1NH2A

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nh2A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nh2A02
1E42A 1KY6A 1QN6A 3EIKA 4B0AA 2MJ7A 1NGMA 4ROEB 2D0BA 2VJ0A 1QN5A 1D3UA 1KYUA 1AISA 1QN7A 1KYDA 4PY5A 3HS9A 1YTFA 1YTBA 3H1ZA 3OC3C 3OCIA 1KY7A 1B9KA 1RM1A 1VOKA 1NH2A 1VOLB 2D0AA 1QNAA 3VN5A 1TBAB 1C9BB 1QN8A 1QTPA 3HS8A 1KYFA 2D0CA 1QN9A 1QTSA 1R4XA 1W80A 4WZSD 1VTOA 5IYDP 2IV8A 2G30A 5IYBP 2IV9A 1NVPA 4ROCB 1PCZA 1MP9A 5IYCP 1JFIC 1CDWA 1QNBA 1QNEA 1TBPA 1QN3A 4RODB 3ASMA 1QN4A 1TGHA 1VTLE 1PZDA 2Z8UA 1QNCA
chains in the Genus database with same CATH superfamily
2YH5A 3I0WA 3D4VA 1KY6A 2QLVA 1YQKA 2Z0FA 4ROEB 1QN7A 4IL8A 1DIZA 3PDKA 2JHJA 1YQRA 1UT7A 3HS9A 3OSEA 1YTBA 3H1ZA 2NOEA 4TPSA 3OCIA 2HKPA 1KY7A 2FGTA 1N3CA 1RM1A 1VOKA 1LXTA 2JHNA 3TE5A 3VN5A 1UT4A 3OH6A 4D7RA 3IH7A 1VTOA 1TUOA 1HU0A 3CVTA 4WXAA 2HZSA 4EAGA 2IV9A 4ROCB 1JFIC 1CDWA 2H4LX 1QNEA 2NOBA 3OGDA 2NLVA 2EHBD 4BJUA 1QN4A 1LWVA 1TGHA 4EALA 5BMNA 3OLPA 2FKMX 1QN6A 2QRDA 4QG5A 4B0AA 1XSZA 3DPTA 3UW2A 2D0BA 3I0XA 1KYUA 1AISA 1M5Q1 3CWSA 3KRMA 2MZ8A 1J3MA 1V5SA 2V92A 2QRCA 3CWTA 2ZFDB 1P5GX 2DKDA 2HZMA 1NH2A 4WX8A 1TBAB 1C9BB 1QTPA 4Q11A 1N39A 4EAIA 5IYDP 1KFQA 3T4NA 3OSTA 2IV8A 2HL9A 3ENOC 1UL7A 3N89A 3NA5A 2QR1A 5EPCA 2QREA 1QNBA 2NVMA 4CFFA 1TBPA 3EAYA 2OOXA 2V8QA 3C04A 2I5WA 5F9CA 2FKFA 2PWWA 1PZDA 5JMVD 1VTLE 4EJZA 3ULXA 2YA3A 1K2YX 3EIKA 3SNSA 2V9JA 3OH9A 2MJ7A 2NWVA 1M3HA 1NGMA 3I3WA 2NOIA 2R5XA 1QN5A 1D3UA 2Y8QA 1KYDA 1FN7A 1EBMA 4PY5A 1YTFA 1YQLA 3RSMA 1C47A 3OC3C 1N3AA 1B9KA 1JDYA 5AN4A 2DKAA 2D0AA 1EUVA 2NOZA 3CWAA 1QN9A 1QTSA 1T6AA 1W80A 1WJWA 2DKCA 5KL0A 2G30A 5BMPA 1NVPA 3F0ZA 1PCZA 2Y8LA 4EAJA 3CWUA 1LWWA 1K35A 1MPGA 3BKQX 1KO9A 3OSMA 4RODB 5JN5A 1QN3A 1M3QA 2NOHA 1PVSA 1WQAA 4MRQA 4EJYA 4EAKA 1E42A 1PCMX 1P5DX 3CW7A 3RPJA 1YQMA 1Q9UA 2O3OA 2VJ0A 3ENCA 4HJHA 3PMGA 4D7QA 3DPUA 3TDHA 3KTUA 4C7PA 2JPIA 1VKLA 1VOLB 2F7LA 5HSHA 2LAEA 2OOYA 1QNAA 2H5AX 1C4GA 2XHIA 1QN8A 3HS8A 1KYFA 1PCJX 2D0CA 4I8OA 1R4XA 2JOIA 4WZSD 2FUVA 5IYBP 1LWYA 2HL8A 1MP9A 5IYCP 4DULA 3ASMA 1KFIA 3F10A 3D7QA 2NOLA 3CVSA 2Z8UA 1QNCA 2NOFA
chains in the Genus database with same CATH topology
2YH5A 3I0WA 1YQKA 1KY6A 4ROEB 1QN7A 1YQRA 1UT7A 3HS9A 1YTBA 3H1ZA 2NOEA 4TPSA 3OCIA 1KY7A 2FGTA 1N3CA 1RM1A 1VOKA 3VN5A 1UT4A 3IH7A 1VTOA 1HU0A 2HZSA 2IV9A 4ROCB 1JFIC 1CDWA 2NOBA 1QNEA 1QN4A 1LWVA 1TGHA 1QN6A 4B0AA 3DPTA 2D0BA 3I0XA 1KYUA 1AISA 3KRMA 2MZ8A 2HZMA 1NH2A 1TBAB 1C9BB 1QTPA 4Q11A 1N39A 5IYDP 3OSTA 2IV8A 3N89A 1QNBA 1TBPA 2I5WA 1VTLE 1PZDA 4EJZA 3ULXA 3EIKA 3SNSA 2MJ7A 1M3HA 1NGMA 2NOIA 1QN5A 1D3UA 1KYDA 1FN7A 1EBMA 4PY5A 1YTFA 1YQLA 3OC3C 1N3AA 1B9KA 5AN4A 2D0AA 2NOZA 1QN9A 1QTSA 1W80A 2G30A 1NVPA 3F0ZA 1PCZA 1LWWA 3OSMA 1QN3A 2NOHA 1KO9A 4RODB 1M3QA 4EJYA 1E42A 3RPJA 1YQMA 2O3OA 2VJ0A 3DPUA 3KTUA 1VOLB 1QNAA 2LAEA 2XHIA 1QN8A 3HS8A 1KYFA 2D0CA 4I8OA 1R4XA 2JOIA 4WZSD 5IYBP 1LWYA 1MP9A 5IYCP 4DULA 3ASMA 3F10A 2NOLA 2Z8UA 1QNCA 2NOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E42 A;  1KY6 A;  1QN6 A;  3EIK A;  4B0A A;  2MJ7 A;  1NGM A;  4ROE B;  2D0B A;  2VJ0 A;  1QN5 A;  1D3U A;  1KYU A;  1AIS A;  1QN7 A;  1KYD A;  4PY5 A;  3HS9 A;  1YTF A;  1YTB A;  3H1Z A;  3OC3 C;  3OCI A;  1KY7 A;  1B9K A;  1RM1 A;  1VOK A;  1NH2 A;  1VOL B;  2D0A A;  1QNA A;  3VN5 A;  1TBA B;  1C9B B;  1QN8 A;  1QTP A;  3HS8 A;  1KYF A;  2D0C A;  1QN9 A;  1QTS A;  1R4X A;  1W80 A;  4WZS D;  1VTO A;  5IYD P;  2IV8 A;  2G30 A;  5IYB P;  2IV9 A;  1NVP A;  4ROC B;  1PCZ A;  1MP9 A;  5IYC P;  1JFI C;  1CDW A;  1QNB A;  1QNE A;  1TBP A;  1QN3 A;  4ROD B;  3ASM A;  1QN4 A;  1TGH A;  1VTL E;  1PZD A;  2Z8U A;  1QNC A; 
#chains in the Genus database with same CATH topology
 2YH5 A;  3I0W A;  3D4V A;  1KY6 A;  2QLV A;  1YQK A;  2Z0F A;  4ROE B;  1QN7 A;  4IL8 A;  1DIZ A;  3PDK A;  2JHJ A;  1YQR A;  1UT7 A;  3HS9 A;  3OSE A;  1YTB A;  3H1Z A;  2NOE A;  4TPS A;  3OCI A;  2HKP A;  1KY7 A;  2FGT A;  1N3C A;  1RM1 A;  1VOK A;  1LXT A;  2JHN A;  3TE5 A;  3VN5 A;  1UT4 A;  3OH6 A;  4D7R A;  3IH7 A;  1VTO A;  1TUO A;  1HU0 A;  3CVT A;  4WXA A;  2HZS A;  4EAG A;  2IV9 A;  4ROC B;  1JFI C;  1CDW A;  2H4L X;  1QNE A;  2NOB A;  3OGD A;  2NLV A;  2EHB D;  4BJU A;  1QN4 A;  1LWV A;  1TGH A;  4EAL A;  5BMN A;  3OLP A;  2FKM X;  1QN6 A;  2QRD A;  4QG5 A;  4B0A A;  1XSZ A;  3DPT A;  3UW2 A;  2D0B A;  3I0X A;  1KYU A;  1AIS A;  1M5Q 1;  3CWS A;  3KRM A;  2MZ8 A;  1J3M A;  1V5S A;  2V92 A;  2QRC A;  3CWT A;  2ZFD B;  1P5G X;  2DKD A;  2HZM A;  1NH2 A;  4WX8 A;  1TBA B;  1C9B B;  1QTP A;  4Q11 A;  1N39 A;  4EAI A;  5IYD P;  1KFQ A;  3T4N A;  3OST A;  2IV8 A;  2HL9 A;  3ENO C;  1UL7 A;  3N89 A;  3NA5 A;  2QR1 A;  5EPC A;  2QRE A;  1QNB A;  2NVM A;  4CFF A;  1TBP A;  3EAY A;  2OOX A;  2V8Q A;  3C04 A;  2I5W A;  5F9C A;  2FKF A;  2PWW A;  1PZD A;  5JMV D;  1VTL E;  4EJZ A;  3ULX A;  2YA3 A;  1K2Y X;  3EIK A;  3SNS A;  2V9J A;  3OH9 A;  2MJ7 A;  2NWV A;  1M3H A;  1NGM A;  3I3W A;  2NOI A;  2R5X A;  1QN5 A;  1D3U A;  2Y8Q A;  1KYD A;  1FN7 A;  1EBM A;  4PY5 A;  1YTF A;  1YQL A;  3RSM A;  1C47 A;  3OC3 C;  1N3A A;  1B9K A;  1JDY A;  5AN4 A;  2DKA A;  2D0A A;  1EUV A;  2NOZ A;  3CWA A;  1QN9 A;  1QTS A;  1T6A A;  1W80 A;  1WJW A;  2DKC A;  5KL0 A;  2G30 A;  5BMP A;  1NVP A;  3F0Z A;  1PCZ A;  2Y8L A;  4EAJ A;  3CWU A;  1LWW A;  1K35 A;  1MPG A;  3BKQ X;  1KO9 A;  3OSM A;  4ROD B;  5JN5 A;  1QN3 A;  1M3Q A;  2NOH A;  1PVS A;  1WQA A;  4MRQ A;  4EJY A;  4EAK A;  1E42 A;  1PCM X;  1P5D X;  3CW7 A;  3RPJ A;  1YQM A;  1Q9U A;  2O3O A;  2VJ0 A;  3ENC A;  4HJH A;  3PMG A;  4D7Q A;  3DPU A;  3TDH A;  3KTU A;  4C7P A;  2JPI A;  1VKL A;  1VOL B;  2F7L A;  5HSH A;  2LAE A;  2OOY A;  1QNA A;  2H5A X;  1C4G A;  2XHI A;  1QN8 A;  3HS8 A;  1KYF A;  1PCJ X;  2D0C A;  4I8O A;  1R4X A;  2JOI A;  4WZS D;  2FUV A;  5IYB P;  1LWY A;  2HL8 A;  1MP9 A;  5IYC P;  4DUL A;  3ASM A;  1KFI A;  3F10 A;  3D7Q A;  2NOL A;  3CVS A;  2Z8U A;  1QNC A;  2NOF A; 
#chains in the Genus database with same CATH homology
 2YH5 A;  3I0W A;  1YQK A;  1KY6 A;  4ROE B;  1QN7 A;  1YQR A;  1UT7 A;  3HS9 A;  1YTB A;  3H1Z A;  2NOE A;  4TPS A;  3OCI A;  1KY7 A;  2FGT A;  1N3C A;  1RM1 A;  1VOK A;  3VN5 A;  1UT4 A;  3IH7 A;  1VTO A;  1HU0 A;  2HZS A;  2IV9 A;  4ROC B;  1JFI C;  1CDW A;  2NOB A;  1QNE A;  1QN4 A;  1LWV A;  1TGH A;  1QN6 A;  4B0A A;  3DPT A;  2D0B A;  3I0X A;  1KYU A;  1AIS A;  3KRM A;  2MZ8 A;  2HZM A;  1NH2 A;  1TBA B;  1C9B B;  1QTP A;  4Q11 A;  1N39 A;  5IYD P;  3OST A;  2IV8 A;  3N89 A;  1QNB A;  1TBP A;  2I5W A;  1VTL E;  1PZD A;  4EJZ A;  3ULX A;  3EIK A;  3SNS A;  2MJ7 A;  1M3H A;  1NGM A;  2NOI A;  1QN5 A;  1D3U A;  1KYD A;  1FN7 A;  1EBM A;  4PY5 A;  1YTF A;  1YQL A;  3OC3 C;  1N3A A;  1B9K A;  5AN4 A;  2D0A A;  2NOZ A;  1QN9 A;  1QTS A;  1W80 A;  2G30 A;  1NVP A;  3F0Z A;  1PCZ A;  1LWW A;  3OSM A;  1QN3 A;  2NOH A;  1KO9 A;  4ROD B;  1M3Q A;  4EJY A;  1E42 A;  3RPJ A;  1YQM A;  2O3O A;  2VJ0 A;  3DPU A;  3KTU A;  1VOL B;  1QNA A;  2LAE A;  2XHI A;  1QN8 A;  3HS8 A;  1KYF A;  2D0C A;  4I8O A;  1R4X A;  2JOI A;  4WZS D;  5IYB P;  1LWY A;  1MP9 A;  5IYC P;  4DUL A;  3ASM A;  3F10 A;  2NOL A;  2Z8U A;  1QNC A;  2NOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...