2ZFDB

The crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
116
Chain Sequence
RRMNAFDIISGSPGFNLSGLFGDARKYDRVERFVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEVRKRQRAARDLWTDTLRPFFVELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/transferase
molecule keywords Calcineurin B-like protein 2
publication title The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 35
structure length 116
sequence length 119
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03822 NAF NAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2zfdB00
2Y8LA 3OSEA 2Y8QA 1UL7A 2QR1A 4EAKA 2V8QA 2V9JA 2QRDA 4EAJA 2OOYA 2QREA 3TE5A 3TDHA 4EAIA 2EHBD 2YA3A 2V92A 2OOXA 1V5SA 2QRCA 2ZFDB 3T4NA 2QLVA 4CFFA 4EALA 4EAGA
chains in the Genus database with same CATH superfamily
4TPSA 1Q9UA 2JOIA 2QR1A 1K35A 2IV8A 2JHNA 1UT4A 3OLPA 4HJHA 1YQKA 1YQLA 2QRDA 1QNBA 2NLVA 3OC3C 3OGDA 3EIKA 3KTUA 3BKQX 5EPCA 1YTFA 5AN4A 3OSMA 3EAYA 1P5GX 2NOHA 2YA3A 1C9BB 4WXAA 1PCJX 1M3QA 1UT7A 1KY7A 1XSZA 1MPGA 2QRCA 3C04A 3ASMA 1KFIA 3VN5A 1J3MA 1R4XA 3OH6A 2HL9A 1QN8A 5KL0A 3CVTA 2QLVA 5BMPA 1M3HA 2JPIA 1PVSA 4PY5A 3D7QA 5IYBP 1VOLB 3I3WA 3UW2A 2Y8QA 2HKPA 1KYFA 1QNEA 1KFQA 3CW7A 2NOBA 2V8QA 2V9JA 1HU0A 3CWSA 1M5Q1 3N89A 1QN6A 1LXTA 1K2YX 1QTPA 1VTOA 1YQRA 4MRQA 4WZSD 1EBMA 2QREA 5IYCP 2NOZA 4IL8A 3RPJA 5JN5A 4D7RA 3HS9A 3OSTA 1QNAA 2H5AX 4EAIA 2EHBD 1YQMA 1E42A 3I0WA 4RODB 3F0ZA 1P5DX 3F10A 1QN3A 1JDYA 2LAEA 1FN7A 1B9KA 3RSMA 1TBAB 4BJUA 1WJWA 2D0CA 4B0AA 3OH9A 2G30A 3T4NA 4D7QA 1D3UA 2NOIA 4CFFA 3I0XA 1KYUA 1C4GA 4EAGA 2I5WA 2XHIA 3CVSA 2PWWA 2HZMA 3CWTA 4Q11A 2YH5A 5BMNA 2FUVA 3ULXA 1VKLA 2FKFA 3ENOC 2HL8A 1TBPA 1AISA 1PCMX 3DPUA 3TDHA 2DKAA 2R5XA 1QTSA 3PMGA 3OCIA 1WQAA 1NH2A 1EUVA 3D4VA 2H4LX 2HZSA 2D0BA 1PZDA 1N39A 1TGHA 1VTLE 1V5SA 5F9CA 1LWYA 1QN5A 2NOFA 2F7LA 2NOLA 3PDKA 4EJZA 1QNCA 3DPTA 4DULA 1W80A 3KRMA 3IH7A 1CDWA 4EJYA 2DKCA 1T6AA 2Y8LA 3OSEA 3CWUA 4WX8A 1UL7A 5HSHA 2NOEA 1MP9A 4EAKA 3CWAA 4EAJA 1NGMA 3H1ZA 4ROEB 1PCZA 2OOYA 2VJ0A 3TE5A 1LWWA 2O3OA 1C47A 1VOKA 4ROCB 2IV9A 3ENCA 1N3AA 4QG5A 5IYDP 2V92A 2JHJA 2OOXA 5JMVD 1RM1A 1QN9A 1QN7A 2MJ7A 2Z8UA 1QN4A 2MZ8A 1KY6A 1JFIC 3HS8A 1NVPA 1YTBA 2FKMX 2DKDA 3SNSA 2ZFDB 2FGTA 3NA5A 4C7PA 2D0AA 1DIZA 1TUOA 2NWVA 2NVMA 1KYDA 2Z0FA 1KO9A 4EALA 1LWVA 1N3CA 4I8OA
chains in the Genus database with same CATH topology
2Y8LA 3OSEA 2Y8QA 1UL7A 2QR1A 4EAKA 2V8QA 2V9JA 2QRDA 4EAJA 2OOYA 2QREA 3TE5A 3TDHA 4EAIA 2EHBD 2YA3A 2V92A 2OOXA 1V5SA 2QRCA 2ZFDB 3T4NA 2QLVA 4CFFA 4EALA 4EAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8L A;  3OSE A;  2Y8Q A;  1UL7 A;  2QR1 A;  4EAK A;  2V8Q A;  2V9J A;  2QRD A;  4EAJ A;  2OOY A;  2QRE A;  3TE5 A;  3TDH A;  4EAI A;  2EHB D;  2YA3 A;  2V92 A;  2OOX A;  1V5S A;  2QRC A;  2ZFD B;  3T4N A;  2QLV A;  4CFF A;  4EAL A;  4EAG A; 
#chains in the Genus database with same CATH topology
 4TPS A;  1Q9U A;  2JOI A;  2QR1 A;  1K35 A;  2IV8 A;  2JHN A;  1UT4 A;  3OLP A;  4HJH A;  1YQK A;  1YQL A;  2QRD A;  1QNB A;  2NLV A;  3OC3 C;  3OGD A;  3EIK A;  3KTU A;  3BKQ X;  5EPC A;  1YTF A;  5AN4 A;  3OSM A;  3EAY A;  1P5G X;  2NOH A;  2YA3 A;  1C9B B;  4WXA A;  1PCJ X;  1M3Q A;  1UT7 A;  1KY7 A;  1XSZ A;  1MPG A;  2QRC A;  3C04 A;  3ASM A;  1KFI A;  3VN5 A;  1J3M A;  1R4X A;  3OH6 A;  2HL9 A;  1QN8 A;  5KL0 A;  3CVT A;  2QLV A;  5BMP A;  1M3H A;  2JPI A;  1PVS A;  4PY5 A;  3D7Q A;  5IYB P;  1VOL B;  3I3W A;  3UW2 A;  2Y8Q A;  2HKP A;  1KYF A;  1QNE A;  1KFQ A;  3CW7 A;  2NOB A;  2V8Q A;  2V9J A;  1HU0 A;  3CWS A;  1M5Q 1;  3N89 A;  1QN6 A;  1LXT A;  1K2Y X;  1QTP A;  1VTO A;  1YQR A;  4MRQ A;  4WZS D;  1EBM A;  2QRE A;  5IYC P;  2NOZ A;  4IL8 A;  3RPJ A;  5JN5 A;  4D7R A;  3HS9 A;  3OST A;  1QNA A;  2H5A X;  4EAI A;  2EHB D;  1YQM A;  1E42 A;  3I0W A;  4ROD B;  3F0Z A;  1P5D X;  3F10 A;  1QN3 A;  1JDY A;  2LAE A;  1FN7 A;  1B9K A;  3RSM A;  1TBA B;  4BJU A;  1WJW A;  2D0C A;  4B0A A;  3OH9 A;  2G30 A;  3T4N A;  4D7Q A;  1D3U A;  2NOI A;  4CFF A;  3I0X A;  1KYU A;  1C4G A;  4EAG A;  2I5W A;  2XHI A;  3CVS A;  2PWW A;  2HZM A;  3CWT A;  4Q11 A;  2YH5 A;  5BMN A;  2FUV A;  3ULX A;  1VKL A;  2FKF A;  3ENO C;  2HL8 A;  1TBP A;  1AIS A;  1PCM X;  3DPU A;  3TDH A;  2DKA A;  2R5X A;  1QTS A;  3PMG A;  3OCI A;  1WQA A;  1NH2 A;  1EUV A;  3D4V A;  2H4L X;  2HZS A;  2D0B A;  1PZD A;  1N39 A;  1TGH A;  1VTL E;  1V5S A;  5F9C A;  1LWY A;  1QN5 A;  2NOF A;  2F7L A;  2NOL A;  3PDK A;  4EJZ A;  1QNC A;  3DPT A;  4DUL A;  1W80 A;  3KRM A;  3IH7 A;  1CDW A;  4EJY A;  2DKC A;  1T6A A;  2Y8L A;  3OSE A;  3CWU A;  4WX8 A;  1UL7 A;  5HSH A;  2NOE A;  1MP9 A;  4EAK A;  3CWA A;  4EAJ A;  1NGM A;  3H1Z A;  4ROE B;  1PCZ A;  2OOY A;  2VJ0 A;  3TE5 A;  1LWW A;  2O3O A;  1C47 A;  1VOK A;  4ROC B;  2IV9 A;  3ENC A;  1N3A A;  4QG5 A;  5IYD P;  2V92 A;  2JHJ A;  2OOX A;  5JMV D;  1RM1 A;  1QN9 A;  1QN7 A;  2MJ7 A;  2Z8U A;  1QN4 A;  2MZ8 A;  1KY6 A;  1JFI C;  3HS8 A;  1NVP A;  1YTB A;  2FKM X;  2DKD A;  3SNS A;  2ZFD B;  2FGT A;  3NA5 A;  4C7P A;  2D0A A;  1DIZ A;  1TUO A;  2NWV A;  2NVM A;  1KYD A;  2Z0F A;  1KO9 A;  4EAL A;  1LWV A;  1N3C A;  4I8O A; 
#chains in the Genus database with same CATH homology
 2Y8L A;  3OSE A;  2Y8Q A;  1UL7 A;  2QR1 A;  4EAK A;  2V8Q A;  2V9J A;  2QRD A;  4EAJ A;  2OOY A;  2QRE A;  3TE5 A;  3TDH A;  4EAI A;  2EHB D;  2YA3 A;  2V92 A;  2OOX A;  1V5S A;  2QRC A;  2ZFD B;  3T4N A;  2QLV A;  4CFF A;  4EAL A;  4EAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...