3T4NA

Structure of the regulatory fragment of saccharomyces cerevisiae ampk in complex with adp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
166
structure length
139
Chain Sequence
STVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYIPDLMKMVIQLFQIETNNYLVDFKFDGWESSTFSAYPFLHLTTKLIMELAVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Carbon catabolite-derepressing protein kinase
publication title ADP Regulates SNF1, the Saccharomyces cerevisiae Homolog of AMP-Activated Protein Kinase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 29
structure length 139
sequence length 166
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 3t4nA01
4EALA 2YA3A 4CFFA 1V5SA 4EAKA 2ZFDB 2EHBD 2Y8QA 2OOYA 2V8QA 2QLVA 4EAIA 2V92A 2QR1A 2V9JA 2QRDA 3TDHA 4EAGA 2OOXA 2QREA 3OSEA 1UL7A 2QRCA 2Y8LA 3TE5A 3T4NA 4EAJA
chains in the Genus database with same CATH superfamily
4EALA 3I0WA 3DPUA 3HS8A 3KRMA 1LWVA 4CFFA 2HL8A 2ZFDB 2EHBD 4EAKA 3I0XA 1K2YX 2OOYA 3UW2A 2R5XA 1KFIA 4HJHA 3SNSA 1UT4A 2JHNA 4EJZA 1PCZA 1VKLA 1JDYA 1QNEA 4EAIA 2G30A 3OH6A 1M3HA 3CVTA 4BJUA 1N3CA 1YTFA 1QTPA 1YTBA 1J3MA 1TBAB 2D0CA 2QR1A 4EJYA 3TDHA 1YQRA 3CWAA 1KY6A 2Z8UA 1QNAA 1N39A 1FN7A 4WX8A 1QN6A 4ROCB 4ROEB 3CW7A 3D7QA 3OSTA 5IYCP 1TUOA 3TE5A 2PWWA 2NOEA 1TGHA 1QN3A 1QN4A 1PCMX 1Q9UA 1HU0A 4WXAA 1V5SA 2Z0FA 2HZMA 5KL0A 1D3UA 2LAEA 2QLVA 2NLVA 4WZSD 1PCJX 1KYDA 1QN9A 1KYFA 5BMNA 1WJWA 4C7PA 2JHJA 2D0AA 5EPCA 1QNCA 3N89A 1M3QA 1VTLE 3CWUA 3VN5A 1QTSA 2FUVA 1P5DX 2OOXA 5AN4A 2NOBA 1C9BB 4TPSA 1QNBA 1DIZA 1M5Q1 1QN8A 1KYUA 4MRQA 1C4GA 5F9CA 1UL7A 2NVMA 2NOHA 1VOKA 2DKCA 5IYBP 2QRCA 2NOLA 3CWSA 1YQKA 1YQMA 4PY5A 2FKMX 3T4NA 1PZDA 2HZSA 1EUVA 2MZ8A 3BKQX 3PMGA 4EAJA 5JN5A 1N3AA 3EIKA 3IH7A 1NH2A 4RODB 3OSMA 3EAYA 2V8QA 4D7QA 2FGTA 3I3WA 1W80A 1WQAA 1LWYA 1EBMA 2YH5A 3ULXA 4QG5A 2F7LA 1QN5A 2DKDA 2HL9A 3OLPA 1AISA 1TBPA 4EAGA 1C47A 3F10A 2QREA 3RPJA 1KFQA 1RM1A 3C04A 3NA5A 3F0ZA 2JOIA 3ENCA 3ENOC 2NOIA 2D0BA 2MJ7A 3OCIA 1PVSA 1R4XA 2YA3A 3DPTA 5HSHA 2XHIA 3KTUA 4Q11A 2NWVA 2IV9A 1VOLB 2Y8QA 1UT7A 3HS9A 1T6AA 1NVPA 3CVSA 3CWTA 2NOFA 2H4LX 3H1ZA 1K35A 2JPIA 3RSMA 4IL8A 1YQLA 1CDWA 2VJ0A 4DULA 2O3OA 1QN7A 1XSZA 3ASMA 5IYDP 2V92A 4I8OA 5BMPA 2V9JA 4D7RA 2QRDA 1KY7A 1JFIC 3OC3C 2I5WA 2H5AX 2DKAA 3PDKA 1MPGA 5JMVD 2NOZA 3D4VA 1LWWA 4B0AA 3OSEA 3OH9A 2IV8A 3OGDA 2HKPA 1VTOA 2Y8LA 1KO9A 1NGMA 1MP9A 1P5GX 1B9KA 2FKFA 1E42A 1LXTA
chains in the Genus database with same CATH topology
4EALA 2YA3A 4CFFA 1V5SA 4EAKA 2ZFDB 2EHBD 2Y8QA 2OOYA 2V8QA 2QLVA 4EAIA 2V92A 2QR1A 2V9JA 2QRDA 3TDHA 4EAGA 2OOXA 2QREA 3OSEA 1UL7A 2QRCA 2Y8LA 3TE5A 3T4NA 4EAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAL A;  2YA3 A;  4CFF A;  1V5S A;  4EAK A;  2ZFD B;  2EHB D;  2Y8Q A;  2OOY A;  2V8Q A;  2QLV A;  4EAI A;  2V92 A;  2QR1 A;  2V9J A;  2QRD A;  3TDH A;  4EAG A;  2OOX A;  2QRE A;  3OSE A;  1UL7 A;  2QRC A;  2Y8L A;  3TE5 A;  3T4N A;  4EAJ A; 
#chains in the Genus database with same CATH topology
 4EAL A;  3I0W A;  3DPU A;  3HS8 A;  3KRM A;  1LWV A;  4CFF A;  2HL8 A;  2ZFD B;  2EHB D;  4EAK A;  3I0X A;  1K2Y X;  2OOY A;  3UW2 A;  2R5X A;  1KFI A;  4HJH A;  3SNS A;  1UT4 A;  2JHN A;  4EJZ A;  1PCZ A;  1VKL A;  1JDY A;  1QNE A;  4EAI A;  2G30 A;  3OH6 A;  1M3H A;  3CVT A;  4BJU A;  1N3C A;  1YTF A;  1QTP A;  1YTB A;  1J3M A;  1TBA B;  2D0C A;  2QR1 A;  4EJY A;  3TDH A;  1YQR A;  3CWA A;  1KY6 A;  2Z8U A;  1QNA A;  1N39 A;  1FN7 A;  4WX8 A;  1QN6 A;  4ROC B;  4ROE B;  3CW7 A;  3D7Q A;  3OST A;  5IYC P;  1TUO A;  3TE5 A;  2PWW A;  2NOE A;  1TGH A;  1QN3 A;  1QN4 A;  1PCM X;  1Q9U A;  1HU0 A;  4WXA A;  1V5S A;  2Z0F A;  2HZM A;  5KL0 A;  1D3U A;  2LAE A;  2QLV A;  2NLV A;  4WZS D;  1PCJ X;  1KYD A;  1QN9 A;  1KYF A;  5BMN A;  1WJW A;  4C7P A;  2JHJ A;  2D0A A;  5EPC A;  1QNC A;  3N89 A;  1M3Q A;  1VTL E;  3CWU A;  3VN5 A;  1QTS A;  2FUV A;  1P5D X;  2OOX A;  5AN4 A;  2NOB A;  1C9B B;  4TPS A;  1QNB A;  1DIZ A;  1M5Q 1;  1QN8 A;  1KYU A;  4MRQ A;  1C4G A;  5F9C A;  1UL7 A;  2NVM A;  2NOH A;  1VOK A;  2DKC A;  5IYB P;  2QRC A;  2NOL A;  3CWS A;  1YQK A;  1YQM A;  4PY5 A;  2FKM X;  3T4N A;  1PZD A;  2HZS A;  1EUV A;  2MZ8 A;  3BKQ X;  3PMG A;  4EAJ A;  5JN5 A;  1N3A A;  3EIK A;  3IH7 A;  1NH2 A;  4ROD B;  3OSM A;  3EAY A;  2V8Q A;  4D7Q A;  2FGT A;  3I3W A;  1W80 A;  1WQA A;  1LWY A;  1EBM A;  2YH5 A;  3ULX A;  4QG5 A;  2F7L A;  1QN5 A;  2DKD A;  2HL9 A;  3OLP A;  1AIS A;  1TBP A;  4EAG A;  1C47 A;  3F10 A;  2QRE A;  3RPJ A;  1KFQ A;  1RM1 A;  3C04 A;  3NA5 A;  3F0Z A;  2JOI A;  3ENC A;  3ENO C;  2NOI A;  2D0B A;  2MJ7 A;  3OCI A;  1PVS A;  1R4X A;  2YA3 A;  3DPT A;  5HSH A;  2XHI A;  3KTU A;  4Q11 A;  2NWV A;  2IV9 A;  1VOL B;  2Y8Q A;  1UT7 A;  3HS9 A;  1T6A A;  1NVP A;  3CVS A;  3CWT A;  2NOF A;  2H4L X;  3H1Z A;  1K35 A;  2JPI A;  3RSM A;  4IL8 A;  1YQL A;  1CDW A;  2VJ0 A;  4DUL A;  2O3O A;  1QN7 A;  1XSZ A;  3ASM A;  5IYD P;  2V92 A;  4I8O A;  5BMP A;  2V9J A;  4D7R A;  2QRD A;  1KY7 A;  1JFI C;  3OC3 C;  2I5W A;  2H5A X;  2DKA A;  3PDK A;  1MPG A;  5JMV D;  2NOZ A;  3D4V A;  1LWW A;  4B0A A;  3OSE A;  3OH9 A;  2IV8 A;  3OGD A;  2HKP A;  1VTO A;  2Y8L A;  1KO9 A;  1NGM A;  1MP9 A;  1P5G X;  1B9K A;  2FKF A;  1E42 A;  1LXT A; 
#chains in the Genus database with same CATH homology
 4EAL A;  2YA3 A;  4CFF A;  1V5S A;  4EAK A;  2ZFD B;  2EHB D;  2Y8Q A;  2OOY A;  2V8Q A;  2QLV A;  4EAI A;  2V92 A;  2QR1 A;  2V9J A;  2QRD A;  3TDH A;  4EAG A;  2OOX A;  2QRE A;  3OSE A;  1UL7 A;  2QRC A;  2Y8L A;  3TE5 A;  3T4N A;  4EAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...