1KY7A

The ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis/exocytosis
total genus 66
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky7A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky7A02
4ROEB 1KY6A 1QN7A 2IV8A 1VTLE 3ZHFA 1KYDA 3HS9A 5IYBP 1GYWA 1JFIC 5CN2A 1KY7A 1R4XA 2D0AA 1QNEA 1AISA 1VOKA 2DWYA 3OCIA 3ASMA 2D0CA 1YTBA 1D3UA 1VTOA 2YMTA 4PY5A 1PZDA 1KYFA 4ROCB 1W80A 1TBPA 1VOLB 1GYUA 5CN1A 4B0AA 2VJ0A 1QNCA 4WZSD 1TBAB 1NH2A 1C9BB 2G30A 3EIKA 2E9GA 2MJ7A 1YTFA 3VN5A 1B9KA 1QN8A 1QN6A 1QTPA 1NVPA 3HS8A 1QTSA 2DWXA 1P4UA 1GYVA 1MP9A 3ZY7A 1RM1A 2A7BA 2IV9A 1QNBA 2Z8UA 4RODB 1KYUA 1QN9A 1NA8A 1E42A 3MNMA 3OC3C 1QN4A 2D0BA 5IYCP 4BCXA 1QN5A 1OM9A 5IYDP 1CDWA 1QN3A 1TGHA 1PCZA 1QNAA 1NGMA 1IU1A 3H1ZA
chains in the Genus database with same CATH superfamily
2J7LA 2JELL 4Z7VA 1M6OA 3UTSE 4Y2DC 1LO2H 3Q2NA 1BEXA 1MRCL 1R33A 1BVNT 5E9DD 1CT8A 2EYSA 4AUYA 3K0WA 3CVHH 4RMRA 5JYLA 4I18C 1CBVL 5BZWB 3IMWA 2WBXA 1OB1A 3TH2T 2XN2A 4LDOB 3IGLA 2Q86A 3L9RA 5FW8A 1LO5B 3U46A 4LSPL 3JWOH 1CG9A 4KI5F 1XVSA 3LB6D 1NEUA 2AFNA 4KXCA 4XVUD 1RZQA 3GM8A 3MNZA 4L0ZA 3ZE2F 3FCBA 1JYNA 3UGEA 4OCNC 1H6FA 4ETQB 1A4AA 3IKKA 3LNHA 2DD8H 5KVGE 3WV0A 3TCLB 4M7KL 1YDPA 3RGVC 1ORQB 3KPQA 1BAFH 3MNWA 2P1YA 1WBZB 2OYMA 5IBLC 1AD9B 4XMWA 1X5ZA 1RZJC 1N8ZA 2YA0A 5E1IA 4P2QB 3JUYA 2HN7B 2BP0B 1ECZA 5AQ0A 1TPXB 4NERA 5HXMA 4CNIB 2BFGA 5E00B 2FYYA 2F74B 3HC3L 2CJUL 1OGAB 2GBAA 1BZ9B 1DLFH 3Q44A 4L3EA 5AAMC 3U6XS 3MRCA 3Q3GB 4X6BA 3TE5A 3RWFB 4MASA 1A4JA 4J8QA 5KVEL 2X2HA 3HOGA 3T0EC 3BUQA 2R0KL 1EH9A 1NM9A 4H8WL 2FWSA 1Y1DA 4TUUA 4X8GA 2QPDB 5SWZD 2QQKL 5C0ND 4Y2NA 5BMFL 1WZLA 4O2EA 2BIMA 3WNIA 4E36A 4XH2B 4LVOC 1IM9D 1JXDA 4BWUA 1MCIA 1YEIL 1F6AA 4TSAH 5GJTL 3MLRH 5I8OL 2O61B 3HR5A 2QKSA 4EI5A 4XE5B 2BZDA 1WIPA 3SPHA 1W0VB 4G6FD 2PYFA 3GBEA 4HXBL 3Q2CA 1A1MA 1ZLSL 5I74B 2ZXAA 2DBJA 3CSYB 4F33B 2JJTC 5HDBF 1HILB 2ITDB 4NKMB 1MCCA 2APTA 4YLBA 1BVOA 1MLCA 1PD0A 1JWMB 4XX5A 4HA1A 3WEXA 4YHKL 4HYTB 2PO6B 2CGYA 3DBSA 4UV7H 5JUEL 4Y2OA 1I3GH 2F54D 1QBLH 4FQIH 5DJAB 5C0JA 4ZFFA 1SY6A 1IEBB 3QFJA 5HHXL 3TA3C 3D85D 5LBVA 4BZYA 2H32A 1KXHA 3X11A 2NUPB 4B6ZA 5KEZA 2ZCHL 43C9A 2I9TA 3S5LA 3UO1L 2ZG3A 4I18A 1G9NH 5IMOA 2OMTA 1JPGB 1B6DA 5IY5B 3NZ8B 4P4RB 1CXKA 4WW1B 4XMLL 4WI3A 2XTJB 3DO3A 4HIPA 4BWTA 1EEZB 1PZBA 4X7TB 2R2CA 2ZUUA 3D4YA 4A2LA 3NEXA 4DVRH 1YYLL 2Q8BL 3ABMB 1V55B 4NZUH 2ZKYA 1S3KH 4YHZH 3UMNA 4NLHA 1IFRA 4X8JB 3AM8C 3QNXB 1E8XA 1JV2B 4JDVA 1U8MA 5L4FA 4MB4A 4Q9BA 3LTVA 3RIAK 2V7NB 3TJEH 3MROB 1R24B 3VH8A 2E6QA 3HMWL 5IG7A 2LLGA 3PWNA 1NGPH 4E9TA 3AQYA 2DIEA 3ZL4L 3FOLA 2EEAA 1JD9A 1PLGL 2NT1A 4U3XA 4WGKA 1OAZH 3MV11 3KH4A 4G11A 2MQ3A 5D1XE 4G8EB 3RTQA 3ZN6A 2Y1YA 4XN1A 3FU8A 3O45A 5EIIG 2WZ5A 5JOEA 5HHME 2DYRB 2B1AH 4QI3A 1AVAA 3NZHL 1T1XA 3BH8B 5I2IB 1MEXL 3FU9A 3D3VE 5F1IA 4CW1B 3LEXA 5DEFA 5GZNC 1GTFA 2BDNH 1KBPA 2GT9B 5FOBB 4Y2LA 5GXBB 2O93L 1VB9A 4W9EC 3D69B 5LDSA 3FQ1A 1JGDA 4CC4C 3EFDH 4UTAA 3KVPA 1TJXA 3MX0B 1O9ZA 1TETH 2NY7L 3MRMB 2X70A 3V0WH 2CNYA 4BA0A 1WWWX 1MP9A 1IGML 4XCCL 1IB5A 3CU1A 3FCSA 2B1HL 3GRWL 2PWEA 1U8OB 4AXWA 2JJTA 3PE9A 3QUKB 2YK1L 5KJ4A 2R69H 1R3LB 3GJFH 1C1EL 1JERA 2W1NA 3HVNA 3TBBA 1DBML 3MLXL 1X44A 4FTVB 2MH4A 3FU5A 1T1ZA 3ARFD 5ALBH 5HGDA 4HEME 3DMMB 3PHQB 1KPUA 3EHBB 1NEZB 3SE4C 4OLYH 5EV7A 5KYNA 3EGSA 1OE2A 1Z5LB 2X6VA 5C3TA 4ENEC 2NWVA 3N41B 1HSBB 2H8PA 2BY1A 4Z78B 5GS0D 2C34A 3GF8A 4ZPTA 3CCHA 4HMCA 5D7KD 2DKAA 1QASA 4N2MA 1XR8B 5JHLL 4TMPA 5GGVH 3O8XC 1LEKB 5TDNA 3COOA 4OFVA 5A2FA 1GCYA 5I19H 4GXUM 4Z1PA 1CD8A 5AOKA 4FQCH 5DD3L 2IGLA 3KLDA 2Q7YB 4E41A 5IT2L 2P5ED 4UTBH 2MCMA 1BQHA 3AM8A 4JFYA 3K5RA 2D2OA 5JDJA 4UCFA 2H6PB 3AAZA 3DUSA 3S3PA 4DK5A 1U8HA 1A9BB 3MHZA 3WD5L 3KCWA 3QCTH 4FFZH 5HYSB 1DSFH 3FFDA 3NEEA 4HW6A 1O7DE 5T5FL 1P7QB 4TN9A 5LBSH 3DIDA 4P46C 3UZEC 5HVFB 3U0TA 4HD5A 4JZJC 1XGZA 4B27A 2VDPH 4UT6H 2IMNA 2WLYA 2VLJD 1GYCA 2R8SL 3TLRA 1GTNA 1TSHA 1QLRA 5DS1A 2HT2C 4U6YB 4JG5A 1DN0B 1OSPH 5D1ZI 4V11A 2H1PL 5GZNA 3UCRA 4KGLA 3SKJH 1YQVH 3IJEB 4PR5A 1NDGB 3ESNA 3ZYJA 5IV2A 5FWRA 3ULUH 3D09A 4PJXE 4A7VA 2KBGA 1RFDL 2WD0A 4J3OH 5L8KB 1C4GA 3CPUA 2ORBH 2Z0FA 1ZT4A 1WWBX 3SDAA 4WI5A 3SKUD 1KULA 1W72B 1IBBA 4OLVH 1ZLWH 5T1DL 1J0ZA 3OXSB 5TQ0L 5DVOA 2H1LM 1ZA3B 2AMGA 5J13C 2C7UB 4GXUN 4L8SC 5HY9B 4RISH 1NMCC 3SKNB 2WUCL 1JIBA 3FAXA 3IDIB 2F68X 4U1SB 3QW9A 1QNIA 4MCNA 5JOFB 4NZJA 4M5ZL 5CIPH 2O6FA 3LV3B 3GO1L 4YHIA 2CK0H 5FYKL 2YGVA 3BW9A 5KBLA 3LNEA 3PGFL 5HJ3A 1JGVH 3WE1A 4L9LA 2E9JA 1JK9A 4H25B 3SGJC 4CMMB 1NGXA 4XB3A 1KXQA 4DGVH 3QJZA 4JFHD 5T33H 2RCSH 2VNCA 4K8RD 1ODUA 2OL3H 3OGCB 4MJ6B 2EABA 3BIBX 4IOIA 5B8CC 1IC1A 4IRZL 1NBYB 3O8XA 1HINH 4KX7A 3WE6B 2DLEA 1HHJA 2V5MA 5C92A 5B1JC 4KNTA 4YR6A 5I8CB 1HHGB 1EZLA 4JRYB 4FRWA 2ZSVA 1ZGLA 3E2HB 1DJXA 1CDWA 5IQNA 4FG4A 1KYOK 4UWQB 3DOSB 5MP6H 3GEWB 3PAYA 5C07A 3JVGC 3EJZC 1KN4H 2WQVA 4KKPA 3O2DH 1VGEL 2XZAL 3D0VB 2C1OA 2OW6A 4HIHB 5FGCE 2UWEA 2RBLA 4JN1L 5CZVH 3RVVC 4GG6A 4FMKA 5AALA 4DK6A 1J3MA 4TLKA 4M93B 3RJOA 1IBDA 1K6QH 4LNRA 3HFMH 4P46A 3UZEA 4JZJA 4QHUB 4NZDA 1W6WA 3WIFB 1WTGT 1A7QL 1XD1A 2PPFA 3WIAA 4JREB 4U3HA 2XIBA 4UV4L 1NPUA 4YFLF 4AOFA 5GGRY 2OYLA 3K2UH 3W2DH 4FQXD 1NBQA 1RD6A 2XDHA 4GAGH 5DYOA 4ROCB 4MLIA 3ILQD 4NQXA 4PJXF 1HT6A 5L0QC 5F3HB 4I0PD 1P6FA 2ZICA 4ZFGL 4EVNA 2OJEA 2W91A 4BQ6A 4KKNA 1U0QA 4B3VA 3W11D 2ROYA 3VFPB 1N4XH 1EVTC 1PX8A 3U1SL 1R75A 4LSTL 5D71H 1UUSA 2JQMA 1FLRL 2FWLB 1X7SA 1AQ8A 2CIIA 4HGWA 4QRBA 3TBSB 2BRRL 3UIZA 2DWEB 2R0WH 4YO0B 3FRUA 2ZXQA 4CJ1A 2R51A 2CLRB 4JANA 4OF5A 3OAYK 3B5HA 3BZFB 4JL2A 4Z8FH 1KC5L 3RVTC 2XIDA 2PR9A 3PWLA 4B41A 2O6DA 4A68A 2G4GA 3GC3A 3MJ9H 2NXYB 5E1GA 4PJ9C 4BCYA 4WO4B 1RK1B 1NOFA 3LY6A 5JOPD 1U2HA 3EKCA 1SGKA 5GGUA 2CM6A 4HJJH 2EEXA 4CKVX 2BS71 1N5AA 2Y7MA 1TJHL 1HKFA 2E4FA 4AMKL 5B8CA 2RH0A 4HISA 1ADWA 4N8VA 4UQ9A 2IALA 2VDOL 1WZ1H 2HH0L 2LTQC 2YD6A 3KR3L 4MD0B 1QN9A 2RFXB 2BP5M 2NXZB 5BOPA 5FF6A 3BP4B 4PP1C 3PMGA 4FQQB 1W91A 2FB4H 3V9CA 3QDMA 1MHEB 3MLUH 5FCSH 3B2DC 2XTLA 1UT4A 1WK0A 3SDXB 2FCBA 1OHZA 1UWYA 1G7MA 3D30A 4QHNB 4X4KA 3O4LE 3H9YA 3PREA 4K23L 4Q8BA 2ZCKH 4ODXB 3K5SA 1IM3B 1OY3B 3FO9A 1B2WH 5IHWA 1RL1A 2F1EA 1XTLA 1ZPUA 3FB7A 4GKNA 3ZZQA 3LN9A 3U4EA 2XWTA 4UF7C 2FGWL 4C4UA 2VB5A 3CDZA 1SJMA 1JZDC 3D52A 4XVOA 4P23B 2AXHA 4GSQA 3SQOL 5JDSB 3QP3A 2WVSA 3V4VB 4L1DA 3IGAA 3WEBA 2I5YH 2B2XL 3EBHA 4EOWL 2ZWNA 5FUCE 2D3VA 5AWNH 3PL6A 1HH6A 4U0RC 4TYUA 2YBGA 3QUMB 4OLXL 1YMMD 3ZVVA 4B9IA 2X2YA 3OR6A 4OGXH 1BXAA 2ZP0T 3CVTA 1W80A 1T03H 5CLYA 3UPRB 2NDGA 4JQVC 2YPLB 4HJSA 3OMIB 3EJQA 5IK3A 3HG4A 1CICA 1GGIH 2RIKA 2YPVH 4CVWA 5L88H 4YDNA 5FIEA 2NUTB 5IB4A 2VLRB 2HJLB 2JKTM 1EGJH 3L3IA 1F3DJ 2CH8A 4HUWA 2DQUH 1WCQA 1LILA 4L4VD 4JM2F 2EYRA 2EAEA 4WDIB 3LZQA 2Y0SA 1AO7B 1QHPA 3UJIL 2KH2B 2Y2YA 4P8QA 4MD5A 1JF6A 1FH5H 2VM3A 2XPYA 1IGCH 4XCYB 1QN6A 4XOBA 2FT8A 4UQBA 1YEKH 5E8PB 4PJ9A 3NPSB 5AVUB 4GBXB 1LO3H 4L29A 3TO4C 3FTVA 1KGXA 2K70A 4XAKD 1E30A 2VR3A 5FLVA 3UYPB 1BD2B 3WMQA 2XPGB 3GHBH 5D4QA 2G2RA 4HKBB 4K3HA 3F84A 4A6YL 1IO4C 5EUKA 3ZK0A 2ZNXA 1MW0A 1DJHA 4R5XA 1RJZB 3QDJE 3LDBB 3PDDA 5CFHA 3UZQA 4BFNA 2P46B 3D7QA 1CLOL 2HRGA 3I50L 3K7UA 4NQED 1WLHA 5LGYA 3HE7B 3RY5A 2JJSC 3GB7A 4XN8A 3EGDA 2DM2A 1E7UA 4ZUUA 3TJPA 5BZZA 4YHNB 3N2JA 4K9EL 1NBVL 1RP8A 2RALA 1I7TB 1MFNA 3OC8A 4M3HA 5DD6B 5DRWA 3G6DL 5F7AA 3CMOH 4LSQL 3W37A 1TG8A 4APQC 1I1AD 3O6LL 3D05A 4HDIB 1AR1B 1PVHA 4EAEA 4BFIA 1U3YA 1PNCA 2BP3A 3MV8B 1CTNA 1Z9SA 4WRLA 3H0TB 4N0YH 3GBNH 2YWZA 5I1DB 2EE6A 2JB5L 4HXAL 5AVXB 3NH7L 5CLXA 1I8IB 1QZNA 2J21A 3WLBA 2B3IA 2JQAA 1U8PB 2YQ3A 5GRVK 1DUZA 4IW4C 3RPBA 2WQRA 3D39D 4I88A 4KX9A 3C12A 4LOUD 4YSDA 4ANWA 2MOVA 3S5LG 4JFDD 4G7RB 4C54A 5FM8A 4U1IB 1XX9C 4TULL 5E9NA 1MOEA 1ORSA 2YRBA 1TU2A 4YJZL 2V5TA 1JPSH 1OAKH 2Q7NA 3HG1A 1LK3H 4DP6X 4NKDA 1T0NA 1FIEA 3Q8EA 4G1MB 3GSQA 4ZSOA 3VG0H 4X6DA 5FKPB 4DKTA 3QULB 4DUVA 4APXA 3SDYH 1JI1A 4AL8C 4TUOB 1ZMYA 3BO8A 2XV0A 1NLBL 1MRCH 4F37K 1KCBA 2WUBL 2YD7A 3UYOD 3NRFA 4HG4J 5JXAL 3VH8G 4HUVB 1FRGL 1SHXA 4DN3L 1NGYB 3PPEA 4X4MA 4F7TA 1CBVH 1ZKAA 1FZMB 1XGYL 3DWTA 2G4EA 3MVSA 2C1PA 5EO9B 5GS3A 3REWB 2WXQA 4Z7IA 1JNLL 2HTKC 3ZDYB 2ZUQC 2EO7A 3NMEA 1XGPB 3Q8BA 4PWEA 5JPNB 2A6DB 5DA0B 4S1QL 3BT2H 1MW1A 2ZXGA 5DZVA 5FC9A 1JF5A 5MEQA 1S7RB 5EU3B 5KN5B 2ATAA 4MTMA 4HH9B 2BSSA 5TE4H 1P2CA 1GC1C 4HPOL 3MCLH 3RURA 2XXGA 2ZG1A 4DQOL 2BSTA 1IZKA 2ZCZA 3IS1X 5EOTA 3MV01 1TQSA 4PS7A 1ETA1 2Z8SA 4BH7A 1A47A 3EJTA 3HC3H 4HWNA 2CJUH 4WEUD 3LIUA 3BCDA 2FJGB 3H7BB 3K2KA 4FHKA 3BVXA 4BKLA 4RFEA 3GHEL 4FG6D 2LGNA 5KVEH 3TYGH 4ZX3A 1IBZA 4APQA 4UILL 1FH2A 3NN8A 2OMUB 3S96A 5KS9E 3VVVA 3BKML 4KXDA 5E9DB 4DEPC 3DTXA 1Q9KB 2ZUWA 3GXUB 4H8WH 4W9FC 3HPJB 3RNQB 1EBMA 1A5FH 2QQKH 1XR9B 2ARJB 5AKRA 2Q1EA 5CINL 2BSEA 3VWJC 4BFBD 2CHNA 1NC2A 3WJLA 1KV3A 1HESA 4IRSD 1TVHA 5FGBC 5GJTH 1RHFA 4HJIA 2VDRL 1PZCA 3D6GA 3P4NA 4HF5L 5DS8B 1QNZL 1JBJA 4JO1L 5FFLA 1R3HB 6PCYA 2L4OA 2P7TB 1OM3H 3KYNB 1HL8A 4OCSL 1JZ7A 3OKKB 4ZNCD 3M1OA 2VXTH 1G94A 4PREB 1CDBA 5MEND 32C2B 3P3YA 2UZXB 1KBBA 4Y4FD 3LZNA 4F7EA 2X4QA 3HE6C 3GMNB 3GZOA 5KANI 3OPUA 4ZFOB 4XNYH 5JUEH 3FQUA 2GG1A 2BZCA 4FFYA 3GI9L 1JHTB 2B4CL 1L0PA 4FNLH 4PLKC 4W81A 1A22B 5ESQA 1A1NB 7TAAA 3GFUA 1PF3A 1E4KC 5HHVH 1IT9H 5AOMA 5EU6A 4X6EB 2ZCHH 3SY0A 4YDVA 2OXGA 2OMZA 3UJTL 1FBIL 4KJWD 4AMXA 3U7AA 1RV6X 2HFFA 2BX5A 4HAFA 3VXSE 2WLJA 5SWZB 4NM4L 4C56A 2HLFC 5F6IB 2QSVA 1YEDB 2GJZA 5IVNA 2D4FA 1U8CB 1ZVNA 4S1RL 4OCXH 2Y8QA 2HVKA 1WFUA 3FQ2A 4JFVA 4I3RL 1QI4A 1KGWA 1YYLH 4LLDA 5GSVA 4H1LA 2Q8BH 2G5RA 4YHOH 4FNRA 1H6TA 5I23A 4ZS7H 1L9OA 2X05A 2VRKA 3W3BA 2WTPA 1TJIL 3ULUD 3G6AB 2BVUA 1YQRA 4YDKL 4GUPA 4J3OD 5I75C 3V5HA 3QJVB 4WEBH 4LVHB 4F58L 2WXJA 2D7NA 2HZHA 3U6RA 3HMWH 3FUEA 1M57B 3J27A 1UWXK 5IUSA 2AXFB 1FL6B 1PLGH 2F54B 4MB5A 4M4RA 5KG9A 5KS9F 2VITA 5KZCD 1KCWA 3MJ6A 3WLWD 1UB5A 3FONB 3VFGL 4HIJA 3OJDA 3D85B 4KRNA 1X9LA 3VWKC 4JRWA 4JRXE 4DFHA 4EAIA 1MEXH 4R5TA 3UTZB 5AW9B 1BXUA 2J2ZA 1DVXA 3VWJA 1N10A 4CN6A 3MUJA 1WEJL 2FBJL 3U4AA 1TZIA 4TLTA 5F3FA 3ULVC 5ID1A 2NY7H 2XHIA 4KK9D 4I2XA 4BBWA 4I1PA 3I3EA 2V3FA 4GO6B 2VN4A 1IGMH 4G5AA 4JZOB 4M1GH 4XCCH 1DUYB 1NM4A 5A3ID 2B1HH 2Y6SD 4KY2A 1KJ2B 2YKKA 3DOHA 2YK1H 1E9QA 3QIBD 1NIDA 3RWHB 4UDUB 1C1EH 5GRXG 3BEWB 2B59A 4TUJA 5B3NA 3FSVA 1LP9F 3AG2B 1Z2KA 4X7FC 3MLXH 1OAXL 1MJJA 1RPKA 5JW5A 5JMRA 1RZJL 4LCWD 5AYQA 2GHWB 5HHOD 2DWYA 3L4ZA 4XP9L 4OJFH 5C0CD 2E76C 1ZA6A 3T5WA 1IBYA 5AW5B 3SJVD 3TVMC 4B5ZA 4BZ2A 1EZVY 3IN2A 4OKVB 2QSTA 1PZSA 2E9BA 2FNBA 4NIYE 2EIBA 2DQGL 1AGFA 3DPDA 4FXKA 2MNUA 1UEYA 4PY7B 5SV3A 5JHLH 2ADJB 2OMNA 3S34L 1TQCC 2ED7A 4LLVA 4TL5A 3T3MB 1E40A 3QIWC 3AFLA 1VRSA 2VM4A 1P1VA 3ELQA 5IFAL 3NCYP 1XIWC 2Y7NA 3JWNC 1KG0B 3HG5A 1U42A 4NQDA 2I32A 3BPOC 1OCCB 5CP7A 5AW8B 1NH2A 3L7FA 4HZAA 3TPUB 1OTSC 2AQRA 4NO3A 5AKSA 3DYOA 3TBCA 3O3EB 1S7VB 4NIKB 3WD5H 4N0UB 5JQ6H 1HI6A 5DRXB 1ZSDA 4QNPE 3ASNB 2XWBA 3J7HA 3UG3A 4PRAB 1KDJA 1NOLA 1S7SA 3DA0A 3NIDE 3QRGL 5GIRA 1LQBC 4WI7A 2QTEA 5DWPA 1A3ZA 2XV3A 5HGHA 3ARFB 4XNXL 5KYUB 3BVTA 2NLJB 4WFFD 3H9SD 1GYVA 3X2QB 2R8SH 3VA2C 4ZS6D 3VWKA 3V0VB 3BPLC 1DVFC 2XXMB 2EILB 2AGJL 2H1PH 2VH5L 3SQBA 3ULVH 1A2YA 2IO5A 1NGWB 2BXZA 4GY4A 3V9EA 3V95A 2I25N 1U3NA 2PCXA 1M1XB 2R2BA 3OLGA 4NP9A 4MXQC 1UENA 5D4HA 3QQ3B 5JNYA 2ZAIA 5IB5A 1RFDH 1DIZA 1J9RA 2CO4A 4QWWC 4WW2A 5FHAL 4EMZA 3IN0A 3QWRD 4LLUA 4XNBA 3IS0X 3RAJL 4D7BA 4W6WB 2HG0A 4XGZB 2P5EB 5T1DH 2PXYC 5DJ0B 2DM7A 4M6ML 5TQ0H 2PR4L 1UEMA 4N8VG 3DVNA 5AVTB 3WMPA 2EACA 1Z9OA 5E4OA 4KZEL 1JPFA 3T4YB 2J6EH 2DQHH 2F18A 4P2OC 3X12A 1Y0LA 4EDXA 1HE7A 3MRFB 4E9XA 2NNAA 2FX9H 3QYCA 3GO1H 3CUPB 3WHXB 4CU8A 1JZ4A 4J6IA 2EDWA 2YQBA 5FYKH 1CDGA 2DMCA 3BWZA 1MAML 2IH9A 3GRBA 1CF8H 5J3HD 3B4NA 3STZB 1GYWA 3WUZA 2VLJB 5D7LD 1OO2A 1S7TA 2F54E 4Y4HC 3TVMA 2DKCA 4WK4B 1F8TL 1IBFA 3ARSA 1URLA 3ZRCC 2GJ6D 4N0CC 2HAZA 1JN6A 3P11H 3QPXL 4MXVE 2OTUA 3TBVB 1F1DA 1WD8A 5IQMA 4UT9A 5LAXA 5HYJE 2VR6A 2PP9A 1A14L 1JGUL 1XIWA 4UOZA 3LHPL 3R8BB 3PP4H 4KU1A 4AT6A 4FNUA 1PSKL 4GSXA 3OSVA 1NFIB 4QNPF 1GOHA 2BVEA 2CO1A 3MFGB 5DJXB 3Q5OA 4EN2A 3NIDF 1XB6A 1VGEH 2XZAH 4UIMB 1BECA 4MB3A 5HHNA 4OZ4B 4OIBA 4U1JB 3V5DB 3F7YA 2DJUA 2H7WA 2WTOA 3WUWA 5C09D 3VTAA 4PCSA 4WZ9A 1H3WM 1PZ2A 3DJSA 4KKLD 1J18A 3CFMA 5AW1B 3UBHA 1D5IL 5CJQL 3UTOA 1A7QH 1V7MH 4XWOD 2CE6A 1PDKB 1CFTA 2NY1D 4WV1B 4PLOB 1T89A 5BUAA 2QQLL 5EZIH 2LAAA 1CQYA 1UXMA 4U6HA 2C9AA 5F96L 2WINA 1A6AA 1QX1A 4DP9X 5L9DL 4DZBA 3KWTA 5C0FB 4HK0A 2WBJB 3B2PA 2WOYA 2F9BT 2UUDK 1ND0B 1HK6A 4FL4C 2WHVA 4LPVA 3UAJD 3C09B 1J5OL 4RSVA 5DJ8A 4ABUA 4QTFA 3MRGB 3SOBL 5HYQB 5AZUA 2K1MA 1U8IB 3EFFA 2GK0B 4LSTH 3U1SH 4BWWA 3QAZB 3T3ME 1EUUA 2Y5TB 1FLRH 2YFOA 2PXYA 1CWVA 3VVWA 1FNSH 2BRRH 4NUGL 4PJEE 3Q2VA 4LEBA 2UZIL 4WQOA 5AZ2L 2X4TA 3EJJX 1U8KB 2PPDA 4ZUTB 3WGVB 5F2FA 4MKMA 4P2OA 1E50A 3MLYL 1KC5H 4BHUA 2FZ3B 4HWBA 3OSTA 3TBWA 1FDLH 3VI3A 2EVFA 2AEQL 1EZUA 1BX2B 4R4FL 1PZUB 1UT9A 4X9YA 5F8QC 4Y4HA 3E6HB 3QR0A 3VFRA 4Q14A 4JEGB 3U9UB 4UQ2A 4BYHA 2ZSWB 4WFGD 3Q0HA 4FQXB 4PMFA 3B7SA 2IAMC 2NW2A 1D7FA 1TJHH 3FPXA 3NSJA 4ZOEA 1Q9WB 1MREH 1SVCP 4AGNA 4I0PB 1TQBB 2VDOH 5BUPA 4UYQA 2HH0H 4HT1H 2MNWA 3KR3H 1C9SA 3A6CH 1E8YA 1IGFH 3BH4A 1CGSL 5D7KE 5EOCL 2AQSA 5BXFA 3GUFA 1R3JB 5D7IB 4QRPD 4QXTB 2A6JA 4B9KC 2XWXA 2DM3A 5IFHL 3K71B 2CBMA 3GGWB 4KJYA 3RY6C 5EC1B 1HHIB 1LNUB 4IL8A 3LKRB 2A73B 4N22A 1M9WA 2UY6B 1GHFL 1JUFA 2BH0A 3VFWB 5C0RL 1BLIA 2FYVA 5PAZA 3IE9A 1IUZA 2FGWH 3IFPA 3PQYD 3I6GB 4Z77B 4WEMB 4PUBL 5ACZA 2E9GA 4M48H 1OAUH 4JG1L 4L1HA 3S4SA 4PJDB 1AIZA 3O6ML 3N1FC 1KBGL 5DQ9A 3IPEA 3V10A 1FZOA 1WE5A 1PKQE 3B9DA 5L4MA 3EYOB 4TSBL 4R0LA 3HI5L 5IQOA 1QWHA 3FT9A 3VSUA 2VLJE 1AMXA 4PD4K 2GVYA 5C0BD 2X5PA 2CA4A 3BYTA 3GMOB 2OSWA 4OLXH 4NFBA 3U4BL 2AAAA 3B3BA 3RL1A 1CK0L 4JM0A 4LQ1A 5G55A 2DAVA 1GOFA 4ZW3A 3GJEA 1E4JA 3J8F7 1TMQA 2ZKMX 1YN7A 4HS3A 4PJEF 4IOSD 1MWAL 2ODIA 5CEXA 2XG5A 1WQVT 4LIQE 4YDJA 4OB5L 3QEQA 2FD6H 1IAIL 3Q1EA 4P9HC 1KTRL 3FB6B 2OXHA 1NPNA 5BS0A 5BV7B 4JX0A 5FCUL 4WI2A 4M1DH 3ZQWA 1TJGL 4DGIL 2JK5A 4NC1C 4BJLA 3V8CA 1RCYA 3NG5A 4JKPL 1U3JA 4F2EA 4WUUA 2WQWA 4PGDB 3CDCA 1FFQA 2ZONA 3BP6A 5TGBA 1LGVA 4JDEB 4XN9A 5E8DL 3SDDD 1QN5A 2YS4A 4YXKL 1CGXA 1EK3A 1MH5B 5BZDB 1M1SA 2HX8A 3IDGB 4M5YL 1QSZA 1QN3A 1OTTC 5GGSB 1MPGA 1YJDC 3CVHB 4A6YH 4JFHE 5F1OB 4K94H 2BCKA 2WKOA 1MHPL 1YMMB 2FRGP 1OWRM 4RMTA 1ZV5A 4ODTL 4GAYA 4W9IC 5F9WB 3QI9D 2H9GA 2Y69B 3HS0C 3BRGC 1CLOH 3I50H 5ABAA 1A02N 3Q01A 1G1KA 4NHUB 2WLIA 4R90L 3F7QA 3KLHD 4WWKD 3RY6A 3OCIA 2YD4A 4F9LC 4L8BA 3IU4H 4LLWA 2IOIA 1V10A 4R2GD 4WCYL 1G9HA 3ZOAA 5CBAA 1P7BA 1FO0A 4L4VB 5CP3H 2DWTA 1TTCA 2PTTB 4K9EH 3T1FB 3IXTA 4HS8L 1I9EA 2Y22A 2Q0ZX 4LSQH 1IGYB 1Z5HA 5FW6A 4PY5A 4TTDD 1BFVL 4POZC 2EYTB 4ISVB 1FFTB 3U30B 3UGUA 3VYNA 4EXPX 1M7UA 4HXAH 4YHML 1R5VA 3F8UB 4MVBD 1IAIM 4MQ7B 5AUMB 2QDWA 3VGDA 3WGUB 2A9AA 3MA7B 4YWGL 1EO8H 1PL3A 2PMZA 3CXHJ 4F7KA 5IUCA 5IEKB 2RAMA 5D7JA 3PWPE 3IFLL 1TUPA 4JFED 3QQDB 2JIXA 2WB7A 4TULH 3FRPG 1UOLA 3QUXA 2HT3D 2ZWZA 2FKFA 1URIA 2ARWA 3AWEA 2DQDL 4L18A 4WTQA 1T5WA 2V2WB 3L08A 1AS7A 1T20B 4XBEL 4NQEB 3GXMA 4WHYG 4KPHL 5D7IE 1KIPB 1JRHL 2VISA 4H1LG 5LG6A 1GGTA 1AHWB 4OBSA 5DK3A 4ZZKA 4O2CB 2NX5D 1DJGA 1B88A 3BN9D 4FQJL 3L5IA 5DHVA 3N40P 1NLBH 4FQ1H 2BS8A 4ZTPL 4B0MM 4BSVA 3KXFD 3OSKA 3SBPA 4ZBJA 2C9SA 4P06A 3BWUF 1YAZA 3MUZ1 4GEIA 1I1AB 5FA4A 3FTYA 4U1KB 3O9WD 4BXSV 3GSOA 1B0WA 1MF2H 3SOTA 4DGUA 1YY8A 5DUJA 1H0DA 3SGKC 4W4OA 4HOMA 4GQRA 1N39A 4OF0A 2C4FU 4UM9D 4PJDE 1I8UA 3D39B 1DBJL 4RESB 4F8NA 5BRZE 2XV2A 1H19A 5E9AA 4LBEA 4S1QH 2XQYA 3HAEB 4JPQA 2EUXA 2XVLA 4GOSA 4JFDB 2EIJB 1L7TL 2IDQA 4ZAKC 1QBML 4HWZA 3MO1B 2L04A 1AOZA 4O02B 4HPOH 1CDUA 1KY6A 1S3RA 2VWEE 3PWUB 3U0WL 3TO2A 3VXUD 1QN7A 3JTTA 4N1CA 1SDDB 2NOZA 3TURA 2IV8A 3NCXA 1THCA 1HX0A 4N90E 4F9LA 2GI0A 2X41A 2AEIT 3KWVA 2O3OA 4JMXA 1J12A 1VA9A 3N6YA 4N9OB 1T7WA 3GIVB 4G9FD 2BOBB 1P1ZB 4U1LB 3ZKNC 3ZRFC 1KPRB 3T77B 5BMPA 4L3CA 5TDOA 4ALAC 4KVCL 4UILH 2UZYB 2UXFA 1XCTA 2K45A 5IZ7A 5LXVA 4PJ7B 3D18B 5IIEB 3A5VA 4QRAA 3C6LD 3CZFB 4E5XB 1BZEA 4Y9FA 4HJHA 3RWJB 2YMTA 3E3QC 4FQHB 5CINH 5I71C 2YSSA 5G5DB 3VRIB 1QMUA 2R2EB 2OJZL 2AQPA 2DZEA 2KZWA 2QBWA 4ZUSB 2OJ1A 1FI8C 5KSBB 4YE0A 3EBIA 2OR9L 2YRZA 4HF5H 1QNZH 1RUQL 3T2NL 4DERA 1E5BA 4WIQA 4L4JA 2DJSA 2EP6A 4FP8L 1T83C 1EBPA 1KLFA 4GW5B 4N9GB 1I8MA 1LMIA 2WCSA 4E9LA 3TEXA 1NCJA 1A65A 2J6WA 3VXTB 4ANXA 2WNKA 5AW2B 4LE8A 5D7IF 4JB9H 3QUZB 4ADIA 4JFWA 4KMQA 5AAPA 4K5LA 1T66C 2LAEA 3ME0A 3ARRA 1UXWB 3HUJA 1THAA 1ZJBA 2Z35A 3W0WD 3GI9H 2B4CH 4IS6A 2JKRM 3J2PA 4U1GC 4MNHB 4PJ5D 1JYVA 3BVDB 5H4ZA 5GISH 4DCQB 2GBTA 4DP7X 3RKDD 3P77A 3ZZ1A 3GJFB 4JO2L 3BSZA 3UJTH 3OSEA 3L4TA 5LGJB 2H0PA 4FXTA 3SPIA 3X3GL 3BPNC 1V3MA 4NDMB 1JNNH 4PJDF 2F7LA 4NM4H 3SGKA 3K1KC 1GY1A 2NTFA 1FLTX 3BFWA 2JLPA 2IPTL 1VFBB 4S1RH 3KVDD 5F1KC 3IGKA 5CGYD 3UBXA 3OMAB 4IRSB 2V9TA 2WWMD 4H40A 2P45B 2X28A 3KD4A 4I3RH 4MJIE 4PB9L 4N2FA 4XAKE 4LPYA 4QOKD 4AIZB 3SBWC 4DP5X 1Z9PA 5J6GA 3KJ4C 3RI5F 1I7UB 1TJIH 2K6YA 1KIQB 1QABA 3LKSB 3P40A 3D48R 2EIKB 3HPLB 2ZKHL 4GS7C 4S1SH 3P2DA 1NGQL 2BVOA 3O3UN 5EULV 2BWQA 4F58H 3VXMB 1LWWA 4Y4FB 5DTFB 2XNAA 4NQCA 4D9LH 4R7DA 3NIFB 4C4BA 4E9QA 4MDIB 1RP9A 1QNAA 1LO4L 2G3ZA 4I87A 5H2BA 3D34A 3DO4A 4H44C 4Z7VE 1XSKA 3VFGH 4D0DA 3QNFA 2O72A 1ET8A 4X9IA 3MNVA 4AL8L 1E9OB 3UC0L 2DB8A 4AW7A 1SY6H 1UOWA 3QO1B 3ZIMA 3B2UC 2A0LC 4OTXL 5DMIL 4Y9GA 1QSVA 2H32H 3QG7L 2P42B 3C60C 1CLYH 5E03A 3P1VA 5JYMA 2ZXCA 5AG9A 1RZ7L 5DI8B 5FDWA 2UVEA 3CHOA 1WEJH 5D1ZB 4A37A 4WXAA 4LLQA 3UJJL 2XHNA 3BP5A 3W81A 4Z18A 2AK4D 2ZWLT 3V0DA 4LCUA 3EYVB 2Y4SA 4FYQA 1CCZA 4UQIM 1A3LH 3FQNB 4Y5YC 4X7SH 2C3VA 5C3IA 1QA9B 3B6SB 3B83A 3T4AA 3TFBA 2OMVA 4KK5C 3SCMC 3RWCA 1O6TA 4OGAC 1E4HA 2F7RA 2D3JA 5B7EA 4BUQA 4B0AA 4G8IB 3SYAA 1YVLA 2FSEB 3IDYC 4GAJH 4Y16B 1TTRA 2G30A 3JWNG 5F7HA 2DL2A 5GSRA 2SEBB 4NFDA 3V4UH 3GDBA 1GC1L 1F11A 1OAXH 2H41A 4K2UH 1UVQA 1DQKA 4C4KO 3RVXD 2X4OB 3NDZE 5CEZE 3LRMA 4XP9H 5LUMA 1Z9MA 3BQUD 5EORL 5KZCB 4UBDD 3FQYA 4UOJA 1XF2A 5D7SL 3WNPA 5GGQL 3ZU8A 5B7MA 2F53A 3SKMB 4WFHD 4OZIA 5ICYA 4MX7A 1LWJA 3GMRB 1CGUA 1AIFA 2YEZA 4NO2A 5DZLA 1CFSB 1RUML 3CK0L 1YECH 4PJ7E 1L7IL 3CX5K 3CFUA 1IAKA 3HG0A 3S34H 4QRSA 3MACL 4C59B 1H3GA 2DL9A 2EXTA 4ZXBC 3W1ZA 3GXPA 4D0BA 2W07B 3MRQB 1FL3B 2YGOA 3KLAB 5SWQB 4AEHL 3MGAA 1CJYA 3IJSA 1YG9A 4G43A 4XCNA 3SBWA 1H3UA 5IW6B 3UACA 4XVSH 3V6ZA 4UTAH 5KSBE 5DD0L 1T6WA 1QFWH 1C16A 2EEDA 2VMJA 4N8PA 3JZYA 4ZMVA 3SDCC 2EIDA 2FHBA 1P7HL 1BZ7A 4LVEA 5EZOH 1DLHA 2Y2TA 3QIBB 2BMKA 4KXZH 3S37L 1BJMA 3NJKA 1XH3A 4Z7OB 1BWWA 1UYWH 4Z7VF 4URKA 5EA0L 3EZ8A 4QJ3B 4D8PA 5E8EA 4NNPL 1XGQA 2DOCA 4LCWB 5HHOB 2IQAB 4OCMC 1NSNH 4JQXA 3NZUA 5C0CB 3V55A 3ARBD 2WJ5A 4Z7WB 2WXPA 3MCG1 5MI0B 5K9QG 3SJVB 2VH5H 2YD0A 4JGNA 1UOKA 2ADIB 1MNNA 4JDTH 3C60A 1KYDA 1NMAL 4YPJA 4MAYD 4J4PC 3S3SA 4BZ2L 4N0FA 2CO2A 2J55A 3KYMA 4I77H 2RGSA 4IDJH 4FCAA 3V4PB 4ZX4A 5FHAH 1XF3B 3RAJH 4E0RA 5DUBB 3ZE1B 4KI5C 1ZTXH 1M7XA 1I4FB 3P9LB 4P0DA 2XZZA 1ZV2A 4M6MH 2PR4H 2YUWA 5ACMA 1S7WA 1DQML 4F8LA 1F86A 2YGNA 1X5XA 5K9JL 5BO1L 4KZEH 1VKLA 5D4JA 2YKLL 3EDKA 3FUMA 3UEQA 1EDQA 1HH9A 3CG8A 3EBAA 5C0DA 2ID5A 2CJ3A 1TEGA 1NCOA 5MENE 4HULB 5D2LA 1F0LA 1QO3A 1MAMH 3TTSA 2LFGA 4RAHA 4AX3A 3JT2A 5FYLL 5D96B 4XNUL 3VQ1C 4Y8AA 3H9SB 4GI6A 4YSQA 5DJCB 1JZJA 1HL9A 3SEPA 4PJ7F 1F8TH 4PJAA 2NOLA 3WN5B 1D9KC 2JCCA 1TXKA 3OKOA 5DUPL 1CD9B 3BKYL 1KFIA 1UB6B 1PQZB 5EBMA 4QLWA 3S4SG 1JL8A 5EHFA 3HRZC 1IGTA 1SHMA 4ZXBA 2PW2B 3CNKA 2J71A 1E27B 1A14H 1JGUH 3EH2A 4M7ZC 5FA3A 3LD8B 3LHPH 5KSBF 3WFBH 1N64L 3P0VH 1PSKH 2D3NA 3U82B 2OA9A 3ROOA 3E6FA 1SJEB 1AS6A 1AHKA 4RRPA 5CZRA 1L6PA 1S9YA 3NK4A 4TRPL 3ULVL 4JO4L 2F58L 3Q5YA 2FJHB 3BUBA 4U31A 1CIUA 1JFQH 1SN2A 3HJEA 1FL5B 3KGUA 3WI9A 5F0PB 4J1UB 3CFCL 5GHWH 5I0VA 2GFBA 4HHAB 3G5YB 3KPPB 4LARL 2N0MA 2VRQA 2VOTA 2H2SC 4NNYB 4EO5A 2E7MA 3V2AR 1EXHA 4NRYA 1U95A 2WXKA 3DSFL 3BZDA 4X9HA 3II1A 3TNNB 1U8LB 1AQMA 2QQLH 1L5GB 5D7LB 1MHCB 4K7FB 4XCEB 4Y4KC 3HMXA 3MFFB 2FHFA 3PV7A 5L9DH 2GIYA 3DX2A 1CYWA 4C57C 5IMKA 4NQUA 4V1DD 2GJ6B 2EDEA 4XX1G 1O7SA 3OJVC 2ZX6A 4J4PA 4ONHB 1K5NA 2F8IA 4FMFA 3I6LE 3NSYA 4R6UA 4HK3N 3WNLA 4HSQA 5I66B 2HJFA 1J5OH 3BKCL 3F12A 4JDZA 4DPBX 5E4IA 2OV0A 5GGRA 4PRNA 2GSMB 5CD3A 5E6IC 4PRPE 4ELMB 2HZSA 4KNSA 1G9MH 1U3HC 3KZ8A 2ZF9A 1EERB 2A1WL 1H3VA 5DCCA 4UT9L 2YUVA 1R0AL 4IGBA 4DZ8B 4NUGH 3WO4B 2D7TL 5CJ5A 4WEEA 4MZRA 5C71A 3A0OA 4N4YB 4KJQD 2O5ZL 4DGYL 1DEEB 1EDYA 3CPLB 3LVEA 4QTIL 3C5ZC 1ZSHA 3RZCD 3WTSA 3TT3H 3TH4T 3P30L 4KNUA 1FYHB 5C09B 4NO0A 4B97A 1INQB 3NA9H 2AEQH 4R4FH 1A64A 4YBQC 4Z7OE 5IROC 1ZHBB 5A43C 2IG2H 1GYUA 2NY1B 1H3PL 1T4KA 4LCWE 4P5TD 4AVKA 4B9GA 1IC4L 1PD1A 5HHOE 2NY5H 1I3RA 1T3FB 3B2XA 3CVIL 3FB8B 4GW4A 4XTRC 5F21B 2ITEA 1D9KA 5C0CE 1MJUL 4Z7WE 5DRZA 2X4UB 4FTDA 1IE4A 4IK7A 3MLSL 3HRZA 4N6RB 3WNJA 1WAEA 4M7LT 1CGSH 4CDHA 1O9VA 3D2UA 4X99B 1AGCA 4NC2B 2B5IC 3GKWL 4TUKH 4J2QA 2WY3B 4JFZL 3VMNA 3GSWA 3L6FB 4PRBA 3CHXA 1JJUA 2YJLA 3BLBA 3WIHA 5IFHH 5I8KH 1SDAB 4S1DC 3OM3B 3KBEA 4GMSL 5IWLA 2A83A 1J9QA 3L81A 2RR3A 5JW3L 1PY0A 4PJIB 2EDMA 1GHFH 4WI0B 5C0RH 4GKSA 3I6KB 5HPOA 2GITB 2XJKA 3CFBA 4H2CA 4P2RD 2VKWA 5I24A 3UTSA 1A6PA 4HWBL 2OX5A 3BP7B 3X1EA 1V3LA 3RIAF 2V5RA 2Q3AA 3E8UL 1QUPA 2AK1H 1CD1B 4TSBH 2BWDA 1GL4B 2D7QA 4Y4KA 3HI5H 3C6SB 5T1JA 3REVB 5I0XA 1BVLA 3TC9A 2JLLA 1UH4A 4ODBD 2MHAA 1DQQA 2APSA 2VLKB 4EKXA 1NMBL 3U4BH 3TBTB 3P3RA 1KCRH 1CK0H 4Y5XB 1EHLL 1QRND 2PETA 5ADOL 2KLRA 4YZWA 1A1OA 3UERA 4F15B 1JPEA 3VRLE 1I7ZA 4QRPB 1U3HA 5L7XL 3QIUC 4JZNA 4YSRA 2DKMA 2FEEL 2YARA 1EO5A 5C07E 4OJDH 4HUKB 1PMYA 1NCNA 2DBLH 4OB5H 1EAPA 2XQYG 2X9ZA 1PJ9A 3KPMB 5D9SA 2VN6A 1IAIH 4I89A 4MHHG 8FABA 2UWEE 3JV5A 3T6WA 3P4OB 1IAII 2X6MA 3EG9A 1OHQA 2I9LB 2IDTA 3DTDA 3QWOB 2K9UA 1PY9A 1FE8L 3C5ZA 3KDPB 4JRFA 5FCUH 2QLYA 2WTRB 1FAIL 4Z7OF 12E8H 4YSUA 2QR1A 1VOKA 4TTGA 2H3NA 1PG7L 4S2SB 5LJYH 1HQRB 1TJGH 3S48A 3IXAA 3PQYB 3E8VA 2CO6B 2OSLA 4ZO9A 5IROA 4JKPH 1N6UA 2XIIA 4JVPA 4ZD3H 1NEPA 5D1XC 4OSUH 2DKUA 1TZHB 2G75A 5E8DH 4Z7WF 3STBA 2W0PA 4DAGH 3WYRA 1HKLH 3T6QC 1TO4A 1KTDA 1TITA 4Y19D 3ARGD 4CVZB 3RVUD 4PRHD 5C0BB 3CMGA 1T22A 2GJ6E 3P69A 3TT1L 4GRLD 2CKBA 3GXFA 2E4TA 4WK0B 4FKKA 4LOFA 5IR1A 1HWWA 1A0QH 4R90H 1IQWH 3MRHB 1AE6L 4QTHA 2K4WA 4WCYH 4PW3A 3WSQL 6FABH 4ES8A 1ED3A 2FECL 2DYPA 5TQ2L 5L2JA 5EU7E 1BFVH 1JDYA 2R1XB 4NPYA 4XXCC 2YA3A 1J0KA 1T21B 2CDFA 5E7BA 5BO0D 4OV5A 2XFXA 3KNBB 3WHE1 5E08L 2NY4D 5C09E 3WKQA 2HVJB 1D5ZB 1A9VA 1ZHNA 2FT6A 2VDLL 4IBLT 4YWGH 4DO5A 5L8JB 4QO1A 1OP5H 3SDDB 2HSIA 3ABLB 4PTTB 1AGBB 4BK5C 3B5GA 1ANUA 3L7EB 4JQIL 4PHXA 1ACZA 1U30A 2NVMA 5FO8B 4C7PA 3MREB 2IGFH 4M61A 1QLFA 2DN7A 1L3NA 3VRLF 3HLAA 2Y7LA 5DMKB 2YD1A 2Q6WA 1IKFL 2AZUA 4M6NL 4A7GF 4F2MB 1A6VL 3IRPX 4Z95L 1K4DB 5A2KH 3QI9B 5C0IB 3S88H 3QDME 1J8HB 3VMOA 3GMLA 5A2LH 1QACA 4XBEH 2UWEF 4KKRA 3S3BB 1BZOA 1E3FA 4KPHH 1JRHH 1QVOB 1WH0A 3LZFL 3PS6A 3M88A 3QPQC 4RDBA 4M7JL 4WWKB 3UH8A 3IETA 3V0JA 5E6SB 3HNSH 1JRHI 5TF1L 1VCBC 4R2GB 1SOKA 4FQJH 4PJHB 4ZTPH 4EI5D 4BSJA 3QCUL 1BOGB 3KE0A 3QA3B 2TSBA 3P2TA 4GW1A 3SE3A 1EFXA 5D1XA 1YUHA 3QQXA 2XICA 3SO5A 4HMDA 3HI1B 5E6RB 1SLVA 1QNEA 4JAMA 1PCMX 2K4AA 3IVKA 3D3VA 1MCLA 3QRFM 2P3YA 1CS6A 2LHAA 4JFEB 4UAOC 4Y2DD 5DFTA 4BFOA 1L7TH 1FG2B 2IADB 1Q9OB 4P4KC 5BZWA 5GS1B 1QBMH 4AGLA 3TTYA 4EAJA 3F5WB 2ATPB 4WJ5B 5EPCA 3M46A 4IBTA 5AB1A 5B3SB 3U0WH 5JW4M 4HUNB 4O5LL 3VO0A 2FR4B 3QJOA 3WAJA 4MXWL 3UIYA 5IVXB 2GTQA 5EU4A 1QEWB 3PIQB 2VXQA 4ETQA 2N7AA 5TF0A 3Q9PA 4QRPE 1J0HA 4HC1A 3AGVA 1S2EA 4L1LA 4OFKA 3TCLA 1I3VA 3EO0B 2NX5B 3IDMB 4KQ3H 4YN3A 1XT5A 1MFBH 1SYSB 4CGUB 5E23A 1D5XB 2L7QA 2W60A 1WBZA 1AD9A 4KVCH 3IE4A 3KXFB 5JHDD 4JM4L 2QR0B 4XXCA 3RGVD 4P9HL 2BLFA 1OZTG 4P2QA 2BP0A 1QYGH 3KMDA 5KYWB 5IBLD 3ABZA 1OK8A 1P53A 4MAUL 3M8OL 3OKLB 4CNIA 1CBJA 3O9WB 4IMLB 1O5DT 1LWHA 4P57B 4RBPK 2FEDC 5E00A 2F74A 4NZFA 5IHZB 1BZ9A 2WBWB 5HDRA 5DZAA 3Q3GA 4PWHA 4EBQL 3RWFA 4BK5A 4UM9B 2WXLA 3OX8B 5HJBA 3QPKA 1I1FB 1N6VA 4QRFA 3WTWA 2IFFL 3L5WB 1WBYB 2AV7B 5ENWB 1OV8A 4FP8H 4MKTA 2HRLA 3T0ED 3CQFA 3U9WA 4EUPG 2DQFB 1OF0A 4CC1A 3RDTC 3ATDA 3C5JA 2DIJA 3O81A 4RWYL 5EF1A 2Z8UA 1MVUB 3H7LA 4XH2A 2GSGB 3FB5B 1YJDL 3MOQA 4G7SB 1OP3K 1J86A 5FUZH 2Z7WA 4QHLB 4XPAL 2O61A 2CO7B 3QJHB 3DROB 5CCJA 3PYCA 1D7BA 1FGNL 1W0VA 2G3XA 3A67L 1MN4A 4XMZA 4X4XB 4P2YA 4BZ1A 1A9EB 4EJ1C 2O5YL 3KYKL 4G9FB 4J2XA 3CSYA 4F33A 2WZPA 3IKCB 1L9QA 2ITDA 5IHUH 1WA0X 1IEHA 1V7NL 1AXTL 2X87A 3L5HA 1JWMA 3T6ZA 5T1KD 5FYJH 3D4VA 3OZKA 5A2IH 2PO6A 3C6LB 4FN0A 2V2XB 1RK0B 5ABDE 1AGDB 5DJZB 2Q76B 5DJAA 4ZTEA 4NQQA 1IEBA 4YIQB 1YN6A 1SPDA 1I8LC 3L48A 4R5VA 2VLME 1ZHLB 2NUPA 3EGXB 4JUTA 5C7XH 3TA3D 4WUKL 1JPGA 3O3AA 4P4RA 4WW1A 5K1VA 4AE1A 3LNDA 4QPEA 3UZVB 1GH7A 1KNOB 2ZKHH 1UWFA 1EEZA 1VENA 2E3VA 2J5LB 4X7TA 1FC1A 1WZMA 3DXAD 1KB9J 2BC4B 3E0GA 4K5NA 5IOPB 4WJG3 1JTPA 1LO4H 4FS0A 4LCCB 2DTSA 1J8KA 1FPTH 2D31A 4ONFL 3W0WB 3S9DB 5IGXL 4X8JA 3I85A 4PV9B 4NXKA 3QNXA 4PJ5B 4P59L 1A8ZA 4AGQA 5JIPA 4JM2C 4AL8H 1NL0H 3CHRA 7FABH 1R24A 3UC0H 4EEEA 3JZ7A 1HIMH 4YE4H 1GOGA 4OTXH 2EDLA 5DMIH 5JHAA 1KXTB 1MFEL 2FL5B 5LG1A 1RZ7H 1HWHB 1TIUA 1WPCA 1N18A 1EJ6A 1VEOA 3BSZL 4G8GD 4AITA 2VUKA 5FEBA 4NZTL 4HKXB 2EDBA 4G8EA 1KZQA 4MDJB 3UJJH 1QWNA 4Z0BH 2DWXA 3PUUA 2HUHA 4KO5A 5EBGA 5EFIB 3FU3A 1Q0EA 3PXLA 5FPIA 3T8VA 5FM4A 3FUIA 3VD5A 3P3SA 3RIFF 3BH8A 3ZYIA 2OBGA 1IZJA 4QOKB 2Z91B 5I2IA 4CW1A 1TYJA 1IGIL 5KAQF 4GRMB 1CURA 3D9AL 2GT9A 5FOBA 4JFEE 4NJ9L 4WHYH 3LH8A 2Z4TA 1FFPA 1VIWA 5E2WL 4H1LH 1I7RA 1NDMA 2DQEL 3F62A 3MX0A 2IH3B 3H3PL 2J88L 5KOMC 3NP4A 1QHQA 3MRMA 4TQEL 3WXVH 1ZPLA 5IW3A 4HFUL 35C8H 4LNVA 5D6DC 5FYJE 1COBA 1H6EA 2BNRE 2E75C 2HFEB 4XN7A 1QZ1A 2J1XA 1XMEB 4NGHL 1U8OA 1JYXA 4F5CE 4LGSB 3TEZA 5D7SH 3MV7B 3QUKA 3CHPA 3WG7B 2NX5E 3ZKQD 3HNTL 5BJTB 4QXGL 1QEXA 1M3QA 3C8KA 3KXFE 4PRDB 2B0SH 1HZHL 1RUMH 1Q9LB 3BI9X 4FTVA 3U2JA 4ALAL 1L7IH 4MNQD 3MACH 5CGTA 3PHQA 2BNQD 1NEZA 4G2AA 3RKPA 3IRCA 1Z5LA 3KCPB 1BAGA 3ZGIA 2OQJB 5LAPA 4AEHH 1HSBA 2AK4B 2GAZB 4PJBE 5T3XD 1BVNP 3L95B 4JRLA 4ENED 3KPOB 2Z64C 1VGKB 2ZT9C 3EJCA 5D5ME 1AQHA 4TNVK 1KB3A 2D0AA 1LEKA 2IPUK 2EIZB 3TIEA 4LL1A 4ODUB 3NRPA 5JXEA 4MJJA 3IRZA 1OVZA 1TQTA 3GXIA 3HBPA 3GTTA 4NNPH 1AI1H 1SLWA 1BGXH 2CRIA 3QEHB 4FXGB 4GPVA 1J0JA 4OCWH 3VXUE 4D0CB 1XGTB 1X4ZA 5CMAB 2H6PA 1LE5B 1G0XA 3BQUB 3WOVA 4OIIH 1HXMB 1F3DH 2V3EA 5HYSA 3HB3C 5E6UB 4QXWA 2JKXA 3TF4A 4KQ4H 1CLVA 1IL1B 4YQXL 3OZ9H 4M93C 1P7QA 3V0EA 2ETWA 5EBLB 1NMAH 3CFIC 1QLEH 5G4OA 4BZ2H 9PCYA 5DJ6B 4GXVL 5JMOC 3V5KB 4XPTL 4P46D 2YXFA 2QVTA 5IQ9A 1F3RB 2XKNB 1WIUA 4AYEC 4AEFA 4UT7L 4Y1SA 3P02A 2DQJL 4FNPA 1B4JH 3ZTDC 4NCC2 3IJEA 3QXAA 1FZJB 3NFNB 1DQMH 1G6RL 3L3DA 1IGJA 3FQTB 3MOBH 5C0AD 3D25B 2LR4A 3DJ9A 4KK8D 5AOIA 1CE6B 3VD7A 5K9JH 1BQSA 3ZKXB 2YKLH 3LN4B 3IWUA 4PRID 5F9OL 2Y06L 3DSNB 1PIGA 4N28A 2EE9A 4XZUB 3WL9A 4JUSA 2ICEB 3ZT5A 1OGTB 4QY8B 2R83A 3C5SB 2BVPB 3O4LA 4K7PY 1UJ3B 4ODVL 3OXSA 3DPUA 4P48A 3HZKA 1ZA3A 3CW7A 1M2OA 1G7IB 3BWAB 4R26L 4Z3FA 1AQDB 3ARBB 4RAVB 3SKNA 2CD0A 3MBEC 2PCFA 3L13A 3IDIA 4LK4A 4U1SA 2Z0UA 3WXWH 3IAQA 5JOFA 25C8L 2VL5B 4YHYB 3BKYH 4X4ZA 4FKEA 2A77L 2JMRA 3K4ZA 5JIMA 2Y23A 1UXSB 2XN9D 4L23A 4PJBF 3DHPA 5IYCP 3G9VA 4H25A 1TLMA 1HU8A 4CMMA 2PYED 1ADQA 4HVBA 3C2AL 4GAFB 4Z3TA 5D5MF 3OGCA 4RH4A 5I1HH 4H8PA 3ESUF 3S36L 1PCZA 2R4SH 1R5IB 1PFCA 5I15L 3B43A 4KH9A 1NBYA 2VDOB 3AY4C 1RZFH 3F7VA 1XHHA 2F58H 2HRPL 2OMYB 4JO4H 5JMVD 4QOKE 3RWGB 1C5BL 5SWSB 1B6UA 5FECB 1DBAH 4JJHA 4AI7A 5IEHB 1HHGA 4HS6B 3VGGA 1SMOA 2V92A 3DOSA 1ET5A 4OJYA 2MFNA 3DSFH 2JHNA 2FQFA 4IRJC 1IKNA 1Q9UA 2Z4QA 4HIHA 3QXUA 1KEGL 3EJZD 3LKPB 4MA8L 1VF5C 3SE4A 3TOPA 3RVVD 4R4NC 5F7DB 4JPWL 2Z8VC 5CZXC 2BHZA 1M05B 1B4TA 1Q1JL 3P9WB 2X42A 3LH2H 2CKNA 3BKCH 1WGVA 2IAAC 3EDJA 4NQDE 3AQXA 3FQRB 4PV1C 2D8KA 2FO8A 3RUGB 2FO1A 2X4SB 4MMZB 2KPNA 1CGVA 4UT9H 3U83A 2BERA 1R0AH 1E5CA 5IF0B 5JO5B 5F3HA 3VGBA 2D7TH 3JWNH 4DNLA 2Y24A 3VRJB 3VFPA 4HU2A 4AGMA 4JNXA 5A2BA 1YNKH 3MCYA 1EAOA 3O6FC 3P30H 1WC7A 2FWUA 5DRNA 3GIZH 1AKJA 1EMTL 2DIAA 4QXUL 5HGBB 2WQ8A 2JTDA 4OU3A 3BPCB 4W9GC 2ZXWB 3TBSA 4PGEB 4ODWB 4YO0A 3AG3B 1HXYB 5D2NE 2CLRA 5E1HB 2L8AA 3MBEA 3MXWL 1ZHKA 3BZFA 1UHVA 3CVIH 5KVDE 1MJUH 4GH7B 1KIUB 1DQLL 3TZVC 3TV3L 2BM3A 4V1DB 3RVTD 2YUXA 1FUNA 4K3JH 3MLSH 5I0WA 3CZSA 3MSPA 4NENA 4RVBA 3QH3A 4ELKA 1MRDL 3I2CL 3HMXL 1RK1A 4WO4A 2NOFA 3NOIA 3NABH 2JFCA 4OGZA 1C5DB 4RMQA 3SYQA 3NIGB 5C0GB 1F4AA 4RFNC 3MJ7B 4XNAA 3ALXA 4M4PA 4M8QB 4LSVL 3KDMA 2D0BA 3PDOB 1CDHA 4YDZA 1M53A 2X3BA 4A6YB 4FZEL 1A3QA 3QNYB 3AY4A 3T6VA 2BNUB 3AXHA 1FVCB 1F3JA 4MD0A 4QGYA 3IMTA 1H5BC 5DZ9A 2P5WE 3BP4A 3NTCH 4FQQA 4LVNB 4MJ4A 3RZCB 1IBHA 1K4CB 3U48A 1ULVA 1WZKA 1VACB 1L9PA 1QBAA 3TN0C 1C47A 4HWBH 2WK2A 1KZYA 4QHNA 3SN6N 1BCIA 5JPMB 1ZLVK 1WYJA 3E8UH 4ODXA 1IM3A 5DXWA 2VC2H 2Z6FA 3H4FA 4YC2C 2Q87A 4P5TB 5EBWB 3DJTA 2YEQA 4LCYB 1KTCA 3VXNB 2WWNA 1H15B 4HIXL 4F7MA 1VDGA 1BMZA 1N70A 1NMBH 4ZTOL 4KUCF 3H55A 1EHLH 1X7QA 2W9DL 4P23A 4Z7UB 5JDSA 3L5XL 4LSSH 4OLWL 3D33A 3UAAA 1RZ8B 5L7XH 1VKXB 2R56L 2TRYA 2JTYA 3GLDA 4AJ0A 3GHPA 2FEEI 4URTB 3QUMA 5HVWA 5DEZA 4HJTA 3V7MA 1DQVA 3T8XA 4DSYA 3FQXB 3WIHL 3D87B 3UPRA 2YPLA 4QYOB 1FAIH 2UX7A 4ZUWB 1RU9L 5J11B 4FFWC 4NWUL 1LE9B 2NUTA 5BW7C 2VLRA 2HJLA 1SJHB 4JFFB 5A7EA 1CDJA 3TXAA 4FLSA 2Z65C 1PPIA 4P2RB 2UXTA 1NCTA 1G4RA 4I9WD 1IJ9A 5J56B 4WDIA 1CMOA 2HLAB 3RILA 3JVFC 2AMUA 3FUKA 3D06A 3WDHA 5DMJB 4UQEA 3F65A 3CLFL 3TZVA 2DRUA 4NKOB 15C8L 1KGJA 4WW2F 1DANU 3IAPA 4J8RB 5E8PA 4GBXA 4NN6C 2HG5B 2ENPA 4MRBA 1KPVB 1QRNB 3NVQA 1RH8A 5I1KL 4G1EB 4YX2L 3X17A 4L4TD 3TO4D 3RB7A 2XPGA 1SM3L 3GT6A 3FT1A 4YZFE 4HKBA 5EU5B 5EUOB 3MOAL 5MERA 4Z7AA 4QAWA 1KGCE 1UQSA 4Y5VB 4KO9A 3QJTB 5TQ2H 1RJZA 4HPYL 4XPFH 4I8OA 2FECI 3ES6B 3TA4D 1OWWA 1WBXB 3Q48A 4LEXL 4MJ5B 3K6SB 3HE7A 1TYRA 2XG4A 2UZPA 4LMQI 3UAEA 5E08H 4OY9A 4L8CB 1F02I 4FYSA 3X13B 3F85A 1KTLB 4B95C 3GBMH 4OLUH 3QJRB 4JFPB 1I7TA 1SOSA 3FHQA 5DD6A 4YVNA 2PKDA 3G6JB 1WJWA 5DLML 3CIAA 4I3SL 3KL5A 1EDHA 3MV8A 2P9RA 4Y19B 2YZ1A 3ARGB 4EZMA 3H0TA 1M6OB 2J8UB 4PRHB 1M7IB 4APQD 1I9IL 3CXDH 5I1DA 2XWCA 4G72B 1JFHA 3SGEI 1AZZC 1I8IA 4Z95H 4WI6A 4V1DE 5CCKL 5GZOC 4R9HA 1U8PA 2EYSB 4GRLB 1RUAL 4FZ8L 4ZFQA 1SBBA 4RX4D 3GNMH 2VDRB 1VERA 3LB6C 1NCDL 3B9KC 3LZFH 2VYRE 4JJ5A 2Q86B 4M7JH 2CKBL 1NCAH 4UUJB 1BREA 1CG9B 2QV2A 5HI4C 5AAWC 5TF1H 3OSMA 1Q94A 4LDLB 3MNZB 1AHMA 2DLHA 4Q6IB 3D0AA 4G1MA 1WT5C 1TR7A 1OGAD 2H6UA 4ZW5A 1J9TA 1YDPB 5BW7A 2DV6A 1FO0H 5FKPA 4QT5B 1TFHA 3QULA 3R0NA 4HAGA 3GD1C 3H2WA 3KL3A 1LO2L 2NY4B 5CU5A 5JR1L 4P5KA 1MJ7H 1D5BA 1NWPA 3R1GL 5PCYA 1NCIA 4FLQA 5FXCH 4AEEA 4JRXA 3QZWG 1IQDB 4F8PA 4DKDC 1ZLUK 1K8IB 2RTTA 3FAWA 5IQLA 3FYEB 4X6CE 2FKMX 3MKGA 2NSMA 1NGYA 3VXRD 1UG9A 5EU6D 3WKYA 1XH0A 3L4XA 1FZMA 2E74C 4XOCA 3ATFA 3M6DA 5C0NC 5EO9A 5K9KA 5F6IC 5HDOA 3T0WA 4JGUA 4OIFA 4YZFF 3REWA 1QR1B 5CXPA 1F4XH 4O5LH 5CLWA 2CRYA 4MXWH 3RU8L 1QBBA 4PP2B 2A6DA 4KHXL 3MBWB 5TTRA 2HTKD 1BQLL 1OOWA 3LEYH 1S7RA 5EU3A 5KN5A 3VG9B 1S4IA 1ZEAH 5BS0E 4HH9A 3VI3F 1EANA 2AI0H 3QJQB 4G6KL 1RJCA 5LN4A 2ITCB 2XZCL 5C08D 3AU1B 4EI5B 4XPBH 4JM4H 5D4IA 4LVHC 3LRKA 1DLFL 1MCHA 4L37B 3S6CA 5DHVH 1KELH 3M8OH 3VD1A 3GBLA 4PG2C 5C86A 1DVUA 2KQNA 5SX4I 2FJGA 3H7BA 1MLCB 4PI2A 4JCMA 1JP5A 2JB6A 2P43B 1OALA 4EBQH 3WEXB 5IOKA 1NFDB 4P2RE 4BFGA 1JGEB 4F7PB 4Y2OB 3GUTB 4L8DA 2OMUA 2IFFH 5E9DA 3NAAL 5I17B 2E9WA 1Q9KA 3PAVA 3RWEA 3D51A 3HPJA 3QFJB 2NNCA 4Y2DB 1T1WA 3N43B 2ARJA 4TSAL 4RWYH 3FH7A 4TLSA 2I9TB 4FDWA 4HLJA 1INEL 4M6OL 3S5LB 5CM1A 3RY4A 4D8OA 4I18B 5IMOB 2OMTB 1YA5A 4S0TD 2HKPA 3NJVA 2MCG1 4BM7A 5AD0B 5DS8A 5ANMB 1LTXA 4TVPE 1R3HA 4NB7A 5AAWA 2P7TA 2KPWA 3A67H 3ETTA 5FK9B 1RJLB 2VERA 1CL7I 2O5YH 1WHPA 2AJVH 4QRRD 2HKAA 1XDTT 2I7OA 4PREA 32C2A 1WT5A 4UV7L 2WOBA 3WFHA 1I3GL 5JHDB 1V7NH 1AXTH 3RGVB 4XR8C 1ILSA 2TAAA 3I3WA 2GTZA 4ZFOA 5E99H 4ZX6A 4YBLC 3T71A 1JHTA 2IGTA 3HE6D 4N1EA 1AZUA 2NCMA 1A1NA 4X6CF 4DP1X 3LPOA 4KRPC 4PLKD 3GMPB 2CBPA 5HYSG 3FOLB 4DEUA 5K1JA 4HKJA 4WUKH 5I1JL 1U8QA 4M03A 3T0EB 1KT2A 5SWZA 4CGTA 3WS6C 4IKIA 4LP4A 4CMHC 1V05A 1YEDA 2QZQA 4LAQL 2J8UE 4PRHE 2E6PA 1IM9A 3BAWA 4RA3A 5IVZB 4YHZL 2BW5A 2HLFD 2NR6C 3LEXB 4GKOA 4NPJA 3AUWB 4ZOBA 3BSGA 4LVOB 5HGAB 1SJXA 5IW1B 2QSCH 3OKEB 1NIBA 2WNWA 2NOHA 5I30L 5IGXH 4PN6A 5I6PA 1NAML 2P24B 2YD3A 4Z7NB 3EJYC 3LRGA 4L0PB 3G6AA 3DX9B 4P59H 1JPST 2X70B 1TTFA 2CHZA 2EO1A 1PD6A 1DE4A 1YEEL 3L2LA 5SX5K 2FIRT 5T1KB 4PG2A 2AXFA 1KN2H 3LRSB 3I0WA 3K72A 2F54A 4N2OA 3BSZH 3DVGB 2B1AL 5E4EC 4JGMA 4U7MA 5FYLD 1SMAA 3VXOB 3WO3B 3ARFC 1LXTA 2WSPA 4NUQA 3FONA 3VYPA 1P6AB 2YXMA 3D85A 3CWTA 1UFUA 1FNEB 4OJEH 4AVIA 2OTPA 3IMBA 4U6XB 1T1ZB 2GB2A 2OR8A 3PNWA 2W95A 3RTLA 1KPUB 3JTBA 3TA3B 1NKGA 1USQA 2I7SA 3EFDL 1IGIH 3HTLX 3D9AH 4NJ9H 2QVFB 4V33A 5L2KD 3CV5A 4PBDA 5E2WH 4U3SB 2Y9RT 2FUVA 4LO9A 1BZDA 1OD7A 3H3PH 2J88H 3DXAB 5I6XC 3RIKA 1JV5B 3CE1A 3W5NA 1NLDH 2P47B 3KPLA 2E8YA 2WQUA 2EXYD 4JZOA 3ULVD 2A74C 1DUYA 4QCIB 1MI5D 4EI6B 4NGHH 1Y1UA 1KJ2A 1RIUL 3RGBA 5DVLA 2VR8A 2NMSA 5F88B 2CR6A 3FS9A 3OKMB 3RWHA 4GEJA 4K3GA 2CRZA 4QXGH 4UDUA 4F27A 5ALBL 1SF3A 2ENYA 1HZHH 4ALAH 3ARZA 4OLYL 3H4HA 4LP8A 3WJMB 1HHHB 2JKSA 2WM0A 3FFDB 2LW3A 5AVRB 4G8GB 1ITCA 4HCFA 1TENA 4QKTA 3CX2A 4NOBA 1DSWA 4Q0XL 3U0TB 4OKVA 1HCFX 2VJ0A 3A4EA 3H53A 5GGVL 5TK4A 1NFDE 3K91A 2J8UF 1VZGA 2HL8A 1HQ4B 5I19L 5E7FA 4EAGA 1D2OA 3DX1A 3ARDC 3LIZA 3T2LA 3ZDWA 1BSIA 2WO4A 4LGRB 4UTBL 2YQGA 3VQLA 1DFBL 1MY5A 4XNDA 1U91B 3PHOB 3TEYA 4EN3C 1KG0A 2WKGA 3NRQA 4PJEA 2XETA 1S5IH 3FDWA 5IV2B 2H26B 5JQIB 4FI8A 3QIWD 4M00A 4WX8A 4YDMA 1SEQL 1K72A 3TPUA 1MCKA 3DECA 4LHQB 1XIWD 3RDJA 3UDWC 1ZE3C 3O3EA 1S7VA 5ANME 2NZ1A 1ZT4B 1OTSD 5DRXA 5FWQA 1VSCA 3B3IB 4PGCB 4PRAA 4XNMB 4M7LH 2IQ9L 1JNHB 2VDPL 2VR4A 3BWUC 4KY1L 4NOFA 5F8RC 5JHDE 1EUTA 1LD9B 4DHLA 3HN5A 4F3FA 4GXVH 2YLHA 3ARFA 3N44B 4MNQB 4XPTH 4CSPA 1BMGA 5KYUA 2NLJA 3QORC 4HLZG 4EUPH 3SKJL 2QLVB 3PDKA 1XSIA 3V0VA 5AB2A 4UT7H 3DIFA 1E42A 3BW9B 4FKHA 5D1QD 5HJ3B 1WHOA 2DQJH 5I8EB 1NGWA 3OH9A 2RA1A 1DVFD 4JRYD 4U7SA 2LT9A 2Y36H 1M1XA 4HSAC 2ORBL 3T04D 3QQ3A 2Q3XA 3T0EE 1M71B 4X7CC 5GRZA 3BYYA 4IOIB 4N2DA 5F9OH 3FN3A 2IOOA 4ONGL 3VTTA 4JY4A 4Y1TA 5F7KC 1FCCA 4GT7A 4MXQD 4NBYB 4FQ2H 2ZFDB 5IJVB 4XGZA 3UADA 4HX1A 2YD5A 3KS0J 2P5EA 4QWWD 2VN5A 3CSTA 4LF3B 5DJ0A 1ZANH 4ETYA 3DBXB 4LEOB 4YSOA 3QZNA 1IAOB 4R26H 1JFIC 5JW4R 5EOQL 2WNGA 4Z7NE 3AS1A 3T4YA 4NUJB 3BISA 1MDTA 3MRFA 25C8H 4R83A 4AQAB 4I7ZC 3CUPA 4IBYA 3WHXA 2GBUA 2A77H 4GG6B 1T7YA 4PWKA 1VFMA 1N0LB 3KLSA 5T33L 1FYTD 5FO9B 2IAND 2OL3L 4LPTA 3STZA 1NFDF 1OPOA 3ZUCA 4P46B 4LNRB 5AVVB 2VLJA 3ABKB 1R5WB 3CZJA 2DJ4A 3QR2A 4JZJB 4AV0A 4LAJH 4F8QA 1HINL 2OW7A 3S36H 1QPXA 5J9PA 3MRNB 5I15H 1HEZA 5DC4B 2HPTA 3ILQC 3ARDA 2LFEA 3FQWB 2HRPH 3VCLB 4I0PC 4WAFA 3TBVA 3VB9A 5EEVA 1C5BH 1QG3A 5MP6L 2QKIB 4ABQA 4G6AC 2JKLA 2N4IA 4MQXC 3FBKA 4PRIB 3S5ZA 3AROA 1L6ZA 1KN4L 1UT2A 3TS8A 4J23A 2VLLA 3RNKB 3RJQB 3UDWA 1NFIA 3DXAE 4XNZC 2HZMA 1LXMA 4GQ9L 1URZA 5DJXA 2N1TE 3T0XA 4UIMA 1Z1WA 1KEGH 1K6QL 4OZ4A 4MA8H 4U1JA 5E8OB 4HGWB 3V5DA 4OZIE 1J1OL 3BE1H 3U79A 1AQKH 4NO5A 4I1NB 4LSUL 3K74B 2CIKB 5J13B 3S5YA 4L8SB 1NMCB 2W9EL 4JANB 2ZYRA 1SNRA 3I84A 1J0IA 4PWFA 4K94C 2G60L 1Q1JH 4MNGE 2XN9B 1PDKA 1JGLH 3VACA 2X6CA 5LXGL 2PYEB 1A4BA 1AR2A 1XWVA 4UB0L 1S9KC 5HVHB 1BPLB 1N4XL 3U1QA 3HC4H 5GGUB 1IBGL 1ND0A 5I76A 1E8ZA 3LQAH 4OF6A 2VWEC 4E2OA 4RCAA 4ATWA 5B8CB 2OI9C 3MRGA 5HYQA 1U8IA 4N8VB 1MZZA 3UFIA 1HDMB 1MWAB 1RXLA 1SFHA 1UC6A 2Y5TA 1EMTH 1P69B 1KXVC 2L3BA 2DICA 3GXDA 4ZMPA 1NC4A 5KSAC 5F70A 2P8MA 1HS6A 4E42B 4Z7NF 4NAJA 3G5ZB 3NJLA 1U8KA 1ZJAA 3BAKA 4ZUTA 2WVUA 1PLCA 4H88H 1RUPL 2AEPH 2BVQB 3HVDA 4L2LA 2AZAA 2FZ3A 1TZGH 5GRWA 1DQLH 3TV3H 3FO1B 2HCZX 4BJUA 4HJJL 4B96A 1MRDH 1S5HB 1D6VL 3HMXH 3I2CH 3FB7B 3KWUA 1A4KB 1GZHC 4D9QD 5C9KA 3TESA 3U4EB 2XWTB 1GGCL 4IU2B 3E6HA 2NY6C 3CDZB 3HBGA 3U9UA 3OJMB 4B7LA 2Z0BA 2ZSWA 4MNQE 3LPWA 4FQXA 4RMWA 4CAGA 2X7LA 1WZ1L 2BNQE 4LSVH 2IH1B 3LNGA 3ZQ9A 3IB4A 3IGAB 4RMUA 4PG9A 1Q9WA 2IAMD 3FFCE 2H2PD 3HZ3A 4I0PA 4TKWA 4TNFA 4B0MB 5T3XE 1ZWIB 2WSDA 1GSMA 5L0QB 3OAZK 3A4FA 1VOLB 5D7IA 5KYYA 5DC2A 2FVNA 1IV8A 2VQUA 5D2LE 1AO7D 5L4IA 3K71A 2ZCKL 3GGWA 1NIAA 2NY2C 1B2WL 1HHIA 5EC1A 4NRZA 5ECGA 4OZIF 4N6QA 1OT2A 1I1YB 1LNUA 3N89A 5I73B 4NJAH 2UY6A 3MZTA 4YEFA 2JPIA 4PJAE 3FJTA 4GP8B 2R59A 2X9YA 1JE6A 5J6SA 1OQXA 1ONQB 3I6GA 4Z77A 4HIXH 3SQRA 3HZMA 4ZTOH 1BD2D 1S7XB 1ZK5A 5H94B 2P26A 2BIOA 2W9DH 4PJDA 5LNEA 1V3KA 4OLWH 1KDIA 4TF4A 4ZYKB 4E68A 3CFEA 3ENOC 3EYOA 4PJ9B 4UZSA 3VM7A 4G42B 3LPPA 1OSYA 3I9AA 2F5BH 2VDQH 5I26A 1KWKA 1M3HA 3ZDYF 1BEYH 3FZUC 4JLRB 4C4KT 1GA2A 1K8DB 3GMOA 1HC1A 4ZMQA 3F7KA 1CIDA 4GFTB 1BWMA 5DA4A 4OFYD 3WIHH 1MRFL 2G2RB 3FT2A 3TWCH 2UYLB 1K2YX 5C0AE 2DQUL 2LTQB 4OI7A 4NWUH 3RX5A 2FX7L 2H0EA 4UYPA 4ZNEE 5KSAA 1QSFD 1C7TA 3D4ZA 2RB8A 4OFIA 3A24A 4CKQA 3FB6A 1SXBA 2EIEA 3LJ3A 4B9JA 1PZ3A 1ZDQA 2MPAH 3GB7B 2VUYA 3G5XA 3NCJL 3F3HA 3M17B 1LO3L 4PLJC 5F0LB 3CLFH 3EGDB 4B53A 5CLTA 4ZUUB 1EX0A 1HNFA 2WLMA 15C8H 1JG9A 1NKRA 5ISZE 1FV1B 3F7PC 5DRWB 1P5UC 3QDHA 2AQNA 3GHBL 4EAKA 4BFIB 4M43L 4XMTA 1MXGA 1UM5H 4NN5C 5BZDA 2XN9E 1SM3H 3AMLA 3IDGA 4X83A 2GUYA 3L4WA 3CVHA 4RZCA 3MOAH 3D50A 4HIEB 4BGLA 1OTTD 1CTMA 3G7TA 5KVGH 1D3CA 5D2LF 4U0RB 4O4YL 4XVJH 1Z3GH 3B37A 5E0QA 1XD0A 4WSKA 1X5LA 3V6BR 1G6VK 3GKZA 3ZTEA 4LEXH 4NHUA 3GTNA 2EC9T 3CFQA 5HI5C 1IIIA 4Q89A 1SN5A 1UKTA 3HG1B 5MHSE 4PJAF 4N2GA 4GSUA 5CN1A 3U7YH 1JZ2A 4L4VA 4X6DB 4X5LA 1ZVYA 2PTTA 4JBSA 1BLNA 3T1FA 5JA9A 1QOKA 4N0YL 3GBNL 4APXB 4DH2A 3GS4A 5DLMH 1LWRA 4AQEB 4I3SH 2COQA 2X1OA 4KFMA 4QDGA 3BVWA 4ISVA 4AQ8A 4POZD 1I9IH 2FJSA 2H5UA 1A7OL 1MFAH 1LWYA 4MQ7A 5AUMA 5CBEB 3MA7A 1RUAH 1BYPA 2DMGA 1EIBA 4F7TB 1PYWA 4L4TB 3TO4B 4ODSL 5IEKA 4B9PA 1S6NA 1NCDH 1JPSL 1OAKL 5JA8B 1W0YT 4Y7MA 2CKBH 4GP4B 4JHAH 2DEXX 5GS2D 4LHUD 1UACL 4P3CL 4PJGB 2FLMA 3AXLB 3IDJB 3WNMA 1GR7A 3SDYL 2V2WA 4Q6YA 5IESL 3US0A 4LCIH 4ZFZB 1E28A 4NQEA 4F9PA 4ONOA 2ZWSA 3SNSA 1CFNB 5HP5A 4BEIA 3OZLA 1R34A 5JR1H 4O2CA 1A7BA 1U4FA 3CN4A 3R1GH 5EOTB 1AY1H 3AJ7A 3I75B 1S9VB 5KVFE 4BH7B 1N3NB 1LEGB 4FG6C 3VGEA 5CAYB 2B14A 4XRCB 1I1AA 4BKLB 1P5UA 3L16A 4U1KA 4APQB 2VSCA 3S96B 1C08A 5B39G 2RACA 4IJ3C 3BT2L 5AW0B 1EBAA 1HVXA 3D39A 5HVGB 3RU8H 4IRSC 4Y1AD 1U33A 2BXYA 4KHXH 4H5SA 4ZODA 5TE4L 5KTEL 3HAEA 4NQVB 1BQLH 5DO2C 1NC2B 2IVFC 3MCLL 3LCYA 5KWYC 3GJFK 4FJZA 2OZ4L 4OFQA 3MO1A 3B5TA 1UZ8B 3TV8A 2K7QA 2VDKL 3DYMA 4G6KH 1UZ6E 3ARYA 4IEFB 4JE0A 2XZCH 4O02A 4GRWE 3RSMA 4H20H 4ZAKD 4AK2A 5A2JH 2YA2A 4AK1A 4YSEA 5AVZB 1SDDA 4Y4FC 2HTLC 2KYIA 2YN5A 5KL0A 3UPAA 4OZHB 1VFOA 3U1PA 1YTBA 1XBDA 2FJFB 3TYGL 2OMWB 3RTQC 4JCWA 3MLTA 3H85A 1PNDA 2V7HB 1P1ZA 4U1LA 1KPRA 1MHHA 1Q0XL 2A99A 2CRMA 2IIJA 3T77A 3ETBF 2WZ0A 1A5FL 3I9PA 2UZYA 3CGTA 3ZKND 3JWDC 3NAAH 1U8JB 4K07A 4PJ7A 1OZUA 2HB0A 3D18A 2VQTA 4MZ3A 3CZFA 4E5XA 4LASH 2WO2B 4D9RD 4YSSA 3VXRB 3OQ3B 3RWJA 5EU6B 3FF7A 3PCYA 2I60L 3CFDB 4FQHA 2X53A 1E7VA 1INEH 3LEVH 4M6OH 5G5DA 3VRIA 2R2EA 4KDTA 1F18A 4PJFB 2VRAA 1OM3L 4N2EA 3CVBA 3FRPB 3ZPDA 3GSRB 4ZUSA 3QXDB 2CUMA 5KSBA 4LQFH 2VXTL 4IM8A 4XP6L 4Z3GA 2AJXL 4GW5A 2ZUQB 4N9GA 2P49B 2X10A 3UBGA 4G5ZH 3VXTA 3NP3A 2LQRA 1MCWW 3ULXA 5GSVB 2HFGL 2VXQH 4XNYL 5C08B 3WHE0 3WELA 2CJTA 1Y18B 4HC1H 1OSEA 4FNLL 2IBBA 3UTTD 2W81C 4B60A 4OT1H 4OD2A 1KYOJ 5HHVL 1IT9L 1VAHA 3V5HB 4DPCX 1XZWA 1T66D 4MNHA 3U6RB 1WAPA 3S36X 2BP8B 4W9KC 4AZUA 4DJMA 4DCQA 3WLWC 4WWPA 3GJFA 3W39A 2NYYC 4I9WE 1G7JB 3SYPA 1PU0A 5I1JH 5I1GL 1UB5B 4U4BA 4NDMA 4OCXL 3U9PL 4LAQH 3BUYB 2C9RA 2YUZA 4A66A 4YHOL 3EAYA 1VFBA 1ZLWK 4WWOA 4ZS7L 2AVGA 4FEMA 4IRSA 1ID5I 4X5QA 3VWJB 1UZ6F 4AIZA 4KK9C 2HUEA 3IDUA 4L4TE 4GRWF 5DWUL 5ERWA 5I30H 1NAMH 4WEBL 2K6WA 1I7UA 2NY0C 4KAQL 3B7UX 3LKSA 5ID1B 1BIIB 3N42B 4QRRB 1ASOA 1JD7A 1HOEA 3HPLA 5A3IC 5GS0C 1JZFA 5MENA 2FWOA 3CAFA 1KLUB 3VD2A 4PJGE 4Y4FA 1YEEH 4NNXB 5DTFA 3ZMRA 4BZ1H 4JY5L 2YD8A 4B3EA 2CWRA 2IJ0C 4NWTL 3ILPB 3HE6B 5DZNA 4B9FA 3VFTB 2A4EA 4G8AC 4FFZA 2UV3A 4BINA 1XBRA 1EJOH 2MNJB 1E9OA 5I28A 5IHLB 3ESOA 3JV4A 2LU4A 4PV8B 5B4MC 4YHPB 5HHPA 3VFMA 3QO1A 2ZCLH 5LBSA 2XBZA 5IB3B 1DSYA 4Q56A 4L3FA 3MA9H 1P4LB 2XZQL 5DI8A 3BXNB 2ZJSL 4L1SA 3B2UD 2A0LD 3SDAC 3AG1B 4DN4H 3UP1A 3C60D 3X14B 3HCVB 4M1GL 2YO3A 3EYVA 1PX4A 3GXTA 2WIMA 1NCHA 1Z5YD 3FQNA 1J5HA 4PI0A 1QA9A 4KKBC 3B6SA 4AW4A 3VU2A 3OG4B 5ID0B 4FQLL 3U2SA 2JJUA 1RIUH 3ILEA 1MY7A 4J3WA 2J56A 4O2FB 2F8XC 4J3VA 4G8IA 4L9DA 4P2QE 4NZRL 4Z9KB 1LJMA 1W15A 4KK5D 3SCMD 4DP4X 4RMBA 3O2WH 2SEBA 2IDUA 4HWEL 4OJFL 3VU1A 4ICWA