2ZFDB

The crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
119
structure length
116
Chain Sequence
RRMNAFDIISGSPGFNLSGLFGDARKYDRVERFVSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEVRKRQRAARDLWTDTLRPFFVELVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Calcineurin B-like protein 2
publication title The crystal structure of plant-specific calcium-binding protein AtCBL2 in complex with the regulatory domain of AtCIPK14
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein/transferase
total genus 35
structure length 116
sequence length 119
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03822 NAF NAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 2zfdB00
2QRDA 2YA3A 4EAJA 2V9JA 2V8QA 2OOYA 4EAGA 4EAIA 4EAKA 2QLVA 2Y8QA 3TE5A 4CFFA 3T4NA 1UL7A 2V92A 2EHBD 4EALA 3OSEA 2OOXA 3TDHA 1V5SA 2ZFDB 2QR1A 2QRCA 2Y8LA 2QREA
chains in the Genus database with same CATH superfamily
1VKLA 3OSTA 1HU0A 1J3MA 5JN5A 2DKAA 2NWVA 2NOZA 5EPCA 2Z0FA 2HL9A 1NGMA 1QNEA 2OOYA 4EAGA 5F9CA 1LWVA 4WZSD 2NOEA 2DKDA 2QLVA 1D3UA 5IYDP 3CWSA 5HSHA 3N89A 1QN6A 1KYFA 2V92A 1NVPA 2EHBD 3F0ZA 2NOBA 1KY7A 2NOLA 2HZMA 3CW7A 3OSEA 4D7QA 5BMNA 1AISA 3TDHA 2IV9A 3OH6A 1YQMA 4PY5A 1P5DX 1QN7A 2FKFA 2G30A 2QRCA 2NVMA 2YH5A 1TGHA 2FKMX 2HKPA 5KL0A 1QNCA 4Q11A 3RSMA 4TPSA 3CVSA 4DULA 2NOIA 2YA3A 1JDYA 4EAJA 2MZ8A 2V9JA 1WQAA 2V8QA 3KTUA 1M3QA 1QTSA 2VJ0A 2D0AA 3HS9A 1QN5A 3ULXA 2JOIA 5BMPA 4CFFA 2HZSA 3T4NA 3OSMA 1MPGA 3OCIA 1M3HA 3DPUA 1JFIC 1Q9UA 2D0BA 3KRMA 5AN4A 1VTOA 2O3OA 1TUOA 4EALA 1KFQA 1YTFA 1YTBA 1VTLE 3H1ZA 2OOXA 1KO9A 2R5XA 2DKCA 2PWWA 1QNAA 4ROEB 1C47A 2NLVA 2XHIA 1RM1A 1QN9A 3I0WA 1R4XA 1K2YX 1LWWA 2Y8LA 4I8OA 1N3CA 2QREA 2JHJA 3D7QA 1P5GX 1T6AA 1PCJX 2FGTA 3OLPA 3EIKA 1E42A 1FN7A 1QNBA 4EAIA 1LWYA 2F7LA 4QG5A 4MRQA 4EAKA 3RPJA 4D7RA 3ASMA 3PMGA 3CWUA 3TE5A 4RODB 3OGDA 5IYBP 4EJYA 1VOLB 1XSZA 3OH9A 1UL7A 2Z8UA 1C4GA 2JHNA 4HJHA 4WX8A 4ROCB 2LAEA 1PCZA 3D4VA 1QN8A 1TBPA 1VOKA 1PVSA 1KFIA 1UT7A 1C9BB 1KYDA 1KYUA 4C7PA 1N3AA 3CWAA 3CVTA 3I3WA 3UW2A 2H5AX 2HL8A 2ZFDB 3OC3C 5JMVD 1YQKA 2IV8A 3HS8A 1UT4A 3PDKA 3I0XA 1LXTA 4BJUA 5IYCP 1PZDA 1W80A 2I5WA 1MP9A 2QRDA 1DIZA 2FUVA 1CDWA 1N39A 3NA5A 1KY6A 3C04A 4EJZA 1EBMA 1QN3A 3DPTA 1YQRA 3IH7A 1NH2A 3CWTA 2Y8QA 2MJ7A 1YQLA 3ENCA 1WJWA 3F10A 1EUVA 3EAYA 3VN5A 3BKQX 1QN4A 2D0CA 1K35A 1V5SA 3ENOC 1PCMX 2QR1A 3SNSA 4WXAA 2NOFA 2H4LX 1TBAB 1QTPA 1M5Q1 1B9KA 4B0AA 4IL8A 2NOHA 2JPIA
chains in the Genus database with same CATH topology
2QRDA 2YA3A 4EAJA 2V9JA 2V8QA 2OOYA 4EAGA 4EAIA 4EAKA 2QLVA 2Y8QA 3TE5A 4CFFA 3T4NA 1UL7A 2V92A 2EHBD 4EALA 3OSEA 2OOXA 3TDHA 1V5SA 2ZFDB 2QR1A 2QRCA 2Y8LA 2QREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRD A;  2YA3 A;  4EAJ A;  2V9J A;  2V8Q A;  2OOY A;  4EAG A;  4EAI A;  4EAK A;  2QLV A;  2Y8Q A;  3TE5 A;  4CFF A;  3T4N A;  1UL7 A;  2V92 A;  2EHB D;  4EAL A;  3OSE A;  2OOX A;  3TDH A;  1V5S A;  2ZFD B;  2QR1 A;  2QRC A;  2Y8L A;  2QRE A; 
#chains in the Genus database with same CATH topology
 1VKL A;  3OST A;  1HU0 A;  1J3M A;  5JN5 A;  2DKA A;  2NWV A;  2NOZ A;  5EPC A;  2Z0F A;  2HL9 A;  1NGM A;  1QNE A;  2OOY A;  4EAG A;  5F9C A;  1LWV A;  4WZS D;  2NOE A;  2DKD A;  2QLV A;  1D3U A;  5IYD P;  3CWS A;  5HSH A;  3N89 A;  1QN6 A;  1KYF A;  2V92 A;  1NVP A;  2EHB D;  3F0Z A;  2NOB A;  1KY7 A;  2NOL A;  2HZM A;  3CW7 A;  3OSE A;  4D7Q A;  5BMN A;  1AIS A;  3TDH A;  2IV9 A;  3OH6 A;  1YQM A;  4PY5 A;  1P5D X;  1QN7 A;  2FKF A;  2G30 A;  2QRC A;  2NVM A;  2YH5 A;  1TGH A;  2FKM X;  2HKP A;  5KL0 A;  1QNC A;  4Q11 A;  3RSM A;  4TPS A;  3CVS A;  4DUL A;  2NOI A;  2YA3 A;  1JDY A;  4EAJ A;  2MZ8 A;  2V9J A;  1WQA A;  2V8Q A;  3KTU A;  1M3Q A;  1QTS A;  2VJ0 A;  2D0A A;  3HS9 A;  1QN5 A;  3ULX A;  2JOI A;  5BMP A;  4CFF A;  2HZS A;  3T4N A;  3OSM A;  1MPG A;  3OCI A;  1M3H A;  3DPU A;  1JFI C;  1Q9U A;  2D0B A;  3KRM A;  5AN4 A;  1VTO A;  2O3O A;  1TUO A;  4EAL A;  1KFQ A;  1YTF A;  1YTB A;  1VTL E;  3H1Z A;  2OOX A;  1KO9 A;  2R5X A;  2DKC A;  2PWW A;  1QNA A;  4ROE B;  1C47 A;  2NLV A;  2XHI A;  1RM1 A;  1QN9 A;  3I0W A;  1R4X A;  1K2Y X;  1LWW A;  2Y8L A;  4I8O A;  1N3C A;  2QRE A;  2JHJ A;  3D7Q A;  1P5G X;  1T6A A;  1PCJ X;  2FGT A;  3OLP A;  3EIK A;  1E42 A;  1FN7 A;  1QNB A;  4EAI A;  1LWY A;  2F7L A;  4QG5 A;  4MRQ A;  4EAK A;  3RPJ A;  4D7R A;  3ASM A;  3PMG A;  3CWU A;  3TE5 A;  4ROD B;  3OGD A;  5IYB P;  4EJY A;  1VOL B;  1XSZ A;  3OH9 A;  1UL7 A;  2Z8U A;  1C4G A;  2JHN A;  4HJH A;  4WX8 A;  4ROC B;  2LAE A;  1PCZ A;  3D4V A;  1QN8 A;  1TBP A;  1VOK A;  1PVS A;  1KFI A;  1UT7 A;  1C9B B;  1KYD A;  1KYU A;  4C7P A;  1N3A A;  3CWA A;  3CVT A;  3I3W A;  3UW2 A;  2H5A X;  2HL8 A;  2ZFD B;  3OC3 C;  5JMV D;  1YQK A;  2IV8 A;  3HS8 A;  1UT4 A;  3PDK A;  3I0X A;  1LXT A;  4BJU A;  5IYC P;  1PZD A;  1W80 A;  2I5W A;  1MP9 A;  2QRD A;  1DIZ A;  2FUV A;  1CDW A;  1N39 A;  3NA5 A;  1KY6 A;  3C04 A;  4EJZ A;  1EBM A;  1QN3 A;  3DPT A;  1YQR A;  3IH7 A;  1NH2 A;  3CWT A;  2Y8Q A;  2MJ7 A;  1YQL A;  3ENC A;  1WJW A;  3F10 A;  1EUV A;  3EAY A;  3VN5 A;  3BKQ X;  1QN4 A;  2D0C A;  1K35 A;  1V5S A;  3ENO C;  1PCM X;  2QR1 A;  3SNS A;  4WXA A;  2NOF A;  2H4L X;  1TBA B;  1QTP A;  1M5Q 1;  1B9K A;  4B0A A;  4IL8 A;  2NOH A;  2JPI A; 
#chains in the Genus database with same CATH homology
 2QRD A;  2YA3 A;  4EAJ A;  2V9J A;  2V8Q A;  2OOY A;  4EAG A;  4EAI A;  4EAK A;  2QLV A;  2Y8Q A;  3TE5 A;  4CFF A;  3T4N A;  1UL7 A;  2V92 A;  2EHB D;  4EAL A;  3OSE A;  2OOX A;  3TDH A;  1V5S A;  2ZFD B;  2QR1 A;  2QRC A;  2Y8L A;  2QRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...