MZ8A 1B9KA 4TPSA 1QN9A 1QN3A 2OOYA 1E42A 4ROCB 5JN5A 2V9JA 3I0WA 3I0XA 2NOBA 2OOXA 1LWYA 1RM1A 3NA5A 1QN4A 1YTFA 4PY5A 1QNEA 5IYBP 2D0BA 3TDHA 2NOHA 3OCIA 1KO9A 4EAGA 4DULA 2XHIA 3KTUA 4I8OA 3CWAA 1R4XA 3BKQX 2PWWA 5JMVD 1MPGA 3RSMA 3D7QA 3OGDA 2Y8LA 2JHJA 3CWTA 3ASMA 5EPCA 2D0AA 2QRCA 1DIZA 1QTSA 2HL8A 2LAEA 2QRDA 3F0ZA 2D0CA 5HSHA 1QTPA 1VTOA 1D3UA 5F9CA 3PMGA 2QLVA 1LWVA 2O3OA 1YQRA 2H4LX 1PCJX 3DPUA 2NOIA 1YQKA 1QN7A 1TGHA 1VOKA 1KFQA 4Q11A 4EAKA 1NH2A 3HS8A 1JDYA 3I3WA 1KYFA 1NVPA 1HU0A 1QN6A 5BMPA 2Z8UA 5IYDP 1Q9UA 1K2YX 1UT7A 2DKDA 3F10A 3N89A 3CWSA 2H5AX 1KFIA 2F7LA 4EAJA 3OSEA 2MJ7A 1K35A 1YTBA 1N39A 1WJWA 2NOFA 1VTLE 1N3AA 3C04A 4BJUA 1N3CA 4EAIA 4EJYA
chains in the Genus database with same CATH topology
2EHBD 4CFFA 2QRCA 2QRDA 1V5SA 2QLVA 2Y8QA 2OOYA 2QREA 4EALA 2V9JA 3TE5A 2OOXA 4EAKA 2ZFDB 3TDHA 4EAGA 4EAJA 2V8QA 3OSEA 3T4NA 1UL7A 2QR1A 2YA3A 2V92A 2Y8LA 4EAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EHB D;  4CFF A;  2QRC A;  2QRD A;  1V5S A;  2QLV A;  2Y8Q A;  2OOY A;  2QRE A;  4EAL A;  2V9J A;  3TE5 A;  2OOX A;  4EAK A;  2ZFD B;  3TDH A;  4EAG A;  4EAJ A;  2V8Q A;  3OSE A;  3T4N A;  1UL7 A;  2QR1 A;  2YA3 A;  2V92 A;  2Y8L A;  4EAI A; 
#chains in the Genus database with same CATH topology
 1NGM A;  3D4V A;  1J3M A;  1VKL A;  4CFF A;  4QG5 A;  3H1Z A;  5BMN A;  3OSM A;  2NOE A;  1EBM A;  1MP9 A;  1PCM X;  5KL0 A;  2G30 A;  3VN5 A;  1M3Q A;  1M3H A;  1QN5 A;  1PVS A;  4ROE B;  1QNC A;  3KRM A;  3OLP A;  3OC3 C;  3OST A;  3SNS A;  1P5G X;  3HS9 A;  1TUO A;  4WZS D;  3UW2 A;  1UT4 A;  3OH6 A;  1CDW A;  1LWW A;  1QN8 A;  4MRQ A;  4B0A A;  3CW7 A;  3T4N A;  2HZM A;  1FN7 A;  2JHN A;  2NWV A;  3ENO C;  5IYC P;  3RPJ A;  4WXA A;  1KY6 A;  2R5X A;  2Z0F A;  1EUV A;  1XSZ A;  2NOL A;  1TBP A;  2IV9 A;  1JFI C;  1KY7 A;  1KYU A;  2NLV A;  1P5D X;  1C9B B;  2DKA A;  4ROD B;  2I5W A;  4EJZ A;  2Y8Q A;  4HJH A;  2QRE A;  3OH9 A;  4EAL A;  2FGT A;  1WQA A;  3TE5 A;  1YQM A;  2FKF A;  1W80 A;  2JOI A;  2NOZ A;  4C7P A;  2YH5 A;  2NVM A;  2HKP A;  3EAY A;  2JPI A;  1C47 A;  1C4G A;  2IV8 A;  3ENC A;  1AIS A;  2ZFD B;  1QNB A;  1KYD A;  2FUV A;  1LXT A;  3CWU A;  1QNA A;  3DPT A;  1PZD A;  1TBA B;  1PCZ A;  3CVT A;  2DKC A;  4D7R A;  1M5Q 1;  5AN4 A;  4D7Q A;  2V8Q A;  3IH7 A;  2VJ0 A;  1UL7 A;  1T6A A;  3ULX A;  2QR1 A;  2YA3 A;  2HL9 A;  3EIK A;  2V92 A;  4WX8 A;  2EHB D;  2FKM X;  3CVS A;  1YQL A;  2HZS A;  1V5S A;  4IL8 A;  3PDK A;  1VOL B;  2MZ8 A;  1B9K A;  4TPS A;  1QN9 A;  1QN3 A;  2OOY A;  1E42 A;  4ROC B;  5JN5 A;  2V9J A;  3I0W A;  3I0X A;  2NOB A;  2OOX A;  1LWY A;  1RM1 A;  3NA5 A;  1QN4 A;  1YTF A;  4PY5 A;  1QNE A;  5IYB P;  2D0B A;  3TDH A;  2NOH A;  3OCI A;  1KO9 A;  4EAG A;  4DUL A;  2XHI A;  3KTU A;  4I8O A;  3CWA A;  1R4X A;  3BKQ X;  2PWW A;  5JMV D;  1MPG A;  3RSM A;  3D7Q A;  3OGD A;  2Y8L A;  2JHJ A;  3CWT A;  3ASM A;  5EPC A;  2D0A A;  2QRC A;  1DIZ A;  1QTS A;  2HL8 A;  2LAE A;  2QRD A;  3F0Z A;  2D0C A;  5HSH A;  1QTP A;  1VTO A;  1D3U A;  5F9C A;  3PMG A;  2QLV A;  1LWV A;  2O3O A;  1YQR A;  2H4L X;  1PCJ X;  3DPU A;  2NOI A;  1YQK A;  1QN7 A;  1TGH A;  1VOK A;  1KFQ A;  4Q11 A;  4EAK A;  1NH2 A;  3HS8 A;  1JDY A;  3I3W A;  1KYF A;  1NVP A;  1HU0 A;  1QN6 A;  5BMP A;  2Z8U A;  5IYD P;  1Q9U A;  1K2Y X;  1UT7 A;  2DKD A;  3F10 A;  3N89 A;  3CWS A;  2H5A X;  1KFI A;  2F7L A;  4EAJ A;  3OSE A;  2MJ7 A;  1K35 A;  1YTB A;  1N39 A;  1WJW A;  2NOF A;  1VTL E;  1N3A A;  3C04 A;  4BJU A;  1N3C A;  4EAI A;  4EJY A; 
#chains in the Genus database with same CATH homology
 2EHB D;  4CFF A;  2QRC A;  2QRD A;  1V5S A;  2QLV A;  2Y8Q A;  2OOY A;  2QRE A;  4EAL A;  2V9J A;  3TE5 A;  2OOX A;  4EAK A;  2ZFD B;  3TDH A;  4EAG A;  4EAJ A;  2V8Q A;  3OSE A;  3T4N A;  1UL7 A;  2QR1 A;  2YA3 A;  2V92 A;  2Y8L A;  4EAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...