2ZFDB

The crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
116
Chain Sequence
RRMNAFDIISGSPGFNLSGLFGDARKYDRVERFVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEVRKRQRAARDLWTDTLRPFFVELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcineurin B-like protein 2
publication title The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein/transferase
total genus 35
structure length 116
sequence length 119
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03822 NAF NAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2zfdB00
4EALA 4EAIA 4EAKA 2V92A 2ZFDB 2YA3A 4CFFA 2Y8LA 2V8QA 4EAJA 2QR1A 1UL7A 4EAGA 2QRDA 3T4NA 2EHBD 2QLVA 3TDHA 3OSEA 2OOYA 3TE5A 2QREA 2V9JA 2Y8QA 2OOXA 1V5SA 2QRCA
chains in the Genus database with same CATH superfamily
1YQKA 3D7QA 4EJZA 2DKDA 1KFQA 1PCJX 2V92A 3HS8A 1WQAA 3CWAA 1QN6A 1LXTA 1N3AA 1YQLA 1NH2A 1VKLA 1UT4A 1VOLB 2NOBA 2PWWA 1PZDA 1Q9UA 3ENOC 5IYDP 3EIKA 1YTBA 2QR1A 2NVMA 2QRDA 1XSZA 4EJYA 1M3QA 4TPSA 1N3CA 1KY6A 3RSMA 1TUOA 1QN8A 2OOYA 2JHJA 4D7RA 1KYDA 3CWUA 2NOEA 2QREA 1QN5A 2NOFA 2V9JA 2HZMA 4WZSD 1UT7A 4C7PA 1QN3A 1VOKA 4ROCB 2OOXA 2H4LX 2DKCA 1C9BB 1VTLE 1V5SA 1J3MA 3RPJA 1QNBA 2DKAA 1LWWA 1QNCA 1KO9A 2IV9A 2YA3A 4CFFA 3OCIA 1YQRA 1QN4A 1QNEA 3OSTA 1WJWA 3VN5A 2HZSA 2Y8LA 1TBAB 5IYBP 4B0AA 1CDWA 1UL7A 4EAGA 2R5XA 1QTSA 3KTUA 1JFIC 3CWSA 1QNAA 5BMPA 3KRMA 3OLPA 5JN5A 1YTFA 1LWYA 3TE5A 3F10A 2MJ7A 2H5AX 1C47A 5BMNA 1NGMA 1N39A 1D3UA 1MPGA 1M5Q1 1KYUA 2NOLA 3DPTA 3BKQX 3I3WA 3PDKA 1HU0A 2QRCA 3ENCA 1PCZA 5AN4A 3IH7A 4EALA 2LAEA 4WXAA 2F7LA 1KYFA 4I8OA 4BJUA 1T6AA 4EAKA 4ROEB 2ZFDB 2JHNA 2IV8A 1KFIA 3ASMA 3HS9A 1QTPA 3I0XA 1VTOA 3CVTA 2FKFA 2V8QA 2FUVA 4IL8A 5EPCA 3PMGA 2NOIA 2JPIA 1E42A 1TBPA 2D0BA 4QG5A 3I0WA 2Z8UA 2NWVA 1PVSA 3ULXA 1JDYA 2I5WA 2VJ0A 1DIZA 3UW2A 3TDHA 1P5DX 1QN9A 2FKMX 4MRQA 3SNSA 2JOIA 1MP9A 1FN7A 1TGHA 2Y8QA 5KL0A 2FGTA 2G30A 2HKPA 5IYCP 1RM1A 3EAYA 2YH5A 4EAIA 5HSHA 1EBMA 1KY7A 3F0ZA 3CW7A 1YQMA 3CWTA 4WX8A 1W80A 3CVSA 1C4GA 5F9CA 5JMVD 3D4VA 2XHIA 4EAJA 1NVPA 4PY5A 3OC3C 1M3HA 3OH9A 2D0CA 1AISA 3OH6A 2NOHA 1PCMX 1K2YX 2MZ8A 3OSMA 3N89A 4DULA 2HL9A 1R4XA 3T4NA 2EHBD 2QLVA 1LWVA 1QN7A 1B9KA 4D7QA 3OGDA 3NA5A 1P5GX 2HL8A 3OSEA 3H1ZA 2D0AA 3DPUA 4HJHA 4RODB 2Z0FA 1K35A 2NOZA 1EUVA 2O3OA 2NLVA 3C04A 4Q11A
chains in the Genus database with same CATH topology
4EALA 4EAIA 4EAKA 2V92A 2ZFDB 2YA3A 4CFFA 2Y8LA 2V8QA 4EAJA 2QR1A 1UL7A 4EAGA 2QRDA 3T4NA 2EHBD 2QLVA 3TDHA 3OSEA 2OOYA 3TE5A 2QREA 2V9JA 2Y8QA 2OOXA 1V5SA 2QRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAL A;  4EAI A;  4EAK A;  2V92 A;  2ZFD B;  2YA3 A;  4CFF A;  2Y8L A;  2V8Q A;  4EAJ A;  2QR1 A;  1UL7 A;  4EAG A;  2QRD A;  3T4N A;  2EHB D;  2QLV A;  3TDH A;  3OSE A;  2OOY A;  3TE5 A;  2QRE A;  2V9J A;  2Y8Q A;  2OOX A;  1V5S A;  2QRC A; 
#chains in the Genus database with same CATH topology
 1YQK A;  3D7Q A;  4EJZ A;  2DKD A;  1KFQ A;  1PCJ X;  2V92 A;  3HS8 A;  1WQA A;  3CWA A;  1QN6 A;  1LXT A;  1N3A A;  1YQL A;  1NH2 A;  1VKL A;  1UT4 A;  1VOL B;  2NOB A;  2PWW A;  1PZD A;  1Q9U A;  3ENO C;  5IYD P;  3EIK A;  1YTB A;  2QR1 A;  2NVM A;  2QRD A;  1XSZ A;  4EJY A;  1M3Q A;  4TPS A;  1N3C A;  1KY6 A;  3RSM A;  1TUO A;  1QN8 A;  2OOY A;  2JHJ A;  4D7R A;  1KYD A;  3CWU A;  2NOE A;  2QRE A;  1QN5 A;  2NOF A;  2V9J A;  2HZM A;  4WZS D;  1UT7 A;  4C7P A;  1QN3 A;  1VOK A;  4ROC B;  2OOX A;  2H4L X;  2DKC A;  1C9B B;  1VTL E;  1V5S A;  1J3M A;  3RPJ A;  1QNB A;  2DKA A;  1LWW A;  1QNC A;  1KO9 A;  2IV9 A;  2YA3 A;  4CFF A;  3OCI A;  1YQR A;  1QN4 A;  1QNE A;  3OST A;  1WJW A;  3VN5 A;  2HZS A;  2Y8L A;  1TBA B;  5IYB P;  4B0A A;  1CDW A;  1UL7 A;  4EAG A;  2R5X A;  1QTS A;  3KTU A;  1JFI C;  3CWS A;  1QNA A;  5BMP A;  3KRM A;  3OLP A;  5JN5 A;  1YTF A;  1LWY A;  3TE5 A;  3F10 A;  2MJ7 A;  2H5A X;  1C47 A;  5BMN A;  1NGM A;  1N39 A;  1D3U A;  1MPG A;  1M5Q 1;  1KYU A;  2NOL A;  3DPT A;  3BKQ X;  3I3W A;  3PDK A;  1HU0 A;  2QRC A;  3ENC A;  1PCZ A;  5AN4 A;  3IH7 A;  4EAL A;  2LAE A;  4WXA A;  2F7L A;  1KYF A;  4I8O A;  4BJU A;  1T6A A;  4EAK A;  4ROE B;  2ZFD B;  2JHN A;  2IV8 A;  1KFI A;  3ASM A;  3HS9 A;  1QTP A;  3I0X A;  1VTO A;  3CVT A;  2FKF A;  2V8Q A;  2FUV A;  4IL8 A;  5EPC A;  3PMG A;  2NOI A;  2JPI A;  1E42 A;  1TBP A;  2D0B A;  4QG5 A;  3I0W A;  2Z8U A;  2NWV A;  1PVS A;  3ULX A;  1JDY A;  2I5W A;  2VJ0 A;  1DIZ A;  3UW2 A;  3TDH A;  1P5D X;  1QN9 A;  2FKM X;  4MRQ A;  3SNS A;  2JOI A;  1MP9 A;  1FN7 A;  1TGH A;  2Y8Q A;  5KL0 A;  2FGT A;  2G30 A;  2HKP A;  5IYC P;  1RM1 A;  3EAY A;  2YH5 A;  4EAI A;  5HSH A;  1EBM A;  1KY7 A;  3F0Z A;  3CW7 A;  1YQM A;  3CWT A;  4WX8 A;  1W80 A;  3CVS A;  1C4G A;  5F9C A;  5JMV D;  3D4V A;  2XHI A;  4EAJ A;  1NVP A;  4PY5 A;  3OC3 C;  1M3H A;  3OH9 A;  2D0C A;  1AIS A;  3OH6 A;  2NOH A;  1PCM X;  1K2Y X;  2MZ8 A;  3OSM A;  3N89 A;  4DUL A;  2HL9 A;  1R4X A;  3T4N A;  2EHB D;  2QLV A;  1LWV A;  1QN7 A;  1B9K A;  4D7Q A;  3OGD A;  3NA5 A;  1P5G X;  2HL8 A;  3OSE A;  3H1Z A;  2D0A A;  3DPU A;  4HJH A;  4ROD B;  2Z0F A;  1K35 A;  2NOZ A;  1EUV A;  2O3O A;  2NLV A;  3C04 A;  4Q11 A; 
#chains in the Genus database with same CATH homology
 4EAL A;  4EAI A;  4EAK A;  2V92 A;  2ZFD B;  2YA3 A;  4CFF A;  2Y8L A;  2V8Q A;  4EAJ A;  2QR1 A;  1UL7 A;  4EAG A;  2QRD A;  3T4N A;  2EHB D;  2QLV A;  3TDH A;  3OSE A;  2OOY A;  3TE5 A;  2QRE A;  2V9J A;  2Y8Q A;  2OOX A;  1V5S A;  2QRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...