1TBAB

Solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR IID 230K CHAIN
publication title Solution structure of a TBP-TAF(II)230 complex: protein mimicry of the minor groove surface of the TATA box unwound by TBP.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Complex (transcription factors)
total genus 37
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1998-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbaB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbaB02
1KYFA 1QN4A 1YTFA 1VTOA 1TBAB 4ROCB 1PZDA 1E42A 5IYDP 1TGHA 2Z8UA 1QTSA 5IYCP 1QTPA 3HS8A 3OC3C 1D3UA 4PY5A 2D0CA 3OCIA 5IYBP 1C9BB 1AISA 1W80A 4B0AA 1QNCA 1VOKA 4RODB 3H1ZA 1YTBA 1NGMA 1QN5A 3HS9A 1PCZA 1KY7A 1QNAA 1VTLE 1B9KA 1TBPA 2MJ7A 1JFIC 1QN8A 1KYUA 1CDWA 3EIKA 2IV8A 1VOLB 1RM1A 2D0BA 1KYDA 2G30A 1QN3A 2D0AA 2IV9A 1NVPA 3ASMA 4ROEB 1QN6A 3VN5A 1KY6A 1MP9A 1R4XA 1QNBA 1QN7A 4WZSD 1QNEA 1NH2A 2VJ0A 1QN9A
chains in the Genus database with same CATH superfamily
2JHJA 3ULXA 1YTFA 2NOEA 4IL8A 5AN4A 3I0XA 3OSEA 3CWAA 1E42A 1EUVA 5IYDP 3I0WA 2QREA 1VKLA 2Z8UA 2OOXA 1FN7A 1QTPA 5BMPA 1Q9UA 4BJUA 4C7PA 5JMVD 1YQMA 1LXTA 5IYBP 4PY5A 2LAEA 2NOLA 1C4GA 4RODB 1TUOA 1QN5A 1PCZA 3RPJA 2V9JA 4EAGA 2DKCA 1N3CA 1TBPA 1JFIC 2H5AX 1N3AA 2HL9A 1N39A 2JHNA 1C47A 2FUVA 2G30A 2V92A 2D0AA 2IV9A 1QN6A 3VN5A 1MP9A 3SNSA 1M3HA 1QNEA 2NOZA 2F7LA 1KYFA 3DPUA 2OOYA 1TBAB 4ROCB 2R5XA 4D7RA 3CVTA 3CWTA 1TGHA 2HKPA 3OC3C 1MPGA 2EHBD 4D7QA 3RSMA 2NOBA 1KO9A 1AISA 2FKMX 4B0AA 4DULA 4CFFA 1YTBA 3BKQX 1WQAA 5EPCA 2ZFDB 3OSMA 1QNAA 3OGDA 1B9KA 1QN8A 1P5DX 1KYUA 1CDWA 2IV8A 4I8OA 3CWSA 5HSHA 1NVPA 3ENCA 2Z0FA 3D7QA 4WXAA 1QN7A 1UT4A 1EBMA 3TDHA 1WJWA 1UT7A 4WZSD 1NH2A 2YH5A 1QN9A 2XHIA 1QN4A 3EAYA 4EAJA 1VTOA 2NLVA 3KRMA 3CWUA 2HL8A 3KTUA 4HJHA 4WX8A 2QR1A 2QLVA 1QTSA 3C04A 3OLPA 4EJYA 4EAKA 3OCIA 1DIZA 4EJZA 1QNCA 3OH6A 1VOKA 3H1ZA 3HS9A 2NWVA 1JDYA 1KY7A 3CVSA 3PDKA 2HZMA 1VTLE 2MJ7A 5BMNA 2I5WA 3ENOC 1PCMX 4EALA 3DPTA 3EIKA 1HU0A 1RM1A 2D0BA 3D4VA 2QRDA 3F10A 4Q11A 1PCJX 5KL0A 4ROEB 4MRQA 1KY6A 2NOIA 1LWVA 1YQRA 1QNBA 2NOFA 3F0ZA 1LWWA 1J3MA 4EAIA 1K2YX 1LWYA 2QRCA 3IH7A 1KFIA 3T4NA 2Y8QA 2DKDA 1PZDA 4TPSA 1YQKA 1XSZA 2DKAA 5IYCP 5F9CA 3HS8A 1D3UA 1K35A 2MZ8A 2D0CA 1C9BB 2HZSA 2FKFA 2PWWA 1M5Q1 1W80A 2Y8LA 3OH9A 2JPIA 1P5GX 1V5SA 1NGMA 1KFQA 1M3QA 2H4LX 3PMGA 2O3OA 2FGTA 3NA5A 2JOIA 2V8QA 2YA3A 3TE5A 5JN5A 1T6AA 2NOHA 1PVSA 3OSTA 4QG5A 1VOLB 1KYDA 1QN3A 2NVMA 3ASMA 3UW2A 1UL7A 1R4XA 3CW7A 1YQLA 3N89A 2VJ0A 3I3WA
chains in the Genus database with same CATH topology
3ULXA 1YTFA 2NOEA 5AN4A 3I0XA 1E42A 5IYDP 3I0WA 2Z8UA 1FN7A 1QTPA 1YQMA 4PY5A 5IYBP 2LAEA 2NOLA 4RODB 1QN5A 1PCZA 3RPJA 1N3CA 1TBPA 1JFIC 1N3AA 1N39A 2G30A 2D0AA 2IV9A 1QN6A 3VN5A 1MP9A 3SNSA 1M3HA 1QNEA 2NOZA 1KYFA 3DPUA 1TBAB 4ROCB 1TGHA 3OC3C 2NOBA 1KO9A 1AISA 4DULA 4B0AA 1YTBA 3OSMA 1QNAA 1B9KA 1QN8A 1KYUA 1CDWA 2IV8A 4I8OA 1NVPA 1QN7A 1UT4A 1EBMA 4WZSD 1UT7A 1NH2A 2YH5A 1QN9A 2XHIA 1QN4A 1VTOA 3KRMA 3KTUA 1QTSA 4EJYA 3OCIA 4EJZA 1QNCA 1VOKA 3H1ZA 3HS9A 1KY7A 2HZMA 1VTLE 2MJ7A 2I5WA 3DPTA 3EIKA 1HU0A 1RM1A 2D0BA 3F10A 4Q11A 4ROEB 2NOIA 1KY6A 1LWVA 1YQRA 1QNBA 2NOFA 3F0ZA 1LWWA 1LWYA 3IH7A 1PZDA 4TPSA 1YQKA 5IYCP 1D3UA 3HS8A 2MZ8A 2D0CA 1C9BB 2HZSA 1W80A 1NGMA 1M3QA 2O3OA 2FGTA 2JOIA 2NOHA 3OSTA 1VOLB 1KYDA 1QN3A 3ASMA 1R4XA 1YQLA 3N89A 2VJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYF A;  1QN4 A;  1YTF A;  1VTO A;  1TBA B;  4ROC B;  1PZD A;  1E42 A;  5IYD P;  1TGH A;  2Z8U A;  1QTS A;  5IYC P;  1QTP A;  3HS8 A;  3OC3 C;  1D3U A;  4PY5 A;  2D0C A;  3OCI A;  5IYB P;  1C9B B;  1AIS A;  1W80 A;  4B0A A;  1QNC A;  1VOK A;  4ROD B;  3H1Z A;  1YTB A;  1NGM A;  1QN5 A;  3HS9 A;  1PCZ A;  1KY7 A;  1QNA A;  1VTL E;  1B9K A;  1TBP A;  2MJ7 A;  1JFI C;  1QN8 A;  1KYU A;  1CDW A;  3EIK A;  2IV8 A;  1VOL B;  1RM1 A;  2D0B A;  1KYD A;  2G30 A;  1QN3 A;  2D0A A;  2IV9 A;  1NVP A;  3ASM A;  4ROE B;  1QN6 A;  3VN5 A;  1KY6 A;  1MP9 A;  1R4X A;  1QNB A;  1QN7 A;  4WZS D;  1QNE A;  1NH2 A;  2VJ0 A;  1QN9 A; 
#chains in the Genus database with same CATH topology
 2JHJ A;  3ULX A;  1YTF A;  2NOE A;  4IL8 A;  5AN4 A;  3I0X A;  3OSE A;  3CWA A;  1E42 A;  1EUV A;  5IYD P;  3I0W A;  2QRE A;  1VKL A;  2Z8U A;  2OOX A;  1FN7 A;  1QTP A;  5BMP A;  1Q9U A;  4BJU A;  4C7P A;  5JMV D;  1YQM A;  1LXT A;  5IYB P;  4PY5 A;  2LAE A;  2NOL A;  1C4G A;  4ROD B;  1TUO A;  1QN5 A;  1PCZ A;  3RPJ A;  2V9J A;  4EAG A;  2DKC A;  1N3C A;  1TBP A;  1JFI C;  2H5A X;  1N3A A;  2HL9 A;  1N39 A;  2JHN A;  1C47 A;  2FUV A;  2G30 A;  2V92 A;  2D0A A;  2IV9 A;  1QN6 A;  3VN5 A;  1MP9 A;  3SNS A;  1M3H A;  1QNE A;  2NOZ A;  2F7L A;  1KYF A;  3DPU A;  2OOY A;  1TBA B;  4ROC B;  2R5X A;  4D7R A;  3CVT A;  3CWT A;  1TGH A;  2HKP A;  3OC3 C;  1MPG A;  2EHB D;  4D7Q A;  3RSM A;  2NOB A;  1KO9 A;  1AIS A;  2FKM X;  4B0A A;  4DUL A;  4CFF A;  1YTB A;  3BKQ X;  1WQA A;  5EPC A;  2ZFD B;  3OSM A;  1QNA A;  3OGD A;  1B9K A;  1QN8 A;  1P5D X;  1KYU A;  1CDW A;  2IV8 A;  4I8O A;  3CWS A;  5HSH A;  1NVP A;  3ENC A;  2Z0F A;  3D7Q A;  4WXA A;  1QN7 A;  1UT4 A;  1EBM A;  3TDH A;  1WJW A;  1UT7 A;  4WZS D;  1NH2 A;  2YH5 A;  1QN9 A;  2XHI A;  1QN4 A;  3EAY A;  4EAJ A;  1VTO A;  2NLV A;  3KRM A;  3CWU A;  2HL8 A;  3KTU A;  4HJH A;  4WX8 A;  2QR1 A;  2QLV A;  1QTS A;  3C04 A;  3OLP A;  4EJY A;  4EAK A;  3OCI A;  1DIZ A;  4EJZ A;  1QNC A;  3OH6 A;  1VOK A;  3H1Z A;  3HS9 A;  2NWV A;  1JDY A;  1KY7 A;  3CVS A;  3PDK A;  2HZM A;  1VTL E;  2MJ7 A;  5BMN A;  2I5W A;  3ENO C;  1PCM X;  4EAL A;  3DPT A;  3EIK A;  1HU0 A;  1RM1 A;  2D0B A;  3D4V A;  2QRD A;  3F10 A;  4Q11 A;  1PCJ X;  5KL0 A;  4ROE B;  4MRQ A;  1KY6 A;  2NOI A;  1LWV A;  1YQR A;  1QNB A;  2NOF A;  3F0Z A;  1LWW A;  1J3M A;  4EAI A;  1K2Y X;  1LWY A;  2QRC A;  3IH7 A;  1KFI A;  3T4N A;  2Y8Q A;  2DKD A;  1PZD A;  4TPS A;  1YQK A;  1XSZ A;  2DKA A;  5IYC P;  5F9C A;  3HS8 A;  1D3U A;  1K35 A;  2MZ8 A;  2D0C A;  1C9B B;  2HZS A;  2FKF A;  2PWW A;  1M5Q 1;  1W80 A;  2Y8L A;  3OH9 A;  2JPI A;  1P5G X;  1V5S A;  1NGM A;  1KFQ A;  1M3Q A;  2H4L X;  3PMG A;  2O3O A;  2FGT A;  3NA5 A;  2JOI A;  2V8Q A;  2YA3 A;  3TE5 A;  5JN5 A;  1T6A A;  2NOH A;  1PVS A;  3OST A;  4QG5 A;  1VOL B;  1KYD A;  1QN3 A;  2NVM A;  3ASM A;  3UW2 A;  1UL7 A;  1R4X A;  3CW7 A;  1YQL A;  3N89 A;  2VJ0 A;  3I3W A; 
#chains in the Genus database with same CATH homology
 3ULX A;  1YTF A;  2NOE A;  5AN4 A;  3I0X A;  1E42 A;  5IYD P;  3I0W A;  2Z8U A;  1FN7 A;  1QTP A;  1YQM A;  4PY5 A;  5IYB P;  2LAE A;  2NOL A;  4ROD B;  1QN5 A;  1PCZ A;  3RPJ A;  1N3C A;  1TBP A;  1JFI C;  1N3A A;  1N39 A;  2G30 A;  2D0A A;  2IV9 A;  1QN6 A;  3VN5 A;  1MP9 A;  3SNS A;  1M3H A;  1QNE A;  2NOZ A;  1KYF A;  3DPU A;  1TBA B;  4ROC B;  1TGH A;  3OC3 C;  2NOB A;  1KO9 A;  1AIS A;  4DUL A;  4B0A A;  1YTB A;  3OSM A;  1QNA A;  1B9K A;  1QN8 A;  1KYU A;  1CDW A;  2IV8 A;  4I8O A;  1NVP A;  1QN7 A;  1UT4 A;  1EBM A;  4WZS D;  1UT7 A;  1NH2 A;  2YH5 A;  1QN9 A;  2XHI A;  1QN4 A;  1VTO A;  3KRM A;  3KTU A;  1QTS A;  4EJY A;  3OCI A;  4EJZ A;  1QNC A;  1VOK A;  3H1Z A;  3HS9 A;  1KY7 A;  2HZM A;  1VTL E;  2MJ7 A;  2I5W A;  3DPT A;  3EIK A;  1HU0 A;  1RM1 A;  2D0B A;  3F10 A;  4Q11 A;  4ROE B;  2NOI A;  1KY6 A;  1LWV A;  1YQR A;  1QNB A;  2NOF A;  3F0Z A;  1LWW A;  1LWY A;  3IH7 A;  1PZD A;  4TPS A;  1YQK A;  5IYC P;  1D3U A;  3HS8 A;  2MZ8 A;  2D0C A;  1C9B B;  2HZS A;  1W80 A;  1NGM A;  1M3Q A;  2O3O A;  2FGT A;  2JOI A;  2NOH A;  3OST A;  1VOL B;  1KYD A;  1QN3 A;  3ASM A;  1R4X A;  1YQL A;  3N89 A;  2VJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...