1TBAB

Solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
180
structure length
180
Chain Sequence
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (transcription factors)
molecule keywords TRANSCRIPTION INITIATION FACTOR IID 230K CHAIN
publication title Solution structure of a TBP-TAF(II)230 complex: protein mimicry of the minor groove surface of the TATA box unwound by TBP.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 37
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 1998-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbaB01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1tbaB02
3EIKA 1QN5A 1QN8A 1KYFA 1E42A 2Z8UA 1QN3A 1VTLE 1TBPA 2VJ0A 1QN7A 2IV8A 1QNAA 1VOLB 1NVPA 1TGHA 1B9KA 1YTFA 2D0BA 3HS9A 4B0AA 1C9BB 1KY7A 3H1ZA 1KYUA 1JFIC 4WZSD 2MJ7A 3OCIA 5IYDP 1TBAB 4PY5A 1MP9A 1KY6A 2G30A 1VOKA 3OC3C 5IYBP 1D3UA 1NGMA 1QN9A 4RODB 1QN4A 3HS8A 1PZDA 4ROCB 1QNEA 1QNBA 1AISA 1RM1A 1NH2A 2D0AA 2D0CA 1VTOA 1QNCA 1CDWA 1QTPA 3VN5A 4ROEB 1KYDA 3ASMA 1YTBA 1W80A 1QN6A 1R4XA 5IYCP 2IV9A 1PCZA 1QTSA
chains in the Genus database with same CATH superfamily
2JHJA 3PDKA 1LXTA 3OH9A 1QN8A 1E42A 2QLVA 1PCMX 1TBPA 1LWVA 3DPUA 1UL7A 1P5DX 1VOLB 1HU0A 2NOEA 3CVTA 2YH5A 1YTFA 1V5SA 3OSEA 1C9BB 4WXAA 3D7QA 3H1ZA 2I5WA 2V92A 2HL9A 3TDHA 1VOKA 1XSZA 4ROCB 1QNEA 3CWAA 1M5Q1 2JHNA 1RM1A 1AISA 4EJZA 1NH2A 5JMVD 5EPCA 1UT4A 1FN7A 2HL8A 4I8OA 3VN5A 3F10A 4ROEB 3KTUA 2FKFA 2PWWA 3CWTA 4Q11A 1WJWA 4CFFA 4MRQA 2V9JA 1YQRA 1WQAA 1EUVA 3C04A 2NVMA 4D7RA 1PVSA 1VTLE 4D7QA 5BMNA 1QNAA 1PCJX 3N89A 4QG5A 3OGDA 2NOBA 3RSMA 1C47A 1KYUA 1UT7A 3ENOC 3SNSA 3OCIA 3CWUA 1YQMA 4PY5A 2G30A 4TPSA 4IL8A 1M3HA 2Y8LA 3OC3C 1K35A 2F7LA 5AN4A 1QN4A 2HKPA 3HS8A 2NOLA 3F0ZA 3OH6A 3KRMA 2QRDA 2D0AA 2ZFDB 5F9CA 3BKQX 1VTOA 2NOFA 1J3MA 2DKDA 4EAKA 1QTPA 4BJUA 3ASMA 1YTBA 1QN6A 2NLVA 5IYCP 1PCZA 3DPTA 4EAGA 3OLPA 2XHIA 3D4VA 1QTSA 1YQKA 3CW7A 2QREA 1KYFA 2H4LX 1KFIA 1MPGA 2VJ0A 1P5GX 2NOHA 2IV8A 1KFQA 1LWYA 2Y8QA 1B9KA 3HS9A 2O3OA 5HSHA 4EAJA 1Q9UA 1KO9A 2MJ7A 1YQLA 1JFIC 5IYDP 1T6AA 1KY6A 2JOIA 1TUOA 5IYBP 3I0XA 3TE5A 5BMPA 4EAIA 1NGMA 1D3UA 1QN9A 1DIZA 3PMGA 3EAYA 1EBMA 2HZSA 2FUVA 1CDWA 2DKCA 3OSMA 5KL0A 4WX8A 1W80A 2JPIA 2LAEA 1R4XA 3T4NA 5JN5A 3CWSA 2MZ8A 1VKLA 2HZMA 2NOZA 3EIKA 3I3WA 1QN5A 2OOYA 2Z8UA 1K2YX 1N39A 2FGTA 4DULA 1C4GA 1QN3A 2EHBD 1QN7A 4C7PA 1NVPA 1TGHA 3NA5A 3UW2A 1M3QA 2D0BA 3CVSA 4B0AA 4EALA 1LWWA 1KY7A 2R5XA 2V8QA 1JDYA 4WZSD 2QRCA 4EJYA 1TBAB 1N3AA 2DKAA 1MP9A 2H5AX 2Z0FA 4HJHA 2NWVA 3ENCA 4RODB 1PZDA 1N3CA 1QNBA 3IH7A 2FKMX 2OOXA 3RPJA 3ULXA 2D0CA 3OSTA 3I0WA 1QNCA 2QR1A 1KYDA 2NOIA 2IV9A 2YA3A
chains in the Genus database with same CATH topology
1QN8A 1E42A 1TBPA 1LWVA 3DPUA 1VOLB 1HU0A 2NOEA 2YH5A 1YTFA 1C9BB 3H1ZA 2I5WA 1VOKA 4ROCB 1QNEA 1AISA 1RM1A 4EJZA 1NH2A 1UT4A 1FN7A 4I8OA 3VN5A 3F10A 4ROEB 3KTUA 4Q11A 1YQRA 1VTLE 1QNAA 3N89A 2NOBA 1KYUA 1UT7A 3SNSA 3OCIA 1YQMA 4PY5A 2G30A 4TPSA 1M3HA 3OC3C 1QN4A 5AN4A 3HS8A 2NOLA 3F0ZA 3KRMA 2D0AA 1VTOA 2NOFA 1QTPA 3ASMA 1YTBA 1QN6A 5IYCP 1PCZA 2XHIA 3DPTA 1YQKA 1QTSA 1KYFA 2VJ0A 2NOHA 2IV8A 1LWYA 1B9KA 3HS9A 2O3OA 1JFIC 1YQLA 1KO9A 2MJ7A 5IYDP 1KY6A 2JOIA 5IYBP 3I0XA 1D3UA 1NGMA 1QN9A 1EBMA 2HZSA 1CDWA 3OSMA 1W80A 2LAEA 1R4XA 2MZ8A 2HZMA 2NOZA 3EIKA 1QN5A 2Z8UA 1QN3A 1N39A 2FGTA 4DULA 1QN7A 1NVPA 1TGHA 1M3QA 2D0BA 4B0AA 1LWWA 1KY7A 4EJYA 4WZSD 1TBAB 1N3AA 1MP9A 4RODB 1PZDA 1N3CA 1QNBA 3IH7A 3RPJA 3ULXA 2D0CA 3OSTA 3I0WA 1QNCA 1KYDA 2NOIA 2IV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIK A;  1QN5 A;  1QN8 A;  1KYF A;  1E42 A;  2Z8U A;  1QN3 A;  1VTL E;  1TBP A;  2VJ0 A;  1QN7 A;  2IV8 A;  1QNA A;  1VOL B;  1NVP A;  1TGH A;  1B9K A;  1YTF A;  2D0B A;  3HS9 A;  4B0A A;  1C9B B;  1KY7 A;  3H1Z A;  1KYU A;  1JFI C;  4WZS D;  2MJ7 A;  3OCI A;  5IYD P;  1TBA B;  4PY5 A;  1MP9 A;  1KY6 A;  2G30 A;  1VOK A;  3OC3 C;  5IYB P;  1D3U A;  1NGM A;  1QN9 A;  4ROD B;  1QN4 A;  3HS8 A;  1PZD A;  4ROC B;  1QNE A;  1QNB A;  1AIS A;  1RM1 A;  1NH2 A;  2D0A A;  2D0C A;  1VTO A;  1QNC A;  1CDW A;  1QTP A;  3VN5 A;  4ROE B;  1KYD A;  3ASM A;  1YTB A;  1W80 A;  1QN6 A;  1R4X A;  5IYC P;  2IV9 A;  1PCZ A;  1QTS A; 
#chains in the Genus database with same CATH topology
 2JHJ A;  3PDK A;  1LXT A;  3OH9 A;  1QN8 A;  1E42 A;  2QLV A;  1PCM X;  1TBP A;  1LWV A;  3DPU A;  1UL7 A;  1P5D X;  1VOL B;  1HU0 A;  2NOE A;  3CVT A;  2YH5 A;  1YTF A;  1V5S A;  3OSE A;  1C9B B;  4WXA A;  3D7Q A;  3H1Z A;  2I5W A;  2V92 A;  2HL9 A;  3TDH A;  1VOK A;  1XSZ A;  4ROC B;  1QNE A;  3CWA A;  1M5Q 1;  2JHN A;  1RM1 A;  1AIS A;  4EJZ A;  1NH2 A;  5JMV D;  5EPC A;  1UT4 A;  1FN7 A;  2HL8 A;  4I8O A;  3VN5 A;  3F10 A;  4ROE B;  3KTU A;  2FKF A;  2PWW A;  3CWT A;  4Q11 A;  1WJW A;  4CFF A;  4MRQ A;  2V9J A;  1YQR A;  1WQA A;  1EUV A;  3C04 A;  2NVM A;  4D7R A;  1PVS A;  1VTL E;  4D7Q A;  5BMN A;  1QNA A;  1PCJ X;  3N89 A;  4QG5 A;  3OGD A;  2NOB A;  3RSM A;  1C47 A;  1KYU A;  1UT7 A;  3ENO C;  3SNS A;  3OCI A;  3CWU A;  1YQM A;  4PY5 A;  2G30 A;  4TPS A;  4IL8 A;  1M3H A;  2Y8L A;  3OC3 C;  1K35 A;  2F7L A;  5AN4 A;  1QN4 A;  2HKP A;  3HS8 A;  2NOL A;  3F0Z A;  3OH6 A;  3KRM A;  2QRD A;  2D0A A;  2ZFD B;  5F9C A;  3BKQ X;  1VTO A;  2NOF A;  1J3M A;  2DKD A;  4EAK A;  1QTP A;  4BJU A;  3ASM A;  1YTB A;  1QN6 A;  2NLV A;  5IYC P;  1PCZ A;  3DPT A;  4EAG A;  3OLP A;  2XHI A;  3D4V A;  1QTS A;  1YQK A;  3CW7 A;  2QRE A;  1KYF A;  2H4L X;  1KFI A;  1MPG A;  2VJ0 A;  1P5G X;  2NOH A;  2IV8 A;  1KFQ A;  1LWY A;  2Y8Q A;  1B9K A;  3HS9 A;  2O3O A;  5HSH A;  4EAJ A;  1Q9U A;  1KO9 A;  2MJ7 A;  1YQL A;  1JFI C;  5IYD P;  1T6A A;  1KY6 A;  2JOI A;  1TUO A;  5IYB P;  3I0X A;  3TE5 A;  5BMP A;  4EAI A;  1NGM A;  1D3U A;  1QN9 A;  1DIZ A;  3PMG A;  3EAY A;  1EBM A;  2HZS A;  2FUV A;  1CDW A;  2DKC A;  3OSM A;  5KL0 A;  4WX8 A;  1W80 A;  2JPI A;  2LAE A;  1R4X A;  3T4N A;  5JN5 A;  3CWS A;  2MZ8 A;  1VKL A;  2HZM A;  2NOZ A;  3EIK A;  3I3W A;  1QN5 A;  2OOY A;  2Z8U A;  1K2Y X;  1N39 A;  2FGT A;  4DUL A;  1C4G A;  1QN3 A;  2EHB D;  1QN7 A;  4C7P A;  1NVP A;  1TGH A;  3NA5 A;  3UW2 A;  1M3Q A;  2D0B A;  3CVS A;  4B0A A;  4EAL A;  1LWW A;  1KY7 A;  2R5X A;  2V8Q A;  1JDY A;  4WZS D;  2QRC A;  4EJY A;  1TBA B;  1N3A A;  2DKA A;  1MP9 A;  2H5A X;  2Z0F A;  4HJH A;  2NWV A;  3ENC A;  4ROD B;  1PZD A;  1N3C A;  1QNB A;  3IH7 A;  2FKM X;  2OOX A;  3RPJ A;  3ULX A;  2D0C A;  3OST A;  3I0W A;  1QNC A;  2QR1 A;  1KYD A;  2NOI A;  2IV9 A;  2YA3 A; 
#chains in the Genus database with same CATH homology
 1QN8 A;  1E42 A;  1TBP A;  1LWV A;  3DPU A;  1VOL B;  1HU0 A;  2NOE A;  2YH5 A;  1YTF A;  1C9B B;  3H1Z A;  2I5W A;  1VOK A;  4ROC B;  1QNE A;  1AIS A;  1RM1 A;  4EJZ A;  1NH2 A;  1UT4 A;  1FN7 A;  4I8O A;  3VN5 A;  3F10 A;  4ROE B;  3KTU A;  4Q11 A;  1YQR A;  1VTL E;  1QNA A;  3N89 A;  2NOB A;  1KYU A;  1UT7 A;  3SNS A;  3OCI A;  1YQM A;  4PY5 A;  2G30 A;  4TPS A;  1M3H A;  3OC3 C;  1QN4 A;  5AN4 A;  3HS8 A;  2NOL A;  3F0Z A;  3KRM A;  2D0A A;  1VTO A;  2NOF A;  1QTP A;  3ASM A;  1YTB A;  1QN6 A;  5IYC P;  1PCZ A;  2XHI A;  3DPT A;  1YQK A;  1QTS A;  1KYF A;  2VJ0 A;  2NOH A;  2IV8 A;  1LWY A;  1B9K A;  3HS9 A;  2O3O A;  1JFI C;  1YQL A;  1KO9 A;  2MJ7 A;  5IYD P;  1KY6 A;  2JOI A;  5IYB P;  3I0X A;  1D3U A;  1NGM A;  1QN9 A;  1EBM A;  2HZS A;  1CDW A;  3OSM A;  1W80 A;  2LAE A;  1R4X A;  2MZ8 A;  2HZM A;  2NOZ A;  3EIK A;  1QN5 A;  2Z8U A;  1QN3 A;  1N39 A;  2FGT A;  4DUL A;  1QN7 A;  1NVP A;  1TGH A;  1M3Q A;  2D0B A;  4B0A A;  1LWW A;  1KY7 A;  4EJY A;  4WZS D;  1TBA B;  1N3A A;  1MP9 A;  4ROD B;  1PZD A;  1N3C A;  1QNB A;  3IH7 A;  3RPJ A;  3ULX A;  2D0C A;  3OST A;  3I0W A;  1QNC A;  1KYD A;  2NOI A;  2IV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...