1KY7A

The ap-2 clathrin adaptor alpha-appendage in complex with amphiphysin fxdxf
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
247
structure length
247
Chain Sequence
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLNFTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTFQNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLCELLSEQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords ALPHA-ADAPTIN C
publication title Accessory protein recruitment motifs in clathrin-mediated endocytosis.
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2002-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02296 Alpha_adaptin_C Alpha adaptin AP2, C-terminal domain
A PF02883 Alpha_adaptinC2 Adaptin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1ky7A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ky7A02
1B9KA 1QN8A 2E9GA 1QN6A 3ASMA 1QN3A 1OM9A 2A7BA 1P4UA 3OCIA 2D0BA 1W80A 1E42A 1QN5A 1TBAB 3VN5A 2G30A 2Z8UA 5CN1A 3OC3C 4B0AA 1NGMA 3ZHFA 3MNMA 2IV8A 1KYFA 1VTLE 1C9BB 4BCXA 1NVPA 1QTPA 1RM1A 2IV9A 1QNAA 3EIKA 1AISA 4PY5A 2D0AA 1PCZA 5IYBP 1QNCA 1JFIC 1NA8A 1KY6A 2MJ7A 5IYDP 3H1ZA 1TGHA 1KYDA 1VOKA 1GYVA 1KYUA 1IU1A 1R4XA 5IYCP 4ROEB 1D3UA 1QN4A 1MP9A 3ZY7A 1CDWA 3HS9A 2YMTA 1NH2A 1TBPA 1QNEA 4RODB 2VJ0A 5CN2A 1KY7A 1QNBA 3HS8A 1YTBA 2DWXA 1PZDA 4WZSD 1GYUA 1VOLB 4ROCB 1YTFA 1QN9A 1QN7A 1GYWA 1QTSA 2D0CA 1VTOA 2DWYA
chains in the Genus database with same CATH superfamily
5I8EA 1L9OA 4N8CH 2YQ2A 5MP6H 3B83A 3I50L 3BLKA 5LGHH 1ZCRA 4KZDH 1F02I 3RI5F 1UM5H 1NGWA 1SHMA 5DZVA 3WKYA 1AZBA 4KJYA 1LJMA 4ODBD 2R1YB 4G42A 5B3JE 4V1DE 2QPFA 1UOVA 2OJZL 1TYEB 2X0UA 4GQQA 1DSFH 2WK2A 4R97B 2ZSWA 1JXDA 2K8QA 1XBRA 3T2OA 4Y0GA 3CDGA 1DUYB 4MS6A 3NUKA 1MJ7H 3QHZH 5C07E 4IIQA 2BVQB 4WWKC 4FA6A 5I0VA 3ZDXB 2MOGA 1A1NA 2W9DH 3EH4B 1D2PA 3A67L 5KS9A 3QBTB 1RSYA 3WNJA 3ULUL 3FOLB 2PR4L 5ID1B 1E2WA 1OW0A 1QUNA 5F7EL 2NY2D 4OZGF 2BW4A 1D5RA 4GAAA 3BX7C 4PBDA 4O02B 3TLRA 1OIOA 2DJUA 2CPCA 2PTUA 3O9WA 3NSFA 1J8KA 4LKCA 4OVVA 4PJBB 5FM8A 3M1CA 1PQZB 4K5NA 2BP0B 2J2ZB 2WLHA 2EYSA 2AQ3A 4TOYL 1AY1L 3RIAF 4NQCB 2VOTA 3UZEA 4KU1A 3FJTA 4LOFA 4W9DC 3WN6A 1JS4A 1JV5A 3KPQA 3LV3B 4LLYB 2F53B 2YK1L 1FNSL 5DUBA 2A73B 4ZYKB 2XQBL 3KVDD 2JCWA 4J3OD 4BWUA 1XF5A 4XN5A 1RIVH 4YNYB 5EO9A 2W0FA 5D7LE 2E6JA 2Z31B 3ULVH 1E27A 1R4XA 4ROEB 1HXYA 2VLJD 3MRKA 2IAND 2Z8SA 4LPXA 5E5MA 5I66B 1F1AA 3BJLA 2Z93B 5D96C 2EVJA 4LPVA 5B1KA 4YHYB 4HWBH 4Y4HD 5DUPH 1GY2A 5KVFH 5CGYC 3VXNB 3EAYA 5DRNB 1MAKA 4QXTA 5CSGA 3WFDL 2BCKB 3DO7A 1JF6A 2E75C 3VFTB 2E9BA 4H26B 4CW1B 1E3ZA 1CK0H 4AVIA 1W72H 4UAOB 1HHIB 2I9LB 3HZMB 3IDMB 4KDTC 1GGIH 5DVPA 3UIZA 2NNXA 4B0MM 4MRBA 3VXRD 2W65A 5F7DA 5IB3B 1AKJA 1AHWC 1TZIA 3S2CA 5KTEL 1LWHA 3UTPD 2PTTA 3M7OA 4IEFB 3ZVVA 4RAVA 1BXUA 2IPUG 2C1OB 4GO6B 2YPVL 3FONA 1H8NA 2BNQA 3QEHB 2AAVA 2V33A 4WHYG 1LM8V 3VI4A 4QYAA 1D6VL 3OF6A 1TLMA 3KL0A 1N64L 2DQIH 2OXHA 2WXMA 1NMBL 3QISA 2XPGB 1QI4A 1ZA3A 2YGPA 4XMWA 3GHPA 2XJKA 1LEIB 1MFAL 4QHKI 1BVKA 4X99B 5EUOB 4Z7OF 3TN0C 5J13C 5F7WC 3JBG7 2QVTA 3L45A 3Q8EA 1DDTA 2VM4A 5JXEA 1N3AA 3H7BA 2F58H 2W0LA 4F7EB 1L0XA 1U8PA 3GMRA 1JF1A 3S88H 5DHVB 4N3UA 5DWUL 3IJYB 3AMLA 3MV7D 5GZOA 3D09A 4U3SB 5F9WB 1DQJB 4OGZA 5SWZB 4WDIB 3LDBC 4EIBA 5ANME 1GC1C 3IFLH 1VENA 1S7VB 4GKZA 1UACL 2GT9B 4L8CA 1PL3A 5AOIA 1K6QL 5MEOB 4QHKJ 3EXJA 2ARJQ 2DEXX 4NRXA 5F21B 3GMMA 3OKEB 3FN9A 5DJZB 4PJGA 3FT3B 1BVLB 3VD5A 4RVBA 2ZG2A 1RPUA 2K6YA 2EZ0C 5JA9A 4JANB 1J8HD 3DX9B 1FL5B 4JG5A 1KOAA 1P7QD 3MN8A 4PJ9A 4WHYH 1KCUH 3TA3B 2XVKA 3BWAB 4FNTA 4RFNB 5FYJH 5IFAH 1U8KA 1E4XH 4FI8A 4GNKB 3RX7A 4FLSA 1OHZA 3FW6A 1KJMB 3CVSA 3SGJC 3FYIB 2MRYA 4M5TA 1T04B 3RFZB 3IGKA 3NJXA 1GS8A 1V54B 1TCRB 4XPAH 4XT1C 5HHOA 1FC2D 4OQ1A 3WUZA 1YYML 3NCCB 4OJYA 4OFIA 5IY5B 3KM2A 3POHA 3BVTA 4BWWA 4MXWH 2JSFA 1K8DA 1T0PB 3ABLB 3X14B 4NKIH 5LQBL 4RNRA 2A6KA 3NA5A 1OE2A 3QPXH 1W0VB 3BKQX 3TBVA 2VQ1A 2R1WA 3SNSA 5E6IC 1X7TA 4N86A 3T8VA 1LEKA 2CO7A 4M61A 3JXAA 3OX8B 3RWHA 2XX0A 1DO5A 4JFOA 2DI8A 1XCXA 4YXLH 3WFBL 1M6UA 5SWSA 3GBNH 3NP4A 1AGCB 3E7JA 5IK3A 1HQ4A 1JNLH 3F7LA 2G9HB 3AG3B 3FHAA 1YMME 2FWOA 5T1LB 3SPCA 3UW2A 4S11A 1FGVL 5KBPA 3EDEA 1NBZA 2R0ZL 4NLAA 2EDDA 5F96L 3J27A 4R4BA 3VFRA 4C4KO 1OSZA 5IFJB 3QG6B 1KACB 2HJFA 2Z35A 3PGDB 4G6JH 3GM0A 3SGEI 1KN4H 4HS8H 4TSCL 3HBGA 4I3SL 5EU4B 5A7BA 4TN9A 1I8UA 3OKYA 5EIIB 1AQKL 3GLDA 4J4PC 4A55A 4FCHA 2AITA 4YFLI 4JQVC 1ADQH 1OCWL 5GZND 1Y1DA 4DEPC 1OD9A 4ALAH 2IQAB 3KLAA 4L4TD 1UJ3B 4BFKA 4OF3A 4NRZB 4MQTB 1QKZH 5TFSH 2DQMA 3BDBA 4QGTA 3B9KB 4PJ7B 2NSQA 4BFIB 4FFZL 3IKCA 5IMMA 1E42A 5JPMB 4FTVA 2IOIA 1N5AB 5FYKL 4LSQL 3V6ZA 3LYRA 4Q9RH 5DSCA 4TSAH 1KELH 2KL6A 3MA7B 3HI1A 2JCCE 4PUBL 5LKNA 5T1MB 3H7LA 4XGZA 3MRCA 3CFKB 3BYYA 1FGNH 4IBSA 1HXMA 1NIEA 1X6NA 4J8RA 1S9WB 1MI5A 4ZUTA 2GJJA 1Q9KA 2EEBA 3HUJF 3A6BH 4UTAL 5FYLE 3NOIA 4JFXB 3LS5H 4M00A 2FYYA 4XCYB 2YOCA 3MGAA 3WS3B 3HNSL 2FRGP 2EEFA 3OBAA 5DJ0A 3AC0A 5LN4A 1NFDF 3QPKA 4Y88A 3MA9H 1FFPA 2ZUWA 1MLCA 4FQJL 4BJLA 1DBMH 3CZNA 4N20A 3BEVB 1T5KA 4FKHA 3W38A 1MFDL 2YFOA 4R3SA 2EVHA 4PY5A 4N90E 1WAPA 2FX9L 1MNUL 2LHAA 2VDOH 2KZBA 4OLWL 4R26H 3ZYJA 5D4QA 1KO9A 1A0QL 1X5JA 4X50A 3I0XA 1T1XA 3BD3A 5DJ2A 5F93C 3LEYH 4QRRE 1CDIA 4JDTL 4N2NA 3OAUH 2NY7H 3RDTC 2HTKD 5TQ0H 3S34H 2CDFA 1V3LA 5HHQA 5HYJA 1OGTB 1CGUA 3QEQE 4X7SH 3L9EA 3LQMA 3BSZL 1FNEA 3MU3A 5F7AA 3AT0A 3RWEA 2NY4D 1KFAL 2WN2A 3QCVH 3SKUD 4BA0A 5IR1B 4LVNB 5GGUB 1M2VB 5IFHH 2J8UA 4W9ZA 3DXAA 3MYZA 1KCLA 2WTRA 3HHMA 4L9LC 2P28B 1B0RB 1JSYA 4ENZA 4EUPG 1OWRM 1F97A 3CGTA 4I9WE 3LAFA 4DF9A 1EO8L 1KULA 2JV6A 3EFDH 3WNIA 3VGEA 4KHXH 2CUHA 2OAAA 3MBWB 4HMCA 5GGQH 4C8XA 2HB0A 3IM1A 3ZX1A 4I0KA 4NBYB 3SKNB 3SJVA 2H47C 2NNAB 4NRYA 3MXWL 2FQDA 5L0QC 1A4CA 5KYWA 2A9NL 1GR7A 3IE9A 5DD1H 4P3DA 4K3HA 1YMHB 3ROLA 2E4TA 2PO6D 4H0GA 3CPUA 4NWUL 4OZIE 4MAYD 2KQNA 4X8CA 1UH3A 3D39B 1E8XA 1W8EA 1CD0A 4RSYA 4UT6H 4IYKA 3VGFA 1IAII 1N4XL 1R5IA 1QN9A 2AKRA 1XB8A 1J5DA 5C6TH 1QSFA 1S7WB 2IVFC 1BWMA 3QIWD 5D5MF 3LRSB 4QRPE 4H40A 2V9JA 3QJXA 3TEWA 3UJJH 4LEXH 5D7JA 3N43B 4F8NA 1X4XA 4C59B 4UM9B 3D4GA 3I6LD 1T1WB 5FGRA 5CHNB 2Z8RA 5IJCC 1CFSA 4L3CA 2JJSC 5E4EB 2R2CA 1JGDA 4N0UB 1MCPH 1I75A 5HGDB 4PREA 1BGXH 4HFWB 4WFFE 4GUQA 3R7QA 1BVNT 2WUCL 4WGVB 4HF5H 2H3NB 2YAHA 1F1DA 4IRJD 4OB5L 5AOJA 2Z34A 5AOLA 3CX5J 5GS3A 3G08B 1H3GA 2OXGB 2RBLA 3UPRB 3IMTA 3VA2C 3VFSB 4M3KB 3U9WA 2QV4A 3BAIA 4LSRL 2D31A 2WCPA 1QRNE 5DO8A 1AQDB 1YY8B 3CFBA 1JMXA 3C8DA 2H0EA 3QZWG 1UQSB 5DGRA 5BV7L 2CSPA 4JY5L 4KAQH 1DQVA 1S7RA 2GTWA 1NMCB 5F3BB 5IW1A 4IIQC 3TIDB 1KN2H 1T83A 1WEJL 3IB4A 3CN2A 3L1FA 2C3VA 4G80B 3KL3A 2ARWA 3B5GA 3KL5A 5D1XB 5IBLD 2XI9A 1J11A 3BFQG 4M62H 3KGSA 3IAQA 4Y2OB 1D9KA 4Y4KD 1A7OH 1OW0C 1BPLB 1M9SA 4OJFH 2DEYX 5HYQA 2QVFB 1PD6A 4FLHA 1CICD 2EO9A 3HNTH 3OJMB 4UM8A 1SY6H 4JFHE 1YHPA 3NZHH 4Y5YB 1WICA 3F7PC 3IDNA 3UTTD 3T2NH 3V4VB 4NO0D 3S35L 2VL5B 3EOTL 3N40P 4LCWE 4AJ0A 4AIZB 5I1GL 4MCMA 4GUPB 1UM6L 1PMYA 1ACYL 4M8QA 3UZEC 5FO7B 2PCPB 5FO9B 3T3MF 1MF2L 1HILB 2CCWA 4G8IA 1KJ3L 4NZRL 3V52H 5ICYB 1FZMA 1ETA1 3CZFB 1LO5A 2NTFB 5TH2A 3PL6D 4JGMA 4A68A 1ZOXA 4HK3J 1XGYL 4NFBA 4BXVA 1E0OB 3L5JA 3TYGH 4JPWH 1AOZA 4X6DF 4DK6A 1F5WA 2G5BA 3W81A 4BH8A 2NNFA 3CTTA 4X6CB 4X8JA 1MHCA 5GRVL 3UH8A 4ZD3H 2MNJB 3DUSB 1FBIL 5AWNL 1Q9LB 1Z0MA 3KPNB 3PWNB 4TSBL 3RNQB 3GDBA 5ISZD 4P3WA 1UWXH 2IAAC 4TNGA 1H8OA 1OKEA 1KBKA 1U33A 1EX0A 3IS1X 4MAZA 2VM9A 2DWYA 2HRHA 4PJCA 3EOBA 4JRFA 4GRWB 2NZ1A 2FSDA 2MOVA 1T2QL 3KE0A 2VDQH 3LD8C 1R19A 3NGBC 2VZUA 1A6VL 3FRUB 1IGJB 5A16A 4WFHE 2HRPL 4GG6F 4QTIL 4OKDA 4D8PA 4JK0D 1FNLA 2DLHA 3F62A 2DAVA 1IBYA 3QQNA 4GKSB 5EMYA 2EIZA 3I85A 3D25B 2OPCA 1N19A 3DROB 2J88L 3WG7B 2AV1B 2VXSL 5JXEC 1BYPA 3FN0L 2X4NB 3SPJA 3PWPD 1QWNA 3RLSA 3U7AA 4CADA 3QDMD 2UY6B 1ZPLA 2X5PA 4NQVB 4P5TC 5I17A 1U3HD 2WLJA 4YHIB 3VE0A 5LNEA 4IBLT 5DS1A 1UVQB 2ATPB 4Z7UA 4LF3A 1KLFA 3QUKA 1ZTMA 1ZY9A 4QTHA 3L3IA 1YZZA 4ZXBB 4LLDB 1B0WA 1UA6H 4Y9GA 3FBQA 3T0ED 4OJEH 4HOWA 4IDLA 3EJCA 2XQYA 4DCQB 3CDCA 5DT1L 3T0VA 3T4AB 3F7VA 1YC8A 3ZKXC 4ELMA 3EJYD 3U7WL 1J1XL 1INDL 4JDVA 3GBML 3WGVB 5FCUL 5BOZG 1TQSA 3QA3A 4MNQE 4CSPA 3PWLB 3KYKL 1BA9A 3ZL1A 4FFVD 5EBMA 4M43H 1T80A 3BO8A 1OAXL 3NVQA 1GVIA 4MNHA 1TJGH 1U4FA 4PJ9C 1CGSL 1A3RL 4PTUA 2OYPA 1A6WL 2BZ7A 1TVBA 4PD4J 5JZ7D 5IYCP 3O2WH 5FHBH 1J1PH 5BZZA 1MW3A 2IWKA 2EXWC 3AJ7A 4U6XA 3RTQB 1KDJA 2X2HA 4HDIB 1IAIL 4GBXA 1C5DB 1C9SA 3RUGA 4DPRA 1V3MA 2ESVD 1XCTB 1XSIA 2EAEA 3MGTA 5PCYA 4H8PA 1KZQA 2EYRA 4FULA 5JDSB 4NNPH 5GISH 1XF3B 2UWEB 4FFWD 2CKBH 4TYUA 4NI6A 5FYLH 4AGLA 4POYA 5C0RL 5KVDE 5C86A 2J57A 1ND0A 4K8RD 4OH2A 2QADB 1NDTA 1P4BH 4ZAKB 5INCA 3EG9A 5ALCL 1SM3H 1BX2B 3V4LA 4PP2B 4PRIA 1KEGH 1HOCA 2FYVA 2I07B 2JKLA 1O75A 3BAEH 1F8TL 3LKPA 4Y9BA 3FQWB 4XNQA 5FS5A 2CHNA 4XBGA 4Z0BL 4FHJA 3VUAA 4RWYL 3FB5B 2IANB 1Z9OA 4AUYA 2CBTA 1KJVB 5I0WA 4HH9B 4TTDC 3TZVC 3MJ9H 2BNUA 2EDBA 4F7MB 4UI2A 5C08A 5CKGA 1BD2D 2DZEA 3ARTA 4Y4HB 1VAHA 4GKLA 4P2QE 1PLGH 1JGVH 4IHOB 1XSJA 3GHBH 4ZUSA 1WYJA 1HSBB 1D5MB 3EGDA 4JDEB 3RWFA 4DGVL 4X5QA 4E9LA 3VXRB 2EDHA 4A2HA 1FZKB 5FFGA 1XFPA 3KJ6L 3DOSB 1UJTA 2BNRA 3GBDA 3LH9A 2PWFA 3OXSB 4KBPA 4YDVB 1ZVNA 4LLVA 1BIHA 1E4WL 2IDFA 2R4RL 3FUDA 3TNNB 5JHLL 3MOAH 3T6WA 5F1IB 3VMNA 2F19H 2BMKB 2ZXEB 3NEOA 1S7SA 4U05A 1B0GB 4NZTH 4J3VA 5SV4A 1C9BB 3ARDD 4MYWB 4LU5H 2AJZB 3I3DA 2X70B 3NRFA 4XHJC 1QFOA 4ADJA 1F3JB 2Q76B 1H0DA 3BQUD 3VXOA 4BFOA 2CLZB 3UAJD 1HWGB 3GZKA 3GXDA 4N5UA 4GB9A 2Y8QA 5BMFL 2IEPA 3OZKA 3DVNB 1KG0A 1NEPA 1N5YH 4I1NB 1QFHA 3PCYA 3G6DL 3P0YL 1JRHH 3LNFA 5HYIA 1OB1B 1T3FB 1LTXA 3FCGA 3JVGA 3MV7B 3VXMB 1AIFA 3FN3A 5DD6A 3O6LL 3QRBA 4L3EB 1UZ8B 2AERT 3F3HA 3CLEL 4WVRA 2XWJA 1KPVB 4Y7OC 1RUKL 2R29H 3LN5A 4HJ0D 1BFTA 5TE7L 4UZGA 3BH8B 4HIIB 2FJGA 1M6OA 3FU5A 4FMVA 5CU9A 4WW1B 3AM8A 1MCNA 3ZHKA 5G4NA 2J1ZA 4B9GA 4RDQG 2MEJB 3SDAD 2DI7A 1ZSHA 3U4KA 1M5Q1 1J8HB 3OMNB 5KSBF 2EE6A 4UINL 3H9SE 2V2WB 1ZLWK 2Y69B 2R8SH 2CKNA 4O02L 4U2YA 5HHNA 4PGEB 5KVEE 3R06B 2GUYA 1A21A 2IH1B 3T09A 2EDNA 3QFGA 4XAKE 4S1RH 1UATA 2L7JA 3ZRSA 4AX3A 1TO4A 1JTOA 3EJPA 3KBFA 2Q8AH 1XL6A 4AYFA 3WTUA 4G7VL 1COBA 2X6AA 2HXAA 5MHSD 2W07B 4NSKB 3DJTA 1SYSB 1FRGH 3CQQA 3RIFF 4Z7WA 2ZOLA 4WWNA 5I24A 1NDMA 5EOQL 3D0VA 2QLVA 1LO2L 5EBGA 3RJQB 4OLZH 2V9UA 4MJ4A 4BFJA 1SPDA 3V0FA 4TKWA 1G5AA 4NWTH 2F7LA 3PG2A 3WIIH 1YDPB 3BUPA 3LH2L 5I71B 3EYVB 4PJDF 1ETZA 4X80L 1OF2A 2C34A 4HC1L 2A9DA 1NCOA 5F72S 4FNLH 4N2LA 1OLZA 2XSKA 3KVQA 3ZKMC 4AENA 2OK0H 2D4FA 2XNAB 3ZL2A 5D2NB 1P4IH 3O3EB 1HAWA 5IIEA 4P57B 3QG7H 4Z7NE 3FTGA 5D7JC 1LWRA 2ROXA 4PB9L 1TITA 2Q6WB 2PABA 4JL1A 4M4RA 1TU2B 4N22A 3ZKNC 4ZFFB 5AB9A 1XF1A 3EYOB 3HBQA 4DULA 5IHUL 1TOXA 2WVUA 2XRAH 5KSAA 3CQPA 4YSQA 3MJ8B 5DMYA 2EDTA 2A9ML 4JO8A 4LL4A 2Y8LA 3V0IA 3ULVF 3QEQB 3QPQD 4XNDA 2VDRB 3CFMA 5C1MB 2IDTA 2LOEA 5HGBA 4FG6C 1REIA 1MFNA 4NN5C 4QKXB 4GO9A 1O9VA 5CZXC 5DXWA 4AQ1B 3V9FA 4FI7A 1IM9D 1OARH 1QEXA 2J1XA 4N68A 4N2DA 3TT3H 3EOAA 4N2GA 4A2DA 4WHCA 3DGGA 2XVBA 4KZ0A 5IBUB 3NN8B 5E5RB 1M05B 1XEUA 3OG4B 2HKHL 1KY6A 3K3QA 3L3JA 5K5YA 1G9ML 1XIWA 2R2HB 3WO3B 3CLWA 3BKJL 4ZO9A 2HL9A 2X4UB 2ZWNA 4ODXB 4PAZA 1T83C 5EIVA 4HYTB 5DLML 5I75C 1YEHH 3NIFF 4UQ2A 1B4JL 2EDJA 1OGAA 3OB0H 3K1DA 4ZNEA 1P5VB 1S7XA 1D9KC 1OSEA 1FZOB 1GZPB 3S48A 4N8CL 3C5ZB 5CS7A 2WXNA 3KYAA 4JRYA 1K4DB 3G5YA 4Z78B 5MP6L 2IH3B 3P54A 3FU6A 2OLDA 4OZIB 1UM5L 4AE1A 1K8IB 4P5SA 5C0FB 2IAMD 4Q6YA 2AJUH 3MUY1 3QP3A 2GY5A 4RGNB 3MCLH 2XC8A 3Q0HA 1IGFH 2WBXA 5I0ZA 2VSDA 1F6FB 5IVZA 3ZQXA 4A63A 1DSFL 2CRMA 2F1EA 1RLBA 1BQSA 4ZUUB 1BMGA 1JDYA 2OCFD 4JFYA 4OGAC 1MJ7L 4FXKB 3GEWB 2FQFA 4HGMA 1RZJC 3ZO9A 2P46B 2IC2A 2W9DL 3SDCD 5ID0B 5B4MC 2WQAA 2XPYA 3VXUA 2YGNA 3WI9A 2AJYH 3PNWA 1W8OA 2CR6A 3BIAX 4ERSL 2YOAA 4GAYA 2NQCA 2OULB 3T8MA 1TYRA 1CXKA 2YN3A 4I2XA 3OC5A 3OKNA 4K71B 4HCRH 2WYHA 2H6OA 2JFCA 2VDMH 4NO5B 4QJ4B 2ENSA 4HUXA 1PX3A 4F15B 5B39B 3QORA 3DWTA 5F0LB 3JWNG 3OCIA 4P4KD 3L3OB 1HHJA 2CHDA 3BPCB 3OLPA 3SYAA 3MYJA 2G2PA 3IMSA 4PS4H 1XF4A 4TL4A 1SF3A 1WTLA 2ICES 3NTCH 1J9TA 3QDJB 3N91A 3BUYA 1BZEA 3N1QC 4KJPC 1RIVL 1UC6A 3KD4A 3SBPA 1NC4A 4EZMA 2P5EB 4NC1C 3ULVL 1BZ9B 2NCEA 4NGHH 1G7QB 4PWHA 3RVUC 5KVDH 2DIEA 3WDHA 3UTZA 3HZKB 1AO7B 3SQOH 1VGEH 5EOCH 5J9PA 3ML8A 4Y9EA 4M6AA 3PDDA 5DUPL 3ZOAA 5KVFL 2JVUA 1WV7T 3UL4A 3ZE2F 4JR9H 4LB8A 2D4DA 2NLJB 2ATKB 4AJVA 1FO0B 3GSNB 3UROR 3D69B 4JGUA 2VR3A 1GGIL 1KJ2H 2CBOA 3EYQD 4H0IA 4HIHB 4HWZB 3PAYA 1V05A 5D2LB 3TOPA 3I75A 4F3FB 3D85A 3F01A 4CVXB 2VL4A 3QUMH 1PY9A 5T5NG 2KMWA 1HH9B 2GK2A 1KIPB 1KB5A 2X9WA 5DEFA 1CFNB 3PP4L 1XGPA 1PNCA 35C8H 2N01B 1QLFB 1Q94B 3QNFA 2YQGA 4PPTA 3K46A 2DQIL 3MDJA 4QRQB 4K9EH 5CBAB 3X12B 2A3TA 2VLKD 4K2UL 1D5XA 1QPXA 4QXVA 4AQAA 3GIZL 2VXUH 2FX8H 5C2UB 3LSOB 2P7TA 2R1YA 1X9UA 3U82B 4FERA 2V7HA 2NY1B 5GS0H 2BCMA 3IJ8A 1H6FA 1W8NA 1MHHB 1MWAH 4O5LH 2F58L 4N0YL 4Q4IA 1B2WH 1NPNA 4MZ3A 3S88L 3VXPA 5EF3A 4CSZA 3SYQA 3BN9D 3P11H 3KHOA 1DUYA 5F9AC 4RMSA 4GBXC 3W0WA 2BVQA 4OJCA 1HZLA 3VGGA 4DP9X 3K2UH 1RP8A 1ITBB 2UUDH 1G0DA 2ADIA 3AXHA 1JDAA 3IFLL 2VXTH 2VDKH 4W9GC 1KCKA 3QIBD 4EXPX 3FOLA 4ROCB 3ULAB 3KLSA 4K0OA 5C70A 3VB8A 4ZMVA 3RB5A 2AVGA 2H1XA 4O02A 3D4YA 4ZOBA 1SYVB 4PJBA 2JPIA 5TJWK 5JPNB 2B2XH 2BP0A 4DUVA 2NY0B 1DQKA 1QSEE 1RXLA 1KIQA 5I6MA 1WFMA 5F89B 2LU5A 3KPSB 1I85A 4NQCA 4OZFG 4RMRA 4TNWF 1KCUL 2OTUA 3KLLA 5KANI 1SZNA 1VRSA 2KHAA 5C0BD 5IFAL 4LLMB 1E4XL 3LV3A 4EAIA 1OAKH 2F53A 3QS2A 1JGLL 2OI9C 4TQ8A 1ETJA 1MCBA 2CIKB 4ONHA 2UY7B 3WNOA 4Z7QE 3ULVD 3V55A 2WO4A 5I66A 2DEWX 3CPLA 4D9RD 2OMTB 1EAQA 5EZIH 5IB4B 3D08A 3KLQA 2C3XA 1PFOA 1WWWX 4Z1PA 4MXWL 5KVEH 1JZ3A 1T1ZB 2FTAA 4JY6B 2HYMA 4MQ7B 4NAMA 5GJSH 2XY1A 2YD7A 2HP4A 4NKIL 5C0ND 5B3JF 2AXFA 5DRNA 2BCKA 2TSBA 3VFTA 4CW1A 2VDMB 1IGCH 2HFEA 5C0DA 3K72A 4K3DH 2I9LA 5C09E 3T8XB 1JZ5A 3UMNA 3WJMB 4YXLL 3F04A 1CQKA 1S78D 4FE9A 5IB3A 3GBNL 3LPWA 4Q7DA 2X7LB 4K7FB 3DJSA 5A6LA 4BM7A 1EGJL 3BAJA 5AVQB 1IC7H 5EA0H 3QEHA 3QUXB 4KRLB 4OT1L 4LQFH 2O5YL 2Q9OA 1XWVA 3HHRB 1FN7A 3V7AE 4G6JL 5E5UB 1KN4L 4HS8L 3PWPB 2FO1A 4DETA 3MTRA 2UZXB 2ZCLH 4RCAA 3IMRA 5FA3B 2EYTB 2R2EB 3RI5K 1U3HB 3MCG1 3JVGC 4PJFA 4X99A 5EUOA 4DHLA 5E6YA 2C9UA 1ADQL 3APFA 4P2RE 4ALAL 2CBMA 2NYKA 4IRZH 4C56E 1MFBL 5DQJB 4XPFH 4LLAA 4V11A 1F86A 2WBJA 5FUZH 4F7EA 2VDNB 1IGYB 5E2JA 4N5ED 3T0EB 1QKZL 5DHVA 5TFSL 1RMFH 2F6AA 3DRQA 3ARFA 4E9YA 2OR9L 3TE5A 1KJ2B 2ZOWA 1H19A 3IJYA 1IBDA 3CFJB 4MMZA 4K07A 5FAAA 5GRZA 4AYEC 1QNEA 2M83A 3AM8C 1A9EB 1UYWH 4Q9RL 3QUMB 4TSAL 1KELL 4U6HA 4WDIA 5SWZA 3W57A 4EN3B 2KZKA 2WLYA 4LSSL 2CAKA 3IRCA 4CN4A 3H8NA 1FGNL 4LLWA 5F3FA 1KYAA 4EJZA 4UZUA 1W16A 1XO8A 3HS8A 5ABZA 5EZPA 1BAFH 3OQRA 4YHPB 1H3UA 1M2OA 3MV8B 3OKMB 4UOJA 4GSQA 5DJZA 2UV3A 1SFHA 1FL3B 3QXUA 3BGMB 5L2JA 1II4E 4IBUA 4JFDD 4NZFA 1YQVH 2YWYA 1ZEAH 4BZ1L 3EHBC 3OB8A 4YXKL 4QR7A 1AZCA 2GC7C 3WDIA 2GSGA 2Q3AA 3MA9L 2W0KA 4IKKA 4UOQA 4QJ5B 4XPGL 5LBSA 1WZAA 2X3CA 2G5UA 3KNBA 5FYJD 2DQUH 3TA3A 3BWAA 4CL7A 4YO0B 2VDOL 4R26L 4XPHL 3VXSB 3ZDZE 2Z9TA 1KC5H 4QMEA 1KJMA 1THAA 1NFIB 3Q9QA 3EADA 4R96B 4HETA 3RFZA 4RX4A 3LEYL 3BW9B 3OAUL 2NY7L 3REWB 1TCRA 5TQ0L 1KBGL 5HJ3B 2WLIA 1I9JL 1NAKL 3QC5X 4KKLC 4F8PA 2IOOA 1MELA 3S5ZA 3UPCA 5IVXB 4F8LA 3L16A 5IUSA 3QCVL 2VDKB 3TBSA 1U3ZA 5IFHL 3X14A 4K94C 1JDDA 2PUQT 2NY6C 2F7OA 4TQIA 2F74B 3Q6FA 1W0VA 4IRSD 2P8MA 1FZJB 3EFDL 1EUTA 3PNRB 3GXFA 3RU8L 3OX8A 3S35X 2VLRA 4UQAA 4P9HC 5GGQL 2MJWA 5C2BH 2VQTA 4RISL 2E9WA 4PEEA 1AGCA 2OMUB 4DKAA 1P2CA 1ZA6A 1DBBH 3W9EA 1IGIH 2ZCKL 1R17A 3MRGB 3ETBJ 3ZTNH 5KSAC 4HJEA 1FYTD 1OE1A 1IBZA 2XXGA 4MA1C 5DD1L 3BPNB 2LU3A 2ENQA 1CR9H 3VFNB 4GXUN 3UBFA 5BZWB 2LLGA 5EWIL 4L2LA 1QFWM 5EU4A 4I0CC 3NEXA 4UT6L 4ZQTA 5IHLB 5BQ7B 4OD2B 4JHUA 5EIIA 3FO9B 1LNUB 3PWVA 2P49B 4L4VB 4G5ZH 3SDDA 5G5DB 1UJ3A 3G5ZB 2EXTA 1CFBA 4LEXL 3MFFB 4YBQC 4YC2C 5C0AB 1XIWC 2WOBA 5A2LH 2A77H 1XXDC 2CM6A 4NOBA 5H8DA 3UGEA 2OTWB 3V8OA 3MLTB 4AL8C 3B9KA 4PJ7A 4BQBA 4PGCA 4DW2H 2WXPA 1MZZA 4MDIB 1CXFA 2IWFA 3LXUX 5JPMA 5IM7A 4PJIE 3AAZB 3F7YB 2JHJA 5KJRH 3OAWA 3SKMA 2BRRH 1N8OE 4QXWA 1MCPL 1VZGA 5T1MA 1LK3H 1BGXL 3MO1B 1ROWA 3MACH 1X7SA 3FUMA 5DUMH 3TWCH 1ZVSA 4HH8A 5D7IB 1QWHA 3QRLA 1KB9J 5TDNA 3I9GH 4JFXA 3H0TB 1J5OH 1WS8A 4XCYA 1G6RB 2K7PA 3DTXB 2HCZX 5D1QB 5GGRY 2PXYB 2VJXA 3L4VA 4JO1H 4Y1AB 4MSWB 3D6GA 1NCGA 3UBXB 2E9JA 3A4DA 1NAMB 2TRYA 3L13A 2W5PA 1IFRA 2GY7B 2FKMX 1ID2A 4KAQL 1HEJC 4R84A 3IF1B 3LHPL 1KN2L 2K6ZA 3Q01A 1KLUB 4JBSA 4X4ME 2VC2B 4UQDA 3TL5A 5F7MC 5I8OL 1N70A 2HL8A 3JUZA 4M1GH 4N8VB 1OGTA 1T21B 2LFEA 2H32A 3CCHB 3QQ3B 3OSEA 1NCIA 4OJFL 4UT7H 5GGUA 3HNTL 1EEZB 3EO1B 1AXSA 3VWKD 4PV1C 2R4SH 3NZHL 3T2NL 2NY3B 4P46D 1WBXB 3L95A 2YMXH 3O3DA 1I8LA 5AALA 2I5WA 2PWHA 2NW3A 3KYMB 2CZNA 3BAYA 4XMKH 4HAGA 4M5YH 1ADWA 1OF0A 3MBWA 5FKPA 3R0NA 2WXFA 1CLCA 1M71A 32C2B 3JWDC 1YNTB 1TPXB 5FF6B 1JD7A 4WI3A 3CN0A 3FO2B 4PM1A 3SKNA 2NNAA 4U6TA 4X5PA 4JPWL 2JCCF 5C7ZA 4PP1C 1ICTA 1YMHA 2A74B 3PP3H 3X3GH 3GTVA 4EKXA 1JPFB 4O00A 5D7KE 3MV9B 4FGMA 1F3DJ 2XKSA 4J23A 4F93B 4ZD3L 3RVTC 4ILDA 5CJ5A 1PFCA 3P3SA 4XI5C 3V7AG 2O6EA 3GLZA 5JW3H 4HLEA 3ZXAC 1AE6H 1HNFA 1S7WA 4XCCH 4XOBA 2W80C 1K35A 1QHOA 3OG6B 3MLUH 2Q2EB 3EZ8A 1ZS8B 3OL2A 3NJNA 3SDYH 1QLEH 5CHNA 5D7LD 1D3UA 4IMKA 3QCTH 1JCKA 2BIHA 2ADFH 1JV2A 3M1BB 1EGJA 3Q5TA 4WUKH 5ESQB 4CA4A 4Z6AT 5HGDA 2LVEA 1GGBH 1I4FB 4HFWA 5DJDB 4EDXB 4XOCA 3LKOB 5AVUB 5GGSA 4Z7VE 4UQBA 3K4ZA 3I9AA 4HU2A 5CEZD 3G08A 4FG4A 1PZCA 2XHNA 2OXGA 3OAYH 2ZWYA 3VFSA 1GS7A 2PPEA 1L5GB 1O9ZA 3LZOA 2DQGH 2CDEA 4Y2DB 1SNRA 1VLXA 4NYLA 1DBJL 4LQ1A 3NPSB 2F0CA 2X3AA 4P05A 4G9FD 5EN3A 1T7VA 5A40E 3NK4A 5JHAA 2H45A 1UQSA 1THCA 2ENYA 5AVSB 4QLWA 4UF7C 5HHMB 2G2RB 2K45A 3VTTA 3WHXA 2JB5H 3PREA 5F3BA 3TIDA 2Q7YA 2VW6A 5TDPA 2C7UB 3BWUF 1TFPA 2IAMB 3BP7B 5E99H 1GAFH 3QQ4A 4WU7A 1MXGA 4UOZA 4L29B 1N9PA 3BAKA 4G80A 4HIPA 4WU5A 4JAMA 4BK8A 4KO9A 4Y9CA 1KMGA 4N26A 5H37A 1G87A 4X6EA 2ZTBA 4OZIF 2HVBA 3DX2A 3COOA 3DYPA 3F2LA 2B14A 4F8OA 1N26A 3V4VA 4WO4B 3HG4A 3M8OH 1I3GH 2VL5A 2J5WA 4PH8A 2PWEA 1IJ9A 4M43L 2VLLA 2FATH 5FO7A 1TJGL 4ZK8A 4HIEB 3L7EB 3NJIA 3LZQA 3O2WL 5FHBL 4MDRA 1O7SA 1J1PL 2K78A 2B59A 4Q4EA 3HR5A 2CK0H 3CD4A 1RPQA 2R15A 3QUZA 4GSRA 4IGBB 4X0NA 1AANA 3QJUB 3IVKB 1NH6A 2YSTA 2MNWA 1F4AA 3OD3A 5FYLL 2CKBL 4EIZC 4X6CA 1HHKA 4M9PA 4ZO8A 3TCTA 3DUSA 5GRVK 1U8JB 1UT9A 4YHYC 1P4BL 2FWSA 1Q9LA 1RZGB 1PD1A 1SM3L 2H0FA 1XD1A 3AT9A 3KPNA 3M7FB 2DKSA 3PWNA 4LHUA 5HI4D 3RNQA 5I8CB 1KEGL 2EKSA 2A5UA 1TEGA 4Y2NA 5GJTH 1NBVH 3FOMA 1JUFA 3NCJH 4UQ3A 4DEUA 3AMKA 2E3VA 3WNKA 4QYOB 3CFCH 4KGJA 3OHXB 2J20A 4QHUB 1X9LA 5C3TA 1PIGA 4JCMA 3UG4A 4MLIA 4XN8A 3BP6A 4BZ2H 2YJLA 1NC2B 4PCKA 1A6PA 4BBWA 5IVOA 1JVLA 3L5HA 4FYQA 1PLGL 1JGVL 3TT1H 2VDRL 3C09B 3FRUA 1IGJA 5IOPB 2AW2A 4NAQA 2DYPD 1MCWW 5FKAB 5DJ6A 4U1SB 4W70A 5AW7B 4JFFE 4GKSA 5K9QG 3FSZA 1IEBA 1SN5A 3DMMB 2Q87A 1RZIA 1L3WA 2W9LA 5D7SH 3U36A 1TTFA 5MEND 4EI5B 1Q9OB 1A6AB 2X4NA 1R3JA 3M07A 2PYEA 1L4IA 2WBJC 3BKYH 5ADOL 3FFDB 3MOAL 3G7TA 1AGEA 1PCSA 2F19L 3L7FB 2MPAL 5ITBH 3ARFC 4LRNH 3F12A 4KK8D 4NZTL 4QRSB 2FIKB 1YMMD 2WANA 4W6YB 3UTSE 1DP0A 4MMZC 3HTLX 3WEXA 2ATPA 1G9MC 4AKPA 2NY5L 2M8XA 1JYXA 4BGLA 5F9WC 1I1YB 4UU9A 3VI3E 2V3EA 4Z7QB 2Y1ZA 4ZXBA 5C0JB 4PGJA 3AS0A 5D55A 4GFTB 4DCQA 4R7NB 2AK4E 5DRWA 4XNBA 4RAUA 2O5NA 3T4AA 3FSOA 1RHHB 2F8VA 4IJ3B 2F61A 1ZT7B 2EUWA 4S0TD 4ZNCD 1NIBA 3KZ8A 5I28A 4OCYH 4B9KC 3O6KH 3GSQB 1BAWA 3D12B 3DKHA 3DJRA 3DV6B 4HJUA 4EAKA 5FA4A 3T0XA 3TA3C 4BCZA 1IGMH 1N6QH 2H2SD 1SHSA 1C8QA 4FJZA 4ACPA 5K9KB 2RAMA 5D8JH 3RTQA 5I1IH 3X13B 4PFEA 4XAWH 4HDIA 2WVSA 3RNKA 3RFZC 4NQXB 1C5DA 1KYFA 2OFQA 4ORGA 4WQOA 2W92A 4I89A 3CZUB 1S7TB 1XCTA 8FABB 4UQCA 2ZXDA 1LE5B 1TYJA 5JDSA 2YD3A 4LMQI 3WJLA 3U4AA 2R8SL 2ENJA 4WJKB 2BY3A 4NENA 3SY0B 4XVSH 5C0BB 1DYZA 4S1RL 1FVDB 2HT2D 5HHPA 2ODIA 1BX2A 1AFVL 5BZXA 3LRGA 1DVUA 4N2AA 5BVPH 5E8DH 2SEBB 2Q8AL 5F9OH 5HSHA 2BXZA 3NJMA 1P0SE 1PZ3A 4YSCA 2O6PA 1QNCA 1CBJA 3EGSB 2Q1EA 1PYWB 1FRGL 2IANA 5DF0A 3DHMA 3EF7A 1KJVA 3QJZA 4HH9A 1P7BA 4QRRD 3SCMB 4OLZL 2LVCA 4Y4HA 4NKQB 1JPEA 1GCFA 4IHOA 3RG1C 3IBOA 3F58H 5GRYA 5G55A 4C54A 5AW5B 4M02A 4JDEA 1D5MA 3IMBA 1GHFL 3VXRA 2KI6A 3BVNA 1DVSA 5DMIH 3K6NA 4DN4H 5C0CE 4FNLL 4I9WD 4J3XA 3T2PA 1FO0L 3ILPA 2MCPH 2OK0L 3DOSA 5JW4R 2WINA 3SDDC 1EJOH 1P4IL 1JG9A 1QFUH 3WFHB 3ZR6A 3VNZA 1UJ3C 3QG7L 4IOIB 2AV7A 2YEVB 2R69L 1JI1A 3RGBA 3S3DB 2UXTA 2W59A 3MR9B 1B0GA 3B9KC 3MTXA 1CU4H 1EZVX 2MKLC 3F6IA 5BVJB 4ODUB 3S8FB 1F3JA 5JPMC 1QP1A 4NM4H 2CXKA 1DVQA 1H15A 2CLZA 2TRHA 1OAYL 1E6JH 2EJ1A 2BJML 2XRAL 4HV8B 4N0CC 5L2KE 4X7TA 3RBGA 3VD4A 4FQQB 3RHWF 4H8WC 1TJMA 4F7PB 3SDXE 4JMXA 2X2JA 3JUYA 4IS6A 4KI5C 2ZKHH 3ARED 1IAMA 3DVNA 5DURD 2PYFB 3X17A 3FQUB 2GSIA 4NN6B 4G6FB 1NIFA 5LJYH 3IPBA 1KXHA 1OB1A 1T3FA 4HUVB 3MV7A 1XZ0B 4QRPD 5E2WH 1RHFA 4U6YB 5HDBB 3QJSB 4ZUVA 3ZTDC 4L3EA 1UZ8A 2X6CA 5AVRB 2GI7A 1OCOB 4FQLH 4J6IA 2Z7YA 3AROA 1E5ZA 3M45A 4OUUA 4PMEA 4MVBC 1SN0A 2NQDA 2OBGA 3BH8A 4HIIA 4PVLA 2V5MA 2WTPA 2R39A 4RIRB 4X6FA 5TF1L 1HFUA 3LEVH 3BMVA 4P2OB 4KKCC 5B38G 3K2IA 1LWVA 1YEHL 2NDGA 5JLZA 1WGVA 3NH7L 3D7PA 1XX9C 4JFDB 1KSRA 2QRDA 1J8HA 1KWKA 2FEDC 4LOVA 3IK2A 1P7QA 2GITB 5G2NA 4RMQA 4LVNC 5TE6H 3S96B 3R06A 5EEUA 2DLTA 4GIOA 1PZ2A 1XGRB 25C8H 2AJUL 2V3FA 4I87A 2VN7A 4ZZKA 1RK7A 1SDDA 1QRND 5DHEA 2FLMA 4L1BA 5AENA 4C57C 4E9SA 3DNKA 3KLHD 1QNZL 2P8LB 3HAEG 4DP2X 4AEHH 1C16B 1CN4A 4FF9A 4MS8C 1YG9A 4CC4A 4LCUB 2C9SA 4U4IA 2VKXA 1ED3A 2HSIA 2NW2B 3UBXI 1MG3C 4MA3B 3MKGA 5D7EA 1AR2A 1U93B 4IRSB 1OO2A 4P5RA 2X2UA 1MNNA 3HHSA 2Y0SA 4OIAA 3EYVA 3PABB 3SD5A 5HGAB 3R4DA 3C8HA 2WOYA 3FTWA 3JT0A 4HCRL 2VDML 2QQKH 3PHQB 1XTMA 2FBOJ 4X9HA 3TBWB 1S3KH 4ODWB 2XNAA 2EO7A 4HQQL 5D2NA 1QEWB 4FX5A 4PD4K 5CEYB 5T5NF 4OKVA 3CDFA 4H7VA 3OSTA 1MZYA 3LZLA 4UANA 2YPLB 1L9TA 5I6XB 3QZBA 5J7CC 3KCWA 3VWJB 3HW7A 4PS4L 3S3JA 4I8DA 3X11A 2EACA 4ZFFA 4IMKC 2Y5QA 3EYOA 5E4EC 3Q2CA 3MJ8A 1OQXA 1U8QA 3BC9A 5GZNA 2Q7NA 3T2QA 4NGHL 3T77B 4HSCX 1KCBA 2B16A 4JNXA 1CCZA 2YPKB 4L4TA 1DJSA 3SQOL 3X1GA 5EOCL 4XMPL 1WH0A 3GHEH 2H2PD 3P4OB 3QGVA 1X5AA 3AT8A 4JR9L 2NOEA 4UZSA 2VDNL 3O0LA 4W93A 2DICA 1OCRB 4UNUA 3NN8A 1M05A 1R3LB 4N0FB 5TGBB 1KJ2L 3GXMA 4O2CA 4QWWC 4BD4A 1AZNA 1BVZA 3I84A 3GB7B 4PRHE 4GW1B 4FZ8L 3QUML 5F7UA 2XTJB 3L6FB 5DS2A 1BJMA 4OZHB 2VDPH 4LNRA 4O2FA 35C8L 4X9YA 4WFHD 1D5ZB 4E5XG 1DZ0A 2ZX5A 5BS0E 2AQRA 2J1WA 5JIDA 1J48A 1A6TB 4FEMA 1P5VA 3WHE1 1LDSA 2AEWA 1FZOA 3E38A 1GZPA 1XGUA 4K9EL 3C5ZA 4OSUH 5E1AB 5FV2A 5JOFB 4AKQA 4Z78A 1CO1A 4B0AA 2IH3A 1H3PH 1S5HB 1A4BA 4Y5YC 1TQCB 2VXUL 3EF4A 2JKJA 2FJUB 3S3SA 4E42A 1A9VA 4J3TA 1ZK5A 4H2CA 5GS0L 2EICA 3MUGB 4WIQA 1KIUA 1MWAL 4O5LL 3FYEB 1JXGA 4ABUA 4Z7NF 1B2WL 4R2GC 3M88A 4IM8A 3P11L 1FFNB 4ZUUA 4EO5A 3A21A 1MFVA 2D0AA 3U2SA 4FXKA 1B4TA 3ZYOA 2AEIT 4P5KB 3L5IA 3FRPA 3MROB 3QUZC 3SO3B 5BMNA 1JGUH 4U6VH 5BO0D 2VYRE 1IAIM 4P46B 3U4BL 4ZMQA 5ID0A 1SJMA 2VDKL 4H1LH 5BZDB 4MQXC 3ARBD 3NIDB 1TUOA 1IC5H 4WI4A 4F2MB 3BP5A 2WLLB 4LSDA 4OCMC 1J10A 3WBDA 3CMOH 2JHNA 1P6FA 2XZQH 3BD4A 4UIMB 4NO5A 2B2XL 2GJ6B 4XMZA 1J3MA 2BSTA 4RESB 5IW3A 2F54E 2QQLH 3F84A 5T8IA 3L3OA 3BPCA 3GMQB 5LVEA 2IOMA 1M56B 2PO6A 3B7RL 1OAKL 1EXHA 2BY1A 2LE9A 4D9LL 2BO0A 3QUYB 4MAYA 4U1NA 1MCOH 4W1TA 2F5BH 1C47A 4KOCA 1IARB 5EU3B 3CXFA 2QGCA 3FZUD 4LBAA 3U46B 4BELD 1BZ8A 5EZIL 3QIWA 3P4MB 4JVUA 5EZOH 4FNRA 5KVEL 1YTBA 1AO7A 1MVUB 4TVPL 3MC0A 1RUPH 5GJSL 4PV8A 1SHWA 2ZT9C 1SOKA 4TNEA 4ZBJA 4QCIB 1CJYA 3NZ8A 3NJKA 1WSST 2X6VA 3CU1A 1RSFA 2NLJA 1QN7A 3TA4D 4XP6H 1FO0A 3GSNA 1GRWA 1F3RB 2HH0H 5FOBB 4K3DL 3TM6A 2WP3O 2VUYA 5D2LA 4NUMA 4X9FA 1Q9UA 2R69A 3NJVA 2V0AA 4IRJA 3VM7A 2QMKA 4E9XA 1IC7L 4P2QD 5EA0L 1VB9A 1UH2A 4P06A 3FSAA 1CFNA 1OANA 4JZOB 1BWWA 1XSKA 4ZXBC 2GUOB 4LQFL 1Q94A 3MSPA 2NZIA 4XTRD 1DZBA 5EDSA 2YA0A 3TYFB 1WA0X 1SMOA 1CGVA 1NGZB 3GBEA 3IU3A 1AVAA 1G6RL 3PQYE 4FL4B 3L2NA 2ZCLL 3FUKA 4F92B 1X9RA 3T4AC 2JQMA 4LL9A 1ORQA 5FUCE 4QHLB 2PWWA 5GS0D 1VTLE 3D8MA 4IRZL 2R0WL 3PFUA 4WFEE 4XPFL 4JHAH 3GSVB 4QOKE 3WKQA 5B22A 5KN5B 4OCNC 4JRLA 5JIHA 3RTQC 3RWIA 5F3HA 1CICA 2B1HH 4QXUL 3UTTA 4NO0A 1S9XB 4FFTA 3IDGB 3SGKA 3WJLC 4N87A 2CGRL 1Q72H 4LAQH 3I3WA 3RQ3A 1GGYA 1BAFL 4KMTH 3VCLA 1EZVY 4AGNA 4Z23A 4ZW3A 4JO2L 3W11C 3LY6A 2QADC 3QR0A 1MCHA 4JE0A 3SPIA 3GKWH 1SYVA 1ZEAL 2GSMB 4J3OC 3HG3A 2J4WH 5JPNA 4F58H 1XH3B 5F89A 4KTDH 2AJ3B 3CHRA 5KG9A 4NIKB 2DQUL 2QREA 1WK0A 4KO5A 4LLMA 4W81A 3T3PB 2X53A 1KC5L 2Y1AA 1FLTX 2CIKA 3QZWB 2UY7A 5E1HB 3Q6GH 1PJWA 3BP4B 1M1XA 4Y4HC 3H9SD 4X6BB 4AKOA 3K6SA 5ISZA 1G7MB 4MNGE 4NQTA 4ZJ9A 4AOFA 2OMTA 2A0LD 5IB4A 4JFEB 4OF8A 3HCVA 3S5LA 4ODTH 3V0JA 2BWIA 4JY6A 4MQ7A 5KYUB 5FDWB 1IZJA 1ZGLB 1N2RB 4BFNA 1YRKA 1UKTA 4M6MH 2GK0B 5JUEH 1R0AH 2QGBA 4LP8A 3H9ZA 2BX5A 1EDHA 3CAFA 3DX6A 3CVBA 2BSCA 5L4FA 4YSRA 2BS9A 1GC1H 2X7LA 4K7FA 1DBBL 5DD5H 1IGIL 3GS0A 2EDRA 3RY6A 2BZCA 3ZTNL 4MZ2A 1CE6A 3QWOB 4NHUA 4WTZA 1BMZA 5MENB 4K9JA 1CR9L 3L9YA 4N28A 1X4YA 2A7BA 1K5WA 3DURA 3PWPA 5J3HD 3MLVH 3QDMA 2XFXB 5EN2B 3U48A 2Y3NA 1CGYA 1WFJA 1U3HA 3M17B 1PEZA 3UZQA 1ZK9A 2IGFH 4G5ZL 4NNXB 2MCAA 2Y22A 5E2UH 3VFUB 3IJEA 4NDMB 5DQJA 1XMWA 1IGYA 4L8DB 5JHBA 3T0EA 2GI0A 4KRPB 2A77L 2XICA 2BNQE 5C6PB 3VI4E 2WKOA 3CFJA 5KYXA 3CDZB 4JFSA 5KJRL 4P9ML 3ESUF 2BRRL 3DPBA 2MHAB 3FUFA 1YECH 4YIQB 1HJBC 3FQTB 1LK3L 2Z64C 4JRXE 2VJ8A 3TWCL 5CEXB 7PAZA 4LGRB 4BUHA 2LLLA 4X4YB 1NGQH 3MV8A 3OKMA 1J5OL 4OFKA 2W9EL 3HLKA 3IDJA 1FL3A 1OGPA 4MD0B 1M57B 3QI9D 4OCXH 1RUMH 1ERNA 3ELQA 4YK4B 4A7GF 1F90H 5C0EA 4JO1L 5AB2A 1ZSDA 3FTVA 2NMSA 1CGTA 1TEYA 3NACH 3DHPA 2ESVA 3FU9A 1TGHA 1TZGH 3TGXA 1YPZE 4P5MB 3WY3A 2BP8A 1G43A 1FCCA 1WWCA 3RY5A 3VXSA 1IC1A 2A1WL 1FUNA 1NFIA 4GXVL 4LZKA 3HMXA 4R96A 2VCOA 1DFXA 5FHAH 1MP9A 3PV7A 3REWA 3RA7L 4H0LC 2BS8A 4M1GL 4U1KB 5HJ3A 4C83B 4PJGE 1XGTB 3SDXB 5CJXA 1LDPH 1NH2A 1X5IA 3AG4B 3LH8A 1A64A 5D96B 5I71C 4L37B 1U2CA 4JN2B 5GRUH 4NUQA 4UT7L 2NOLA 3FB7A 4FHKA 2E7DA 2R4SL 2N0KA 5CILH 5C3LD 3QWNA 5TK2A 5CAYB 1SF5A 3A4EA 5DZNA 1IQWH 1VADB 1YNLH 4X0KB 2XWBA 4R0LA 5D2NC 1BD2A 4JFPB 2X4QB 1GYUA 2XZAL 4XMKL 5GGSY 4M5YL 3TP4A 4E9WA 1HYSD 2ZJSL 1NJ9A 4ZZFA 2OMUA 2OMBA 3L4UA 1L6XA 2VH5H 4P4RA 5T5FH 4PJEB 4BK4A 5GZNC 2HVKB 3GSOA 3X3GL 3VU2A 1I3RB 2DQCL 4APQD 3VFNA 1UM4H 3HPLB 5K1JA 1M3QA 4HUWA 5BZWA 1G4MA 3CZJA 4H20H 4HAFA 5LGJB 3EJTA 3GNMH 4I9XA 4JM2F 3TN0B 5T3XE 1P9MA 5J1AA 2NRDA 5J6SA 4D8OA 5PAZA 4XNYH 5JW3L 4DQOH 3BQUA 4L4VA 4CUCA 1AE6L 1U8CB 1UUSA 3UAJA 2NDFA 5SWSE 2YUWA 3MLUL 3G5ZA 5C0AA 5LWYL 5DURB 3ARGD 4ZFZA 4K55A 3MLTA 3SDYL 4KK5D 1QASA 4GEJA 1QLEL 3PV6B 2YEZA 1ZLSH 1A6UH 3ZDZF 3CWSA 2QQNL 1JE6A 3QCTL 3AAZA 4MD5A 1TJIH 2JKWA 3S2AA 2V9TA 2ADFL 2NY5C 3HE6B 5T1KD 4N2HA 3ATDA 1O7DE 1GGBL 3LZFH 3MO1A 5I73C 4OLUL 3C5ZC 4OCSH 3VSQA 4WI0B 1N8ZA 5D7IA 4KVCH 3MQIA 5AYUL 3V6OA 5KBKA 2BSRB 5K9OB 1ONQB 1IBHA 2CDGB 4R5TA 1G6RA 2XV6B 1R5WB 1V7MH 1XAUA 2ZSVA 5AD0A 4RGNC 4YAQA 4XC1H 3P0VH 2PXYA 2YRLA 1RP9A 2A9CA 2DQGL 4NO2B 4FFYH 3HG1B 4Y1AA 3WLWD 3ERXA 5KOVC 4FD0A 1MVYA 3UBXA 4BYHA 2ZUVA 2YBGA 1LP9B 2E8ZA 1IBGH 4G3YL 2W91A 1NAMA 1E9QA 2FD6H 2DQFA 2NY4C 5E8PB 4FXKC 4ZTEA 1TTBA 5DRXA 3H4FA 5F70A 1G1KA 1GAFL 3C6LB 1USQA 3CIQA 2C3GA 4R7VA 5DS8B 3WAJA 4HK3N 2ED9A 4YN3A 5F7FA 5GGTL 1EAJA 2GIXA 1VKXB 3CCHA 5CIPB 1FNAA 3EO1A 2ICWB 4K23H 3O6FD 3PY9A 4UMGA 3MBEB 3H2WA 5E6IB 4BUQA 3M8OL 3MRHA 1WBXA 5F44A 1HCYA 1URLA 3I02B 4F15C 2V3DA 3NZSA 2HX9A 4OD3H 4PJAB 2E9IA 1SLUA 2FATL 2VZSA 3KGRA 3KYMA 3L3OC 3WKNA 1I8MB 1IAOB 4GG6A 1MCDA 4OR1A 2PO6C 3HA0A 3WAKA 4U1MA 4HS3B 3OKOB 3HLAB 4MAYC 4HIXL 1YNTA 5FF6A 2CK0L 5HYJE 5I1JH 4PJIF 3CSPA 2X40A 4XP1H 5E00A 1J88A 5DQDH 1MREL 1U8LA 1EXUA 2A74A 2JNZA 3BZDA 3QIWC 3L5WB 3DXAE 4X83A 4M5ZH 5CN3A 1GW6A 3DECA 3INUL 1MH5A 2PLTA 1G84A 2WN3A 1KTBA 3ECUA 3Q48A 1KCRH 5DEJA 1QSED 2RQ8A 4C4KT 5E8NB 1R3IH 5J56B 4Q0XH 5GJTL 3UC0H 1NBVL 3NCJL 3B6SB 4G43B 3W5MA 1DLFH 1JTPA 1UWXK 3C04A 3ARWA 4MCYA 1ZS8A 1EFXB 3SJVE 4G6AD 4IRJC 3ZKSD 4KTYA 3A3YB 3RE0A 4NUPA 3TU6A 1BQLH 4WSKA 2L3BA 5I5IA 1AZUA 3NIGE 5CU5A 3QQDA 1PKOA 1IM9A 1CLYH 3DX3A 2X4OA 3M1BA 1ZLWH 5ESQA 3TT1L 1I4FA 1Q1JH 2XDHA 4Z18A 2ODHA 5KAQG 4UV7H 2XIDA 4EDXA 3LKOA 1JF5A 4LBEB 5FGBA 3FTYA 1GPOL 4ONFH 4Y5VA 1Y1UA 1RFDL 4BE5A 4APXB 1FFOB 1KYOJ 3NPZB 1TZAA 3VMPA 1JXJA 1L5GA 4G7YH 1E67A 2NY1C 5LAPA 5E9DE 3LRKA 5C09D 4IU2B 3BKYL 2KLRA 1QACA 4B7LA 5ITBL 2W8CA 4LRNL 5EUKA 3L81A 2BHFA 3Q2NA 4WHTB 1DVFD 3EDDA 4AZUA 4DGUA 3DX7B 1CICC 3OAZH 4DTGH 2CO6B 2PW1A 4FNUA 1UOKA 2VZVA 4HIQA 2IAMA 3MRFB 3N41F 4LHJB 5JO5B 2DIAA 1DE4B 2EINB 1FHGA 2ZWSA 4L29A 3U1PA 5FFLA 4G8EA 3SGKC 4JE4B 5JMOC 2VN4A 5C8JA 3T0DA 2CHWA 1RH8A 2F7QA 4BE6A 5INDA 5AW0B 1J0YA 3D18A 4QD2E 1T6BX 4L9LB 3G5VB 4P2RD 3ZIMA 4GLRH 1JZ8A 4C56D 2FEEI 4G70B 4WO4A 4WNQA 2GABA 5DJXA 4ZX3A 5JPNC 1KTLA 2WUBH 3BJ91 2J56A 2NY0C 3D2UD 3DX1A 4OCYL 3VD7A 4F5CA 3O6KL 4FNQA 2JKNA 4TLSA 3P3UA 3SDCA 1IGML 4HIEA 1RY7B 4KQ3H 4NXKA 2Y07H 3CQFA 3F5WB 5D8JL 5I1IL 2DPKA 5I9QB 4XAWL 4J3UA 2YARA 3KHQA 5HI5D 3WHE0 3PJLA 2VN3A 2AEQL 3KH3A 1NLDH 1MHPH 2FL5B 3K7UA 4TRPH 3X1BA 2XHIA 3CFEB 1K2YX 1MLBA 4JM2D 4RMBA 2Y7NA 2M2DA 4Z7VF 5F8RC 4P2YA 5DVOA 1URIA 2VRKA 4AC4A 4XVSL 1U8JA 2ZOOA 4N85A 4W9FC 2BSED 1M9WA 3ESPA 1NCWL 5I8CA 2FH6A 2DF3A 3ASMA 5BVPL 5E8DL 5F9OL 5IQLA 5AZ2H 4RAHA 3ML9A 1J9CT 1UXWB 4PGBB 4QYOA 1FJ1B 4HX1B 4K5PA 1WFNA 2DLGA 3OHXA 4QHUA 1E4JA 4QOKB 1P84J 2OMZB 1BVOA 2Z1KA 4CVZA 3DYMA 4N2KA 1AD0B 1CD9B 4GSDL 5B1JC 1OT1A 3RY6C 2WPGA 4DP4X 2N59A 3ISWA 1EEUA 6PAZA 2Q3ZA 4HWNA 4F7TA 5IOPA 3VH8A 1NGWB 2E46A 5FKAA 5J4MA 2DD8H 2YJQA 4KJYB 4TL5A 1U3HC 1PX8A 4G42B 5DMIL 1A7NH 4XP4H 4JZNA 3DMMA 1NWPA 1WFOA 2MCPL 4J6RH 3SEPA 3UAEA 4EI5A 2ZSWB 1BYNA 1Q9OA 4PJCE 1CF8H 2KT6A 4D7QA 3RVXD 4N2BA 3FFDA 3W2DH 3CDGB 5F7BA 3T0EC 3L17A 4WWPA 3NJLA 4P23D 1Q0YH 1X5MA 4QRSA 4AMKH 4TM9A 1CU4L 2QHLA 4NC1E 5A6IA 2VLKA 3EJZD 3EJYC 4KV5E 4L2YA 4NM4L 4C7PA 1I1YA 1E6JL 1DN0A 2CBQA 5KS9B 2XWTB 5AOKA 2NT0A 5KBDA 3RSMA 3ZUCA 4QTFA 4W6XB 1QUNB 4CU8A 2V2TA 5C0JA 2IBGA 4MJIE 2ZKHL 4FFVC 2ILLA 1OAJA 4R7NA 3O9WB 5T3XH 4YUEL 3BOVA 4LKCB 1CD1B 4BSVA 4CFFA 1RHHA 4XMLL 1FG2A 5JZ7C 4NHCH 1ZT7A 1AAJA 4OF5A 2EYSB 1G1CA 1UA3A 1CLOH 4W9JC 2CE6A 2J12B 1YNKH 3C12A 4FQLL 4LDCA 3DV6A 4WUUD 3MZGB 3CFDA 1WZLA 4OGYL 4PJDA 1R33A 1XF5B 3CVCA 1Y6MR 5EO9B 4JHBA 3LEVL 5M7QA 3P30H 4XX5A 5FYKE 3X13A 4ZTPL 3QDHA 4NQXA 1HXYB 5E5MB 5E7FA 4DZBB 2ZKMX 3O2VH 2XY2A 1J18A 1S7TA 4FLQA 1LE5A 4ELME 5AZEH 5CJXC 3WNPA 3C6SB 3OVUB 3HVDA 1HS6A 2JLLA 5GGTA 3JTBA 1WF5A 2ZNXA 5AAMA 5TE6L 1EHLH 3S4SA 4A37A 3WTVA 1EXGA 4ODSL 2W1NA 3HB3D 5CO1A 4QXTB 1FH5H 3ARQA 3O4LD 5C0BA 3DO7B 4M7JL 4M6OL 4JO4H 4LEEA 1BQHG 3KPRE 1CXLA 3PJNA 4LGSB 1F45A 2SEBA 2W65B 1AKJB 2VLME 4AEHL 3AABA 5F8QC 4IDJH 1U4EA 4NQED 4XCEB 2X3BA 3EGSA 2CWRA 1F6AA 1MRDL 3RUGE 2D03L 4G11A 2HX8A 2CM5A 4FZEL 4YPGA 3NGBB 2NXYD 1PDKA 3QDGB 3MODH 3VI3F 3T4NA 3UBHA 1ESOA 2OXHB 2WMPA 4KKNA 1WCBA 2HMID 4ORZC 2EDFA 5JXAL 3I50H 3U7YH 3SYCA 1UWEL 1BVKB 4EKJA 3D50A 3FBKA 2AJVL 1P9MC 2X42A 1I7RA 4EJYA 3O8XD 3UYOD 3VYPA 2QQKL 3H7BB 4JVPA 1QBLL 4Y16D 1S3KL 3RGVD 1JBJA 3UAJC 3GMRB 1TETL 4FXTA 3OXRA 2R0KL 4R4ND 3BI9X 3MR9A 5TF0A 1WZ1L 5E8EB 3FT4A 5E95B 5BVJA 4ODUA 4OZFB 1TMQA 2XJLA 4HV8A 2EO1A 2FEEL 1OK0A 4L8CB 1DBKH 1OXYA 1SJHA 2WLNA 2Z7UA 3LKQA 3GMMB 2LAGB 2PR4H 3QHTC 4NRXB 5D7KD 1EMTL 5F7EH 5F6IB 1TDQA 4TNFA 3IEAA 3ZKXB 3V6OC 2PYFA 4YL4A 5C9KA 3FQUA 1ZAGA 1CI5A 1BXAA 2WM0A 1L7TH 4HJ0C 3W1ZA 2VB5A 2PXYC 3GHEL 5ERWB 1M1SA 2MKWA 1UD2A 1EHNA 4C4BA 2YBRB 1VDGA 4NC2B 4PJ9B 5IMKB 1JTTA 4G8GD 1EJ8A 1X3DA 1RU9H 3MJWA 1DJGA 3U9UA 4RFOL 5HHOB 5K1NA 5I74B 1Q38A 1A1MA 2QHRH 2VDPL 3IETB 3QI9B 2DIJA 3PIQA 4JFDA 3SGDH 3TFBA 2QPUA 5AYQA 4LCCA 3OSVA 2E47A 1K8DB 1WHPA 2XX1A 4OSUL 4DKEH 3B5HA 1MDTA 1H3PL 2GITA 1KGCE 3GSRB 4OV6F 3D0LA 2ZP9A 1DEEB 2FAUA 4RNRB 3S96A 2GBUA 1H9DA 1PZ5A 3TBVB 2VQ1B 2R1WB 1XGRA 2NY3C 4UAHA 3BDYL 2ZYRA 1C5CH 4P2AA 1LEKB 2CO7B 4AYGA 3PPSA 4GQPH 4HJTA 4UYQA 5F6HI 1IRAY 4JFOB 1KF9B 1UD5A 5KTEH 5SWSB 5F1KC 1C16A 1PSKH 2V7NA 5IK3B 1HQ4B 4YDKH 5I23A 5CMAB 3ZE0B 3D07A 6CGTA 2FWOB 3QFDA 5D70L 2YPVH 2COQA 1NBZB 1SXBA 1OSZB 4I1RA 1JGUL 4U6VL 2Z35B 1KTJA 2HJFB 4B9CA 4MA3A 3DSFL 1NMBH 2A74C 4IRSA 3SDXF 4O58H 4AZ8B 4F7KA 4A6YB 1ES0A 4B3EA 1NANI 2VT0A 1IC5L 4WZ9A 5DO2D 4F1ZA 5F6HJ 4LSUH 4MXVE 3CMOL 5ACMA 1VIWA 3UJIL 2XZQL 3PHQA 1IT9L 3BHBA 1NGYB 3TBWA 5GIRB 4ODWA 1JZGA 3RKDC 1H5BA 4Z7WE 1QEWA 3MUHL 5CEYA 2QQLL 2ICWI 4WY7L 4XP5H 5DWUH 3K6IA 1NIDA 3VX0A 3NMEA 4DPBX 4BRJA 3NBNA 2YPLA 3IKCB 5IMMB 3QPQC 4FTVB 2Y7QA 2DLIA 3VWJA 3V6ZB 2EDMA 3RKPA 1MCOL 5DSCB 2F5BL 3HI1B 4ZUTB 2AQSA 1AISA 1K6QH 1MI5B 4MXQD 4XNAA 4FQXD 3LB6C 4QHMA 2FYYB 5EZOL 4PJXF 3APCA 2YPKA 5F1OB 5L9DH 3V0EA 2GEQA 4QEGA 5DJ0B 1RUPL 4WI6A 4UDUB 4PWKA 1OQOA 3S97C 1NOAA 2PPFA 4E9VA 1MLCB 4PRNB 4D94A 2P42B 4FLRA 2HH0L 3NPSC 3WD5H 4CMHB 3WEMA 1RZJH 4JUTA 2GHZA 5EU6D 5FM4A 4AQEB 3GB7A 5LLIC 1T1XB 5DJ2B 4L3AA 4XR8C 3L6FA 4JJOA 5HHQB 2CDFB 2IAMC 2LTQB 1KCWA 1YYMH 4GI8A 1D5ZA 5DHXB 2KDYA 4OZ4A 4JFFD 1TUPA 5E1AA 5EFIA 2J8UB 1A5FH 2JE8A 5JOFA 3DO4A 5LBGA 3FULA 5A43C 2ETWA 1C7SA 5LQBH 2YO3A 2FE0A 1CDCA 5K9KA 1WISA 2KPWA 3MCKA 3RPIA 4WO4C 4XB8A 1DLHB 1W0WA 3D2TA 5MEQA 3LNGA 1JPTL 2RR3A 2EE0A 3B7UX 4AJWA 3QXAA 4HISA 4D0CB 2Y7MA 4JHAL 3SE4A 3WE6B 3ZMRA 1HK6A 3UTSD 3PUUA 1X5GA 1WE5A 1A7RH 1KLGB 1ILUA 2H26B 1ZTXL 3UXFA 3SJVB 4NRYB 4YBLB 5KYWB 3W5NA 2VMDA 2V5RA 4GG8B 5F96H 2Q8BL 4P3DB 3MROA 2B1HL 3TEYA 1M4KA 4JRYE 4LSPH 4P46A 1LD9A 4TSCH 4XBEL 3STLA 2AK4D 1FAKT 4KROD 3TVMD 1QR1A 1Q72L 4KPHL 4LAQL 3T6XA 4KMTL 1Q9WB 3ZSTA 5BZDA 5JA8B 2Z7WA 1AQKH 3IGAB 4DUXA 2AFNA 2XWXA 2WLLA 1Z0NA 3DDFA 1QSFB 5AYTA 3GKWL 1WUZA 2J4WL 2Z8UA 4J3WA 1YQRA 4F58L 3NCYS 5D7JB 3B2MA 5DR5H 1MUJA 2SODB 4KTDL 3CV5A 5ESAB 2EDWA 2KC0A 5FYJU 1FORH 3GMQA 3QYCA 1LE9A 3OHXC 1CFSB 5FYKH 5KOMC 1JGDB 3QUYA 2YMOA 1ZKAA 3BUTA 2OZ4L 4URTB 2AGJL 3F85A 5EU3A 3VXUE 4AK2A 1SXAA 3CXHJ 2FECL 2GCYA 4DQAA 5DI8B 3U46A 3U0TA 2UZYB 2BIOA 1GMIA 3P4MA 4NN5B 3GPEA 1GW0A 5IB1A 4ODTL 5GS1A 3FU3A 1MVUA 3IMUA 3OJVC 3AGWA 4JEGB 1A14H 3DMMC 5K93A 3SQBB 1M7DB 1ILSA 3V8CA 4YFDB 3WL9A 2D31B 4TS6A 1URZA 4RMVA 2AC0A 4EI5C 4FQJH 5D7LA 3VNYA 2DTSA 4ETQB 3GSUB 3HE7B 5FOBA 5JUEL 4WWKD 1R0AL 3GTTA 2FX9H 2GTWB 5CWSA 4OLWH 4XO5A 3UADA 1EDYA 3RRQA 4EUPA 1J5IA 1GC1L 3TFKD 4QHPA 5I75B 1HYRC 5DD5L 2C3VB 3NSYA 2Z0BA 1E4HA 2C3WA 3BSZH 5HYQB 1J0JA 1KFAH 1DQMH 4POZD 1NMAH 1ID5I 1YYCA 4G9FA 4KTEH 5C0CD 1KWGA 3S8WA 4QHLA 4IJ3C 4A39A 1ZE3C 2A6IA 4R8WL 1JZ6A 1T0NB 2CO4A 4YSOA 3JV6B 1YAZA 2IGFL 5E2UL 3AVEA 2C7FA 2P3YA 3LRMA 3EH1A 3KS0J 1C5BL 2R27A 5KJ7E 1FZMB 2ZP0T 2WYTA 4LEOA 3GQFA 1LO5B 1IFGA 3TCLA 4AM0B 4TTGA 1RVFH 5KN5A 1VJSA 2FHBA 2KPNA 5IEKB 4ATTA 3ATEA 3P0GB 4KKAD 4F1SA 2ZXQA 1P53A 1MHEA 2VXQA 2G5BB 1B4LA 1SMDA 2P5PA 5A2BA 1S9XA 4E2OA 4X8JB 1ZHLA 1Y0LA 4HEME 4EN2A 4NWUH 2QQQA 3GM8A 5D4JA 4AQZA 5AUMA 2DKDA 4YR6A 5AAMC 3BKMH 3QWRA 5DC9B 1N4XH 4WJ5A 2Q86B 3T9WA 3K0YA 1RUML 4KJWC 3O0RH 3FDWA 2OL3A 4D3CH 1F90L 1LVEA 2QL1A 4GUOA 3AU1A 4OI7A 1XH3A 5LXGL 3FH7A 1CYGA 2AJ3A 3EOBB 1TZGL 1AP2B 2X1XR 2RJMA 3W0WE 1P7KB 1G9NC 2NPLX 4DAGH 9PCYA 4XCNA 3TO4D 2D7MA 4DP8X 1MAJA 1CYWA 3RDJA 3ZDXE 3GINA 4ICXA 4OFVA 2J1YA 3QZWA 1T2XA 5A16B 3BH4A 2VDLB 5J89A 2WUCH 1G7MA 2NR6D 4KK9C 4KH2A 1XT5A 4GRLD 1LDPL 4ISVB 4OB5H 5ESVB 1AR1B 5AOMA 4JFEA 2JKRM 3L4ZA 4RRPG 4L48A 2Z8VC 5GRUL 2DM4A 3B1TA 3J7HA 1OAUL 4PJBE 2NXZB 5KYUA 1S78C 2H9GA 5CILL 1X5KA 1S4IA 4FYRA 5FDWA 4LSRH 3FT2B 1IQWL 1F6LL 3PHSA 1R34A 4NQCE 4E41B 4RMWA 3KDMB 4DH2A 2GFBA 2F53E 4JY5H 5I6KA 2YRPA 2J6EL 4Z7UB 1QYGH 4LF3B 4R7XA 3TV8A 4CMMB 4QTHB 3QO1B 2YD5A 2BVTA 4A2MA 2VH5L 5T5FL 3EJUA 1FYHB 1AGDA 1XR8A 3D7QA 4N9GA 4I48B 4QXGL 1AYOA 5MENA 4EVNA 5HBBA 1UM4L 2CUAA 2XBDA 2EZ0D 3F7VB 4L0PB 4H20L 1KB3A 3GNML 4NN6C 5EN2A 3DUHA 2AQ1A 2F08A 2NX5B 3IPFA 2G60H 3EOTH 2C4XA 1OP9A 1R24B 1WO2A 1YMMA 3F83A 4XNYL 1UM6H 3ZTJH 4B9JA 5I1GH 5EBMB 2AMUA 4DQOL 3FHQA 4U1LA 4NNXA 3GS7A 3BO8B 5IUCA 4J1UA 3VFUA 4PTUB 1N6UA 3GJFB 1TZHB 2DQ6A 1BFVH 1TVBB 3RWCB 2F1BA 1L0PA 4WW2F 5IZ7A 1KFIA 4U6XB 4GBXB 1ZVYA 2H41A 4GS7B 3R0MA 1ZLSL 1A6UL 2WQXA 5DEZA 5EEWA 4B97A 1A22B 2EYRB 4RQQB 3MLZL 4TUKH 4WI2A 4JFVA 4K94H 4N6RB 3LZFL 3ET9F 4OCSL 5CEXA 5EUOE 4M3HA 4KVCL 4FQIH 4JZJA 3KLKA 4X4YA 3CHXA 1PG7H 3D9AH 1N10A 4UTCA 3QIUB 3DI3B 4PRIB 4TSBH 1HOCB 3VO0A 4XZ4A 2WCGA 4BV1A 1NZRA 2CQVA 3AG2B 4Q2ZA 2V2XA 1SXZA 4XNQB 1WG3A 3ZKQD 4P9HH 4FFYL 3ZW3A 2JCCA 3GLAA 3LMJL 5IHBA 4WKZB 3OH9A 2HKFL 3K8MA 2WLMA 4PRHD 1IBGL 4AITA 1J05B 2BNUB 2FD6L 3LKRB 3KMDA 2XXMB 1PZBA 3QS3A 5C08B 2XACC 5SWZE 4YS4A 1JXFA 3Q1SH 5BS0D 5IQMA 1RUQL 1EZUA 3IWUA 3O4LB 2HRPH 3CNKA 4U1KA 3EGDB 4IRSC 1QI5A 1XGTA 1IAKA 4FP8H 4JCWA 1U92B 4OFDA 5J0BA 4EBQH 3L3HA 2E7HA 4NQEB 4XPBL 3HN8A 5IJBC 2VXSH 3IGLA 2BNRB 3MJ9A 4LLVB 1W0YT 4OLXL 4QRRA 3GSXB 3Q8AA 4X0KA 4AL8H 1H5BC 4KTGA 3ZZLA 1WIOA 4HCIA 4OD3L 1V3JA 2WAHA 2C8NA 2MWCA 2X4QA 3REVA 3EFFA 4ANKA 1IE5A 3ZGIA 1ORSA 5I6XC 2OMVB 4DOHB 1H0DB 4N9OB 1VFBA 3VWJC 1KNOB 1Z1WA 3THMH 3VI4F 2JI3A 5T3ZE 1B90A 2GBVA 2J21A 4U7KA 3OSMA 4XP1L 5DQDL 5HSFA 4NP9A 4NS0A 2HA1A 4M8RA 3GS4A 2XV3A 2HVKA 3STZA 2VW4A 4NQDD 5DT1H 3HPLA 4AH2B 2J71A 1HIML 4NCC2 1UGKA 1J1XH 2HN7A 4XMVA 2EUVA 1TLKA 3GBMH 5E2TH 5DD6B 3F05A 1KCRL 3GMLB 3K80A 3KYKH 1MCKA 4ELDA 3Q8CA 2WQRA 3FXIC 3UC0L 2F54D 4S0HA 2RHEA 1OAXH 2XWJB 1ZLVH 2HT3C 1CGSH 2D7TH 4G5AA 4KQ4H 2ZAGA 4YX2L 3LN5B 2QGEA 3EYFB 1PLCA 2E4FA 2ALWA 2R0LH 2FJGB 1M6OB 3OZLA 5KUMA 1K5NB 1YPZF 3QJRB 3AREA 1ULVA 1CZ8L 1SEQH 2XTJC 1BFOB 1FG9C 3NDZE 1PCJX 3K4DA 4NB7A 3HE6A 2YC1A 5HYSG 4OY9A 3US0A 2PCXA 4N1HB 3G04B 1Q1JL 4PJGF 3MUUA 3BPOB 4UV7L 4G8GB 4L8SB 4N0RA 4GRMA 1W15A 4ONFL 1ONQA 2W88A 2R29A 2DKCA 3A0OA 5KVFE 1TQCC 4I1PA 4W9KC 1PD0A 2D9CA 2DMHA 3GXIA 4G7YL 3X1NA 3HG1A 4TMPA 3BD5A 1G7JA 2DDQH 3SE4C 2DOCA 3JWDH 4PJ7E 4KX7A 4Z7WB 1LP9A 2X6UA 5IQOA 2ZOLB 3QW9A 2V5YA 5E8PA 3DVFA 5HVHC 4DTGL 3BYTA 1QN5A 1WZMA 1PNDA 3IXAA 4KI5E 4IBYA 3SE6A 5DS8A 4P46C 3H4HA 4NKDA 1R6VA 3QULA 4L8BB 3ZHFA 1VKXA 5DZ9A 3RVVD 5HI3C 4GIPD 5CIPA 4PLNC 4GUCA 4OJDH 3BFWA 4LLQA 3AY4A 3W9DA 1QLRB 4AENB 1TQBB 3V0VA 2F8OA 4D0DB 3RYMA 1TXKA 5AVVB 4LVOB 2CO2A 2VR5A 3VGDA 3FTGB 5E23A 2PN5A 5CM1A 2R1XB 3B9EA 2CR0A 2A4EA 1KT2A 4G9DB 4M7LT 4PJAA 3UAAA 2JKIS 5B3NA 2ZQKA 1I8MA 1KB5H 4I18B 4KO6A 4DO4A 4OIBA 2D9QB 2Y07L 1VACA 2D8KA 2CHZA 4HS3A 3QUYC 4POUB 4Z0XA 5IHHA 4YVNA 4MA1B 3PGFL 2XN9D 1JNHA 4O4YL 4CVWA 3T04D 4CC0A 5IESH 3P2DA 1B6DA 1DQLH 1MHPL 1XHHA 4PLKC 4AYID 3UX9B 1FI8C 3L5WA 1ZLDA 4L1TA 2FT8A 5GS1C 2HWZH 4W9LC 1BV8A 4BSWB 4EXKA 4NZ8A 4PG2A 4E9QA 1HQRA 2Y4SA 1E8YA 4FG0A 5FC9A 4F2FA 4QHNB 3CLEH 2Z92A 1FAIH 3L3JB 3PDGA 3BRGC 2ROYA 2YFNA 1RZ7H 4NKMA 4CNIA 1WTGT 4H5SB 4HJHA 4M8VA 4KZEH 3LEXA 1EFXA 4AV5A 2R2BA 4XVJH 3IS0X 1M7UA 2J6EA 1P7HL 4UQ2B 1OGAB 2EP6A 1S7XB 1K4CB 2IWGA 3GXUB 4UINH 2JIXD 4UOW1 2JF1A 3D39E 3G5YB 2DWDB 4JDZA 4O02H 5BRZD 1Z32X 4AC2A 2DD8L 4LBEA 4I4WA 4Z77A 3QQXA 3CBKB 4APXA 5EU6B 1A7NL 1A3ZA 3AXIA 3BVUA 5IVZB 1CXIA 4AW4A 3PJSB 4JHZA 4QPEA 2HUHA 4J6RL 4Z5RA 2E7BA 3N55A 1FCGA 4N1CA 5A6MA 4N24A 1CF8L 4AVKA 1I1CA 3QEUA 4LDOB 1XF2B 2LU4A 5AVWB 4AJYV 4KITB 3D34A 4BIKA 3I6SA 4JFYB 4H44C 4X4XA 3VVVA 1L9PA 3CHQA 4FJYA 3IPEA 3LQAC 4N0UE 3DX7A 3NQIA 1AXTH 2ADGA 4YDLB 5LHDA 2R23B 3BEWA 1DQQA 3MRFA 1DE4A 1T0MA 4KNSA 3H56A 1WITA 3PNWB 3SN6N 1HN1A 1OSYA 5EEZA 5JORA 3ISRA 4HD5A 4AEIH 3MRIB 5E1IA 3HN3A 1V3KA 4JN1H 4NFCA 4RETB 4HFUH 4I2XB 3VACA 2YSSA 1NPJA 2NUTA 4GY4A 5FX3A 1I3VA 2D2CC 4NHCL 3JV5A 4OD1H 3QORB 3U6XA 4CRPA 3RPJA 2FLBT 1SRDA 3Q5OA 1PW3A 3SODB 4YHML 1CLOL 1T5WA 1HHJB 4NC0B 1YNKL 3MYJB 3ZBMA 2BNQD 3NK3A 4PB9H 1NUFA 3HS0B 3QXWA 3BUYB 4KXDA 3TF7C 3ARBA 3M86A 3F5WA 4HMDA 3VX1A 1HCFX 1NC4B 3P30L 5H4ZA 5D1XE 2QELA 1JP5A 3NIGF 3UEQA 2YD8A 4JRXD 1H3WM 4Q6KA 3N42B 5AZEL 3CFEA 5ACZB 4O2EA 1CTNA 5JXED 4KFZC 2L0DA 4HGKC 2P24A 3GJEA 4LDLB 3J2PA 4YEFA 1ZXQA 4P5TD 3TO2B 2IFGA 4JO4L 5DHVH 5I30H 4PW4A 2IDUA 3I75B 1G9MH 1R3KB 4KNQA 1T4KA 4IDJL 3BKJH 1E9OB 1NUNB 4PGBA 1G1OA 3WSQL 5CGBA 1FJ1A 4A7SA 5LBVA 3WNLA 3F64A 2AS5M 5DEFB 5DLMH 3ZTEA 1CXHA 1XGPB 1AS7A 5FO8A 3ARPA 3BUQA 3MODL 4HVBA 1D7CA 2YLKA 2XCMC 4FOMA 4X6CE 4KY2A 3KWWB 1ET8A 2LGNA 1TCMA 2PP7A 2WWOA 3L4WA 4JW3A 3U7YL 3NESA 3V4PB 1D5XB 4AQAB 2OMXB 4ZPVA 4AUJA 2P7TB 1L9MA 2V7HB 5LBSH 5JHDD 2H6PB 1E43A 2MFNA 4IQHA 3QFJD 1N68A 4K73A 3VXPB 2EXWD 3R4RA 1CI3M 4GRWE 4JQIA 4KRPC 1VTOA 3G5XB 5CGMA 4M7ZB 3W0WB 5T3ZH 2APWA 1YCSA 3CIAA 2WWNA 1V8HA 3E3QC 3BFOA 2ADIB 2KZ1B 2P43B 3GXPA 5L8KB 5LGKA 4Z7AA 3JYCA 5DFWH 2XWTA 1DBKL 1DJWA 1V55B 2DKMA 1U8OA 1FNGB 2E7CA 4JKKA 4C4UA 4ERSH 2VUKA 4U1IB 5T3XD 3N1MC 5IB2A 1CD1A 1VPOH 1YEKH 1L7TL 1Z7JA 1F2XK 2Q20A 4ADGA 1T6AA 5IJDC 2DJSA 4BFEA 3QB7C 3QO0B 4FMKA 4HEPG 2XIBA 3FCUB 4I0PD 4YK4C 1KIQB 2EEDA 2I24N 5HDRA 3TZVD 2IG2H 2OTUB 2CK2A 4PR5A 1RU9L 4PY8J 4K7PY 3VD9A 3NA4A 2PP9A 4WK4B 3BLBA 3U30B 2VN5A 4ONHB 2CLVB 2UYLA 2Y25A 3D87B 2W95A 3ZHDA 2OMNA 2QHRL 3CPLB 1N6VA 2HT2C 4DZBA 4PS3A 3K2MC 5IOKA 4LPUA 2VQ4A 1KEMH 1CT8B 1MJ8H 2A2QT 5AG8A 2AP2A 4DKEL 3C6SA 1HXKA 2ITCB 1P5DX 2NZ9D 1H3XA 4M48H 3WENA 2WIIA 3IH7A 2AXFB 1CB4A 2XYBA 3VFPA 3OH6A 1C5CL 2HFEB 2GBAA 5C0DB 3K72B 5JN5A 4PJCF 4ZMTA 2HTLD 3JWOC 1WBYB 4HKZA 3H9SA 2D7OA 2W60A 2CRZA 1PSKL 4XCEA 4YDKL 4GRLB 3OKLB 1WAAA 4H8WH