2MJ7A

Solution nmr structure of beta-adaptin appendage domain of human adaptor protein complex 4 subunit beta, northeast structural genomics consortium (nesg) target hr8998c
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
MGHHHHHHSHMQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWRGEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFLTELLLEPGNSEMQISVKQNEARTETLNSFISVLETVIGTIEEIKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords AP-4 complex subunit beta-1
publication title Solution NMR structure of beta-adaptin appendage domain of human adaptor protein complex 4 subunit beta, Northeast Structural Genomics Consortium (NESG) Target HR8998C
rcsb
source organism Homo sapiens
total genus 35
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09066 B2-adapt-app_C Beta2-adaptin appendage, C-terminal sub-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 2mj7A00
2D0BA 5IYDP 1PZDA 1VOLB 4B0AA 3H1ZA 1TBPA 3VN5A 2Z8UA 2D0CA 3OC3C 1QTSA 1JFIC 4WZSD 1QN8A 1VTOA 2G30A 1NVPA 3HS9A 1KY7A 1QN5A 1QNEA 1D3UA 1AISA 2IV8A 1RM1A 1NH2A 4ROCB 1QN4A 1W80A 1QN3A 1PCZA 1KYDA 1E42A 5IYCP 1CDWA 1TBAB 4PY5A 1QTPA 2D0AA 4ROEB 1QNAA 1MP9A 1KYFA 2IV9A 1NGMA 1QNCA 1YTBA 1QN9A 1QNBA 3OCIA 1C9BB 1QN7A 5IYBP 1QN6A 3EIKA 1VTLE 2VJ0A 1KY6A 1B9KA 3HS8A 4RODB 1TGHA 1VOKA 1YTFA 1R4XA 2MJ7A 3ASMA 1KYUA
chains in the Genus database with same CATH superfamily
1WJWA 1PZDA 2Z0FA 4BJUA 1TBPA 1LWYA 3RSMA 2Z8UA 2ZFDB 2NOEA 1JFIC 4EAJA 2Y8QA 2OOYA 1K2YX 3F10A 4EAGA 1VTOA 2G30A 2HKPA 5KL0A 1YQRA 1N3AA 1KY7A 2V8QA 1D3UA 2YH5A 1P5GX 1PCJX 4EAKA 1K35A 2HL9A 2QR1A 1KYDA 1JDYA 1VKLA 5IYCP 3OH9A 1QTPA 1LWVA 4ROEB 1QNAA 3I0XA 1KYFA 1N3CA 2DKAA 1PCMX 1C4GA 3D4VA 1QN6A 1VTLE 2VJ0A 3HS8A 4IL8A 3F0ZA 1N39A 1TGHA 1VOKA 3ASMA 2HZSA 2NVMA 1M5Q1 2QREA 4PY5A 3CVSA 3CVTA 4B0AA 5BMPA 3UW2A 4QG5A 3VN5A 5HSHA 3OC3C 5EPCA 4DULA 4MRQA 3CW7A 2NLVA 4WZSD 2R5XA 1UL7A 1EBMA 3HS9A 2NWVA 3OH6A 1RM1A 3OSMA 2PWWA 2Y8LA 1QN4A 1C47A 3NA5A 3KRMA 3OLPA 3ULXA 1TBAB 2JHJA 1EUVA 2IV9A 1NGMA 2EHBD 3OCIA 1M3QA 5IYBP 2O3OA 1YQMA 4EJYA 1B9KA 1P5DX 1V5SA 3DPUA 2NOHA 3CWUA 1HU0A 4TPSA 1KYUA 4Q11A 3TDHA 5IYDP 2HZMA 1VOLB 2LAEA 3H1ZA 4EAIA 1XSZA 2DKDA 1QTSA 3RPJA 1QN8A 3BKQX 3KTUA 2FKFA 2FUVA 3T4NA 1YQLA 1QN5A 1Q9UA 2IV8A 1NH2A 2QLVA 3PMGA 1W80A 1M3HA 2HL8A 1QN3A 5JN5A 3OSEA 4D7QA 4WX8A 3DPTA 1CDWA 1DIZA 4D7RA 4CFFA 5JMVD 1MP9A 3PDKA 1LWWA 1QNCA 1YTBA 1QN9A 1QN7A 3I0WA 2YA3A 1C9BB 1WQAA 4C7PA 1TUOA 3OGDA 3C04A 3EIKA 3SNSA 1FN7A 1J3MA 3ENCA 2NOZA 5F9CA 2V92A 3I3WA 1R4XA 1KFQA 2FKMX 2NOFA 2D0AA 1KFIA 2FGTA 2H4LX 2D0BA 2XHIA 3CWTA 2JHNA 3CWAA 2D0CA 4HJHA 2I5WA 4EALA 3OSTA 3D7QA 2F7LA 1PVSA 2MZ8A 1NVPA 2QRDA 1KO9A 1YQKA 1QNEA 1MPGA 5BMNA 1AISA 2DKCA 2NOLA 4ROCB 2OOXA 1UT4A 1LXTA 2QRCA 4WXAA 1PCZA 1E42A 3ENOC 4I8OA 2JPIA 3CWSA 3N89A 3EAYA 3TE5A 2H5AX 1QNBA 3IH7A 1KY6A 1T6AA 4RODB 1YTFA 4EJZA 2JOIA 2V9JA 5AN4A 2MJ7A 1UT7A 2NOBA 2NOIA
chains in the Genus database with same CATH topology
1PZDA 1TBPA 1LWYA 2Z8UA 2NOEA 1JFIC 3F10A 1VTOA 2G30A 1YQRA 1N3AA 1KY7A 1D3UA 2YH5A 1KYDA 5IYCP 1QTPA 1LWVA 4ROEB 1QNAA 3I0XA 1KYFA 1N3CA 1QN6A 1VTLE 2VJ0A 3HS8A 3F0ZA 1N39A 1TGHA 1VOKA 2MJ7A 3ASMA 2HZSA 4PY5A 4B0AA 3VN5A 3OC3C 4DULA 4WZSD 3HS9A 1RM1A 3OSMA 1QN4A 3KRMA 3ULXA 1TBAB 2IV9A 1NGMA 3OCIA 1M3QA 5IYBP 2O3OA 1YQMA 4EJYA 1B9KA 3DPUA 2NOHA 1HU0A 4TPSA 1KYUA 4Q11A 5IYDP 2HZMA 1VOLB 2LAEA 3H1ZA 1QTSA 3RPJA 1QN8A 3KTUA 1YQLA 1QN5A 2IV8A 1NH2A 1W80A 1M3HA 1QN3A 1CDWA 1MP9A 1LWWA 1QNCA 1YTBA 1QN9A 1QN7A 3I0WA 1C9BB 1FN7A 3SNSA 3EIKA 2NOZA 1R4XA 2NOFA 2D0AA 2FGTA 2D0BA 2XHIA 2D0CA 2I5WA 3OSTA 2MZ8A 1NVPA 1KO9A 1YQKA 1QNEA 2NOLA 1AISA 4ROCB 1UT4A 1PCZA 1E42A 4I8OA 3N89A 1QNBA 3IH7A 1KY6A 4RODB 1YTFA 4EJZA 2JOIA 5AN4A 1EBMA 3DPTA 1UT7A 2NOBA 2NOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0B A;  5IYD P;  1PZD A;  1VOL B;  4B0A A;  3H1Z A;  1TBP A;  3VN5 A;  2Z8U A;  2D0C A;  3OC3 C;  1QTS A;  1JFI C;  4WZS D;  1QN8 A;  1VTO A;  2G30 A;  1NVP A;  3HS9 A;  1KY7 A;  1QN5 A;  1QNE A;  1D3U A;  1AIS A;  2IV8 A;  1RM1 A;  1NH2 A;  4ROC B;  1QN4 A;  1W80 A;  1QN3 A;  1PCZ A;  1KYD A;  1E42 A;  5IYC P;  1CDW A;  1TBA B;  4PY5 A;  1QTP A;  2D0A A;  4ROE B;  1QNA A;  1MP9 A;  1KYF A;  2IV9 A;  1NGM A;  1QNC A;  1YTB A;  1QN9 A;  1QNB A;  3OCI A;  1C9B B;  1QN7 A;  5IYB P;  1QN6 A;  3EIK A;  1VTL E;  2VJ0 A;  1KY6 A;  1B9K A;  3HS8 A;  4ROD B;  1TGH A;  1VOK A;  1YTF A;  1R4X A;  2MJ7 A;  3ASM A;  1KYU A; 
#chains in the Genus database with same CATH topology
 1WJW A;  1PZD A;  2Z0F A;  4BJU A;  1TBP A;  1LWY A;  3RSM A;  2Z8U A;  2ZFD B;  2NOE A;  1JFI C;  4EAJ A;  2Y8Q A;  2OOY A;  1K2Y X;  3F10 A;  4EAG A;  1VTO A;  2G30 A;  2HKP A;  5KL0 A;  1YQR A;  1N3A A;  1KY7 A;  2V8Q A;  1D3U A;  2YH5 A;  1P5G X;  1PCJ X;  4EAK A;  1K35 A;  2HL9 A;  2QR1 A;  1KYD A;  1JDY A;  1VKL A;  5IYC P;  3OH9 A;  1QTP A;  1LWV A;  4ROE B;  1QNA A;  3I0X A;  1KYF A;  1N3C A;  2DKA A;  1PCM X;  1C4G A;  3D4V A;  1QN6 A;  1VTL E;  2VJ0 A;  3HS8 A;  4IL8 A;  3F0Z A;  1N39 A;  1TGH A;  1VOK A;  3ASM A;  2HZS A;  2NVM A;  1M5Q 1;  2QRE A;  4PY5 A;  3CVS A;  3CVT A;  4B0A A;  5BMP A;  3UW2 A;  4QG5 A;  3VN5 A;  5HSH A;  3OC3 C;  5EPC A;  4DUL A;  4MRQ A;  3CW7 A;  2NLV A;  4WZS D;  2R5X A;  1UL7 A;  1EBM A;  3HS9 A;  2NWV A;  3OH6 A;  1RM1 A;  3OSM A;  2PWW A;  2Y8L A;  1QN4 A;  1C47 A;  3NA5 A;  3KRM A;  3OLP A;  3ULX A;  1TBA B;  2JHJ A;  1EUV A;  2IV9 A;  1NGM A;  2EHB D;  3OCI A;  1M3Q A;  5IYB P;  2O3O A;  1YQM A;  4EJY A;  1B9K A;  1P5D X;  1V5S A;  3DPU A;  2NOH A;  3CWU A;  1HU0 A;  4TPS A;  1KYU A;  4Q11 A;  3TDH A;  5IYD P;  2HZM A;  1VOL B;  2LAE A;  3H1Z A;  4EAI A;  1XSZ A;  2DKD A;  1QTS A;  3RPJ A;  1QN8 A;  3BKQ X;  3KTU A;  2FKF A;  2FUV A;  3T4N A;  1YQL A;  1QN5 A;  1Q9U A;  2IV8 A;  1NH2 A;  2QLV A;  3PMG A;  1W80 A;  1M3H A;  2HL8 A;  1QN3 A;  5JN5 A;  3OSE A;  4D7Q A;  4WX8 A;  3DPT A;  1CDW A;  1DIZ A;  4D7R A;  4CFF A;  5JMV D;  1MP9 A;  3PDK A;  1LWW A;  1QNC A;  1YTB A;  1QN9 A;  1QN7 A;  3I0W A;  2YA3 A;  1C9B B;  1WQA A;  4C7P A;  1TUO A;  3OGD A;  3C04 A;  3EIK A;  3SNS A;  1FN7 A;  1J3M A;  3ENC A;  2NOZ A;  5F9C A;  2V92 A;  3I3W A;  1R4X A;  1KFQ A;  2FKM X;  2NOF A;  2D0A A;  1KFI A;  2FGT A;  2H4L X;  2D0B A;  2XHI A;  3CWT A;  2JHN A;  3CWA A;  2D0C A;  4HJH A;  2I5W A;  4EAL A;  3OST A;  3D7Q A;  2F7L A;  1PVS A;  2MZ8 A;  1NVP A;  2QRD A;  1KO9 A;  1YQK A;  1QNE A;  1MPG A;  5BMN A;  1AIS A;  2DKC A;  2NOL A;  4ROC B;  2OOX A;  1UT4 A;  1LXT A;  2QRC A;  4WXA A;  1PCZ A;  1E42 A;  3ENO C;  4I8O A;  2JPI A;  3CWS A;  3N89 A;  3EAY A;  3TE5 A;  2H5A X;  1QNB A;  3IH7 A;  1KY6 A;  1T6A A;  4ROD B;  1YTF A;  4EJZ A;  2JOI A;  2V9J A;  5AN4 A;  2MJ7 A;  1UT7 A;  2NOB A;  2NOI A; 
#chains in the Genus database with same CATH homology
 1PZD A;  1TBP A;  1LWY A;  2Z8U A;  2NOE A;  1JFI C;  3F10 A;  1VTO A;  2G30 A;  1YQR A;  1N3A A;  1KY7 A;  1D3U A;  2YH5 A;  1KYD A;  5IYC P;  1QTP A;  1LWV A;  4ROE B;  1QNA A;  3I0X A;  1KYF A;  1N3C A;  1QN6 A;  1VTL E;  2VJ0 A;  3HS8 A;  3F0Z A;  1N39 A;  1TGH A;  1VOK A;  2MJ7 A;  3ASM A;  2HZS A;  4PY5 A;  4B0A A;  3VN5 A;  3OC3 C;  4DUL A;  4WZS D;  3HS9 A;  1RM1 A;  3OSM A;  1QN4 A;  3KRM A;  3ULX A;  1TBA B;  2IV9 A;  1NGM A;  3OCI A;  1M3Q A;  5IYB P;  2O3O A;  1YQM A;  4EJY A;  1B9K A;  3DPU A;  2NOH A;  1HU0 A;  4TPS A;  1KYU A;  4Q11 A;  5IYD P;  2HZM A;  1VOL B;  2LAE A;  3H1Z A;  1QTS A;  3RPJ A;  1QN8 A;  3KTU A;  1YQL A;  1QN5 A;  2IV8 A;  1NH2 A;  1W80 A;  1M3H A;  1QN3 A;  1CDW A;  1MP9 A;  1LWW A;  1QNC A;  1YTB A;  1QN9 A;  1QN7 A;  3I0W A;  1C9B B;  1FN7 A;  3SNS A;  3EIK A;  2NOZ A;  1R4X A;  2NOF A;  2D0A A;  2FGT A;  2D0B A;  2XHI A;  2D0C A;  2I5W A;  3OST A;  2MZ8 A;  1NVP A;  1KO9 A;  1YQK A;  1QNE A;  2NOL A;  1AIS A;  4ROC B;  1UT4 A;  1PCZ A;  1E42 A;  4I8O A;  3N89 A;  1QNB A;  3IH7 A;  1KY6 A;  4ROD B;  1YTF A;  4EJZ A;  2JOI A;  5AN4 A;  1EBM A;  3DPT A;  1UT7 A;  2NOB A;  2NOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...