1UT7A

Structure of the conserved domain of anac, a member of the nac family of transcription factors
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
166
structure length
147
Chain Sequence
GSHMGIQLTQLSLPPGFRFYPTDEELMVQYLCRKAAGYDFSLQLIAEIDLYKFDPWVLPNKALFGEKEWYFFSPRDRPNRVAGSGYWKATGTDKIISTEGQRVGIKKALVFYIGKAPKGTKTNWIMHEYRLIEPSDDWVLCRIYKKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords NO APICAL MERISTEM PROTEIN
publication title Structure of the Conserved Domain of Anac, a Member of the Nac Family of Transcription Factors
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 27
structure length 147
sequence length 166
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02365 NAM No apical meristem (NAM) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.150 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1ut7A01
3ULXA 1UT7A 4DULA 1UT4A
chains in the Genus database with same CATH superfamily
3ULXA 2JOIA 3ENOC 1V5SA 5BMPA 2NOFA 1K2YX 1QN3A 5EPCA 3CVSA 3EIKA 2JHNA 2D0CA 3ASMA 4EAIA 3OLPA 1VKLA 5F9CA 1TUOA 2VJ0A 3C04A 1C47A 1YQRA 2Y8QA 2G30A 1NGMA 3OSMA 1M3HA 1VTOA 1T6AA 2V9JA 1XSZA 3KTUA 3D4VA 1N3CA 3OSEA 1UT7A 3N89A 1D3UA 2DKAA 2NOHA 2MZ8A 1KYFA 2Y8LA 1QN9A 1QNEA 1WJWA 2JPIA 2HZMA 5BMNA 2FGTA 1KFQA 3D7QA 3I3WA 1QN4A 1VOKA 1W80A 2HL9A 2OOYA 1QN7A 1UL7A 5AN4A 1M3QA 1YTBA 2NOZA 4PY5A 4D7QA 1LXTA 1N39A 2H5AX 1PCZA 1P5DX 2NOLA 1PCMX 2O3OA 1UT4A 3H1ZA 3OC3C 3PMGA 5JMVD 4RODB 3RSMA 1Q9UA 2FUVA 3BKQX 2QR1A 1QN8A 2ZFDB 1YQLA 1PVSA 5IYDP 2V8QA 2OOXA 3NA5A 5JN5A 4BJUA 1LWVA 1QNCA 2NOEA 2NOIA 2QREA 2NOBA 1EUVA 1HU0A 1QNAA 1EBMA 1KFIA 2F7LA 1TBPA 1B9KA 2JHJA 2HZSA 2V92A 4HJHA 3HS9A 1MP9A 3T4NA 1N3AA 4EJYA 4IL8A 1PZDA 1QTPA 4C7PA 1QNBA 3OSTA 1KY7A 5IYCP 2EHBD 4EAGA 4Q11A 3I0WA 1YQKA 1JFIC 1KYUA 2IV8A 4B0AA 4QG5A 1YTFA 3OGDA 1VTLE 1FN7A 1WQAA 1KY6A 1JDYA 2LAEA 2DKCA 4MRQA 3VN5A 3CWSA 3EAYA 2NVMA 3I0XA 2HKPA 2YH5A 3TE5A 1C9BB 4EAKA 3DPUA 2I5WA 3CWAA 2IV9A 5KL0A 4ROEB 2NWVA 2QRCA 5IYBP 4WZSD 2PWWA 1YQMA 2FKFA 2FKMX 3KRMA 3CW7A 2NLVA 4D7RA 2D0BA 1KYDA 1C4GA 4EALA 2R5XA 2H4LX 4TPSA 3F0ZA 1PCJX 2Z0FA 4CFFA 2D0AA 3OH9A 1MPGA 1R4XA 2MJ7A 4WXAA 3PDKA 1DIZA 4EJZA 2Z8UA 1QTSA 3CWUA 1RM1A 2YA3A 2XHIA 3DPTA 1AISA 3OH6A 1K35A 4DULA 3TDHA 4I8OA 1NH2A 3CVTA 3CWTA 1QN5A 1NVPA 3UW2A 2HL8A 4ROCB 3IH7A 3OCIA 1P5GX 1VOLB 1KO9A 3ENCA 1LWWA 4EAJA 2DKDA 3F10A 1J3MA 3HS8A 4WX8A 1CDWA 3RPJA 1QN6A 1TGHA 5HSHA 2QRDA 2QLVA 1LWYA 1E42A 3SNSA 1TBAB 1M5Q1
chains in the Genus database with same CATH topology
3ULXA 2JOIA 2NOFA 1QN3A 3EIKA 2D0CA 3ASMA 2VJ0A 1YQRA 1NGMA 2G30A 3OSMA 1M3HA 1VTOA 3KTUA 1N3CA 1D3UA 1UT7A 3N89A 2NOHA 2MZ8A 1KYFA 1QN9A 1QNEA 2HZMA 2FGTA 1QN4A 1VOKA 1W80A 1QN7A 5AN4A 1YTBA 1M3QA 2NOZA 4PY5A 1N39A 1PCZA 2NOLA 2O3OA 1UT4A 3H1ZA 3OC3C 4RODB 1QN8A 1YQLA 5IYDP 1LWVA 2NOIA 1QNCA 2NOEA 2NOBA 1HU0A 1QNAA 1EBMA 1TBPA 1B9KA 2HZSA 3HS9A 1MP9A 1N3AA 4EJYA 1PZDA 1QTPA 1QNBA 3OSTA 1KY7A 5IYCP 4Q11A 3I0WA 1YQKA 1JFIC 1KYUA 2IV8A 4B0AA 1YTFA 1VTLE 1FN7A 1KY6A 2LAEA 3VN5A 3I0XA 2YH5A 1C9BB 3DPUA 2I5WA 2IV9A 4ROEB 5IYBP 4WZSD 1YQMA 3KRMA 2D0BA 1KYDA 4TPSA 3F0ZA 2D0AA 1R4XA 2MJ7A 4EJZA 2Z8UA 1QTSA 1RM1A 2XHIA 3DPTA 1AISA 4DULA 4I8OA 1NH2A 1QN5A 1NVPA 4ROCB 3IH7A 3OCIA 1VOLB 1KO9A 1LWWA 3F10A 3HS8A 1CDWA 1QN6A 1TGHA 3RPJA 1LWYA 1E42A 3SNSA 1TBAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULX A;  1UT7 A;  4DUL A;  1UT4 A; 
#chains in the Genus database with same CATH topology
 3ULX A;  2JOI A;  3ENO C;  1V5S A;  5BMP A;  2NOF A;  1K2Y X;  1QN3 A;  5EPC A;  3CVS A;  3EIK A;  2JHN A;  2D0C A;  3ASM A;  4EAI A;  3OLP A;  1VKL A;  5F9C A;  1TUO A;  2VJ0 A;  3C04 A;  1C47 A;  1YQR A;  2Y8Q A;  2G30 A;  1NGM A;  3OSM A;  1M3H A;  1VTO A;  1T6A A;  2V9J A;  1XSZ A;  3KTU A;  3D4V A;  1N3C A;  3OSE A;  1UT7 A;  3N89 A;  1D3U A;  2DKA A;  2NOH A;  2MZ8 A;  1KYF A;  2Y8L A;  1QN9 A;  1QNE A;  1WJW A;  2JPI A;  2HZM A;  5BMN A;  2FGT A;  1KFQ A;  3D7Q A;  3I3W A;  1QN4 A;  1VOK A;  1W80 A;  2HL9 A;  2OOY A;  1QN7 A;  1UL7 A;  5AN4 A;  1M3Q A;  1YTB A;  2NOZ A;  4PY5 A;  4D7Q A;  1LXT A;  1N39 A;  2H5A X;  1PCZ A;  1P5D X;  2NOL A;  1PCM X;  2O3O A;  1UT4 A;  3H1Z A;  3OC3 C;  3PMG A;  5JMV D;  4ROD B;  3RSM A;  1Q9U A;  2FUV A;  3BKQ X;  2QR1 A;  1QN8 A;  2ZFD B;  1YQL A;  1PVS A;  5IYD P;  2V8Q A;  2OOX A;  3NA5 A;  5JN5 A;  4BJU A;  1LWV A;  1QNC A;  2NOE A;  2NOI A;  2QRE A;  2NOB A;  1EUV A;  1HU0 A;  1QNA A;  1EBM A;  1KFI A;  2F7L A;  1TBP A;  1B9K A;  2JHJ A;  2HZS A;  2V92 A;  4HJH A;  3HS9 A;  1MP9 A;  3T4N A;  1N3A A;  4EJY A;  4IL8 A;  1PZD A;  1QTP A;  4C7P A;  1QNB A;  3OST A;  1KY7 A;  5IYC P;  2EHB D;  4EAG A;  4Q11 A;  3I0W A;  1YQK A;  1JFI C;  1KYU A;  2IV8 A;  4B0A A;  4QG5 A;  1YTF A;  3OGD A;  1VTL E;  1FN7 A;  1WQA A;  1KY6 A;  1JDY A;  2LAE A;  2DKC A;  4MRQ A;  3VN5 A;  3CWS A;  3EAY A;  2NVM A;  3I0X A;  2HKP A;  2YH5 A;  3TE5 A;  1C9B B;  4EAK A;  3DPU A;  2I5W A;  3CWA A;  2IV9 A;  5KL0 A;  4ROE B;  2NWV A;  2QRC A;  5IYB P;  4WZS D;  2PWW A;  1YQM A;  2FKF A;  2FKM X;  3KRM A;  3CW7 A;  2NLV A;  4D7R A;  2D0B A;  1KYD A;  1C4G A;  4EAL A;  2R5X A;  2H4L X;  4TPS A;  3F0Z A;  1PCJ X;  2Z0F A;  4CFF A;  2D0A A;  3OH9 A;  1MPG A;  1R4X A;  2MJ7 A;  4WXA A;  3PDK A;  1DIZ A;  4EJZ A;  2Z8U A;  1QTS A;  3CWU A;  1RM1 A;  2YA3 A;  2XHI A;  3DPT A;  1AIS A;  3OH6 A;  1K35 A;  4DUL A;  3TDH A;  4I8O A;  1NH2 A;  3CVT A;  3CWT A;  1QN5 A;  1NVP A;  3UW2 A;  2HL8 A;  4ROC B;  3IH7 A;  3OCI A;  1P5G X;  1VOL B;  1KO9 A;  3ENC A;  1LWW A;  4EAJ A;  2DKD A;  3F10 A;  1J3M A;  3HS8 A;  4WX8 A;  1CDW A;  3RPJ A;  1QN6 A;  1TGH A;  5HSH A;  2QRD A;  2QLV A;  1LWY A;  1E42 A;  3SNS A;  1TBA B;  1M5Q 1; 
#chains in the Genus database with same CATH homology
 3ULX A;  2JOI A;  2NOF A;  1QN3 A;  3EIK A;  2D0C A;  3ASM A;  2VJ0 A;  1YQR A;  1NGM A;  2G30 A;  3OSM A;  1M3H A;  1VTO A;  3KTU A;  1N3C A;  1D3U A;  1UT7 A;  3N89 A;  2NOH A;  2MZ8 A;  1KYF A;  1QN9 A;  1QNE A;  2HZM A;  2FGT A;  1QN4 A;  1VOK A;  1W80 A;  1QN7 A;  5AN4 A;  1YTB A;  1M3Q A;  2NOZ A;  4PY5 A;  1N39 A;  1PCZ A;  2NOL A;  2O3O A;  1UT4 A;  3H1Z A;  3OC3 C;  4ROD B;  1QN8 A;  1YQL A;  5IYD P;  1LWV A;  2NOI A;  1QNC A;  2NOE A;  2NOB A;  1HU0 A;  1QNA A;  1EBM A;  1TBP A;  1B9K A;  2HZS A;  3HS9 A;  1MP9 A;  1N3A A;  4EJY A;  1PZD A;  1QTP A;  1QNB A;  3OST A;  1KY7 A;  5IYC P;  4Q11 A;  3I0W A;  1YQK A;  1JFI C;  1KYU A;  2IV8 A;  4B0A A;  1YTF A;  1VTL E;  1FN7 A;  1KY6 A;  2LAE A;  3VN5 A;  3I0X A;  2YH5 A;  1C9B B;  3DPU A;  2I5W A;  2IV9 A;  4ROE B;  5IYB P;  4WZS D;  1YQM A;  3KRM A;  2D0B A;  1KYD A;  4TPS A;  3F0Z A;  2D0A A;  1R4X A;  2MJ7 A;  4EJZ A;  2Z8U A;  1QTS A;  1RM1 A;  2XHI A;  3DPT A;  1AIS A;  4DUL A;  4I8O A;  1NH2 A;  1QN5 A;  1NVP A;  4ROC B;  3IH7 A;  3OCI A;  1VOL B;  1KO9 A;  1LWW A;  3F10 A;  3HS8 A;  1CDW A;  1QN6 A;  1TGH A;  3RPJ A;  1LWY A;  1E42 A;  3SNS A;  1TBA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...