1NH2A

Crystal structure of a yeast tfiia/tbp/dna complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 43
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nh2A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1nh2A02
1NGMA 1KY6A 2VJ0A 1AISA 1C9BB 2D0CA 1B9KA 3ASMA 1QTSA 4RODB 1VOKA 1VTLE 1QN7A 1QNEA 1PCZA 1KY7A 3OC3C 5IYDP 1QN6A 1RM1A 3EIKA 3HS8A 3VN5A 1QN4A 1KYFA 2G30A 1VTOA 1MP9A 1TGHA 2IV9A 1QNAA 4ROCB 1QNCA 1QN5A 1JFIC 1KYUA 5IYBP 4B0AA 4PY5A 1KYDA 1QTPA 2D0BA 1TBPA 2D0AA 3H1ZA 1PZDA 1QN3A 1QNBA 1YTBA 1NVPA 5IYCP 1TBAB 4ROEB 1QN8A 2MJ7A 1NH2A 1QN9A 2Z8UA 3HS9A 4WZSD 1W80A 1E42A 1YTFA 1VOLB 1R4XA 1CDWA 2IV8A 3OCIA 1D3UA
chains in the Genus database with same CATH superfamily
1AISA 2D0CA 1QTSA 3CVTA 1DIZA 2PWWA 2NOZA 4EAIA 3I0WA 1M3QA 3EIKA 3HS8A 2HZSA 1QN4A 1KYFA 4MRQA 2FKMX 2QRCA 2NOBA 3DPUA 1KO9A 4EAJA 5JN5A 3PMGA 1YQMA 1P5DX 1JFIC 4B0AA 1EBMA 2NOHA 5BMNA 1LXTA 2D0BA 5HSHA 2HKPA 2D0AA 3H1ZA 3CWTA 1NVPA 3I0XA 1YQKA 4EALA 4EAKA 2MZ8A 2QLVA 3OLPA 3C04A 2R5XA 3PDKA 1E42A 1VKLA 3RPJA 5EPCA 4CFFA 1FN7A 1KY6A 2QREA 4WXAA 3OSEA 1PVSA 1QNEA 4EAGA 3F10A 2YA3A 1M5Q1 3NA5A 1V5SA 2Y8LA 1XSZA 2HL9A 1T6AA 3IH7A 2G30A 1P5GX 1C4GA 3SNSA 4EJYA 1VTOA 1MP9A 3ENCA 3D4VA 1WJWA 1UL7A 1QNAA 3TDHA 1QN5A 3CWSA 2YH5A 1YQRA 1KYUA 2HZMA 2F7LA 4Q11A 1QTPA 2V9JA 2Y8QA 1WQAA 1UT4A 5JMVD 1MPGA 1PZDA 1LWVA 1YTBA 1KFIA 1TBAB 5KL0A 4ROEB 2JOIA 4BJUA 1W80A 2NWVA 3RSMA 2H4LX 2QRDA 1VOLB 2NLVA 1TUOA 5BMPA 5AN4A 1J3MA 3D7QA 1NGMA 2VJ0A 1KFQA 4D7RA 1C9BB 3ASMA 3KTUA 1K35A 1KY7A 2HL8A 3OC3C 2DKCA 1RM1A 1PCMX 1LWYA 3CWAA 2EHBD 2NVMA 3F0ZA 2FGTA 4I8OA 2H5AX 4ROCB 4D7QA 2JHNA 3KRMA 5IYBP 4HJHA 3ENOC 1KYDA 4C7PA 2NOEA 3OSTA 4TPSA 3OGDA 3I3WA 1QN8A 1JDYA 4EJZA 1N3AA 2MJ7A 1NH2A 1QN9A 2QR1A 2Z8UA 4WZSD 2ZFDB 1R4XA 2XHIA 3OCIA 1D3UA 3OH9A 4WX8A 3CW7A 2FUVA 1QN6A 1N39A 3ULXA 2DKAA 2NOFA 1B9KA 4RODB 1VOKA 2I5WA 1K2YX 1VTLE 1QN7A 1PCZA 1PCJX 2O3OA 3EAYA 3CVSA 5F9CA 5IYDP 2JPIA 2Z0FA 3BKQX 3VN5A 1M3HA 2NOIA 3UW2A 1C47A 2DKDA 1TGHA 2V92A 2IV9A 2V8QA 4DULA 3N89A 3OH6A 3T4NA 1YQLA 1QNCA 2JHJA 2FKFA 3TE5A 1EUVA 2OOXA 1LWWA 1TBPA 4IL8A 1Q9UA 1QN3A 1QNBA 4QG5A 5IYCP 3OSMA 2OOYA 1UT7A 3HS9A 4PY5A 1YTFA 1N3CA 3CWUA 1CDWA 2IV8A 1HU0A 3DPTA 2LAEA 2NOLA
chains in the Genus database with same CATH topology
1AISA 2D0CA 1QTSA 2NOZA 3I0WA 1M3QA 3EIKA 3HS8A 2HZSA 1QN4A 1KYFA 2NOBA 3DPUA 1KO9A 1YQMA 1JFIC 4B0AA 1EBMA 2NOHA 2D0BA 2D0AA 3H1ZA 1NVPA 3I0XA 1YQKA 2MZ8A 1E42A 3RPJA 1FN7A 1KY6A 1QNEA 3F10A 3IH7A 2G30A 3SNSA 4EJYA 1VTOA 1MP9A 1QNAA 1QN5A 2YH5A 1YQRA 1KYUA 2HZMA 1QTPA 1UT4A 1YTBA 1PZDA 1LWVA 1TBAB 4ROEB 2JOIA 1W80A 1VOLB 5AN4A 1NGMA 2VJ0A 1C9BB 3ASMA 3KTUA 1KY7A 3OC3C 1RM1A 1LWYA 3F0ZA 2FGTA 4I8OA 4ROCB 3KRMA 5IYBP 1KYDA 2NOEA 3OSTA 4TPSA 3DPTA 1QN8A 4EJZA 1N3AA 2MJ7A 1NH2A 1QN9A 2Z8UA 4WZSD 1R4XA 2XHIA 3OCIA 1D3UA 1QN6A 1N39A 3ULXA 2NOFA 1B9KA 4RODB 1VOKA 2I5WA 1VTLE 1QN7A 1PCZA 2O3OA 5IYDP 3VN5A 1M3HA 2NOIA 1TGHA 2IV9A 4DULA 3N89A 1YQLA 1QNCA 1LWWA 1TBPA 1QN3A 1QNBA 5IYCP 3OSMA 1UT7A 3HS9A 4PY5A 1YTFA 1N3CA 1CDWA 2IV8A 1HU0A 4Q11A 2LAEA 2NOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NGM A;  1KY6 A;  2VJ0 A;  1AIS A;  1C9B B;  2D0C A;  1B9K A;  3ASM A;  1QTS A;  4ROD B;  1VOK A;  1VTL E;  1QN7 A;  1QNE A;  1PCZ A;  1KY7 A;  3OC3 C;  5IYD P;  1QN6 A;  1RM1 A;  3EIK A;  3HS8 A;  3VN5 A;  1QN4 A;  1KYF A;  2G30 A;  1VTO A;  1MP9 A;  1TGH A;  2IV9 A;  1QNA A;  4ROC B;  1QNC A;  1QN5 A;  1JFI C;  1KYU A;  5IYB P;  4B0A A;  4PY5 A;  1KYD A;  1QTP A;  2D0B A;  1TBP A;  2D0A A;  3H1Z A;  1PZD A;  1QN3 A;  1QNB A;  1YTB A;  1NVP A;  5IYC P;  1TBA B;  4ROE B;  1QN8 A;  2MJ7 A;  1NH2 A;  1QN9 A;  2Z8U A;  3HS9 A;  4WZS D;  1W80 A;  1E42 A;  1YTF A;  1VOL B;  1R4X A;  1CDW A;  2IV8 A;  3OCI A;  1D3U A; 
#chains in the Genus database with same CATH topology
 1AIS A;  2D0C A;  1QTS A;  3CVT A;  1DIZ A;  2PWW A;  2NOZ A;  4EAI A;  3I0W A;  1M3Q A;  3EIK A;  3HS8 A;  2HZS A;  1QN4 A;  1KYF A;  4MRQ A;  2FKM X;  2QRC A;  2NOB A;  3DPU A;  1KO9 A;  4EAJ A;  5JN5 A;  3PMG A;  1YQM A;  1P5D X;  1JFI C;  4B0A A;  1EBM A;  2NOH A;  5BMN A;  1LXT A;  2D0B A;  5HSH A;  2HKP A;  2D0A A;  3H1Z A;  3CWT A;  1NVP A;  3I0X A;  1YQK A;  4EAL A;  4EAK A;  2MZ8 A;  2QLV A;  3OLP A;  3C04 A;  2R5X A;  3PDK A;  1E42 A;  1VKL A;  3RPJ A;  5EPC A;  4CFF A;  1FN7 A;  1KY6 A;  2QRE A;  4WXA A;  3OSE A;  1PVS A;  1QNE A;  4EAG A;  3F10 A;  2YA3 A;  1M5Q 1;  3NA5 A;  1V5S A;  2Y8L A;  1XSZ A;  2HL9 A;  1T6A A;  3IH7 A;  2G30 A;  1P5G X;  1C4G A;  3SNS A;  4EJY A;  1VTO A;  1MP9 A;  3ENC A;  3D4V A;  1WJW A;  1UL7 A;  1QNA A;  3TDH A;  1QN5 A;  3CWS A;  2YH5 A;  1YQR A;  1KYU A;  2HZM A;  2F7L A;  4Q11 A;  1QTP A;  2V9J A;  2Y8Q A;  1WQA A;  1UT4 A;  5JMV D;  1MPG A;  1PZD A;  1LWV A;  1YTB A;  1KFI A;  1TBA B;  5KL0 A;  4ROE B;  2JOI A;  4BJU A;  1W80 A;  2NWV A;  3RSM A;  2H4L X;  2QRD A;  1VOL B;  2NLV A;  1TUO A;  5BMP A;  5AN4 A;  1J3M A;  3D7Q A;  1NGM A;  2VJ0 A;  1KFQ A;  4D7R A;  1C9B B;  3ASM A;  3KTU A;  1K35 A;  1KY7 A;  2HL8 A;  3OC3 C;  2DKC A;  1RM1 A;  1PCM X;  1LWY A;  3CWA A;  2EHB D;  2NVM A;  3F0Z A;  2FGT A;  4I8O A;  2H5A X;  4ROC B;  4D7Q A;  2JHN A;  3KRM A;  5IYB P;  4HJH A;  3ENO C;  1KYD A;  4C7P A;  2NOE A;  3OST A;  4TPS A;  3OGD A;  3I3W A;  1QN8 A;  1JDY A;  4EJZ A;  1N3A A;  2MJ7 A;  1NH2 A;  1QN9 A;  2QR1 A;  2Z8U A;  4WZS D;  2ZFD B;  1R4X A;  2XHI A;  3OCI A;  1D3U A;  3OH9 A;  4WX8 A;  3CW7 A;  2FUV A;  1QN6 A;  1N39 A;  3ULX A;  2DKA A;  2NOF A;  1B9K A;  4ROD B;  1VOK A;  2I5W A;  1K2Y X;  1VTL E;  1QN7 A;  1PCZ A;  1PCJ X;  2O3O A;  3EAY A;  3CVS A;  5F9C A;  5IYD P;  2JPI A;  2Z0F A;  3BKQ X;  3VN5 A;  1M3H A;  2NOI A;  3UW2 A;  1C47 A;  2DKD A;  1TGH A;  2V92 A;  2IV9 A;  2V8Q A;  4DUL A;  3N89 A;  3OH6 A;  3T4N A;  1YQL A;  1QNC A;  2JHJ A;  2FKF A;  3TE5 A;  1EUV A;  2OOX A;  1LWW A;  1TBP A;  4IL8 A;  1Q9U A;  1QN3 A;  1QNB A;  4QG5 A;  5IYC P;  3OSM A;  2OOY A;  1UT7 A;  3HS9 A;  4PY5 A;  1YTF A;  1N3C A;  3CWU A;  1CDW A;  2IV8 A;  1HU0 A;  3DPT A;  2LAE A;  2NOL A; 
#chains in the Genus database with same CATH homology
 1AIS A;  2D0C A;  1QTS A;  2NOZ A;  3I0W A;  1M3Q A;  3EIK A;  3HS8 A;  2HZS A;  1QN4 A;  1KYF A;  2NOB A;  3DPU A;  1KO9 A;  1YQM A;  1JFI C;  4B0A A;  1EBM A;  2NOH A;  2D0B A;  2D0A A;  3H1Z A;  1NVP A;  3I0X A;  1YQK A;  2MZ8 A;  1E42 A;  3RPJ A;  1FN7 A;  1KY6 A;  1QNE A;  3F10 A;  3IH7 A;  2G30 A;  3SNS A;  4EJY A;  1VTO A;  1MP9 A;  1QNA A;  1QN5 A;  2YH5 A;  1YQR A;  1KYU A;  2HZM A;  1QTP A;  1UT4 A;  1YTB A;  1PZD A;  1LWV A;  1TBA B;  4ROE B;  2JOI A;  1W80 A;  1VOL B;  5AN4 A;  1NGM A;  2VJ0 A;  1C9B B;  3ASM A;  3KTU A;  1KY7 A;  3OC3 C;  1RM1 A;  1LWY A;  3F0Z A;  2FGT A;  4I8O A;  4ROC B;  3KRM A;  5IYB P;  1KYD A;  2NOE A;  3OST A;  4TPS A;  3DPT A;  1QN8 A;  4EJZ A;  1N3A A;  2MJ7 A;  1NH2 A;  1QN9 A;  2Z8U A;  4WZS D;  1R4X A;  2XHI A;  3OCI A;  1D3U A;  1QN6 A;  1N39 A;  3ULX A;  2NOF A;  1B9K A;  4ROD B;  1VOK A;  2I5W A;  1VTL E;  1QN7 A;  1PCZ A;  2O3O A;  5IYD P;  3VN5 A;  1M3H A;  2NOI A;  1TGH A;  2IV9 A;  4DUL A;  3N89 A;  1YQL A;  1QNC A;  1LWW A;  1TBP A;  1QN3 A;  1QNB A;  5IYC P;  3OSM A;  1UT7 A;  3HS9 A;  4PY5 A;  1YTF A;  1N3C A;  1CDW A;  2IV8 A;  1HU0 A;  4Q11 A;  2LAE A;  2NOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...