4Q11A

Crystal structure of proteus mirabilis transcriptional regulator protein crl at 1.95a resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
126
structure length
126
Chain Sequence
PTRGKLLKRFAQIGPYIREQQCQESQFFFDCLAVCVNKKVTPEKREFWGWWMELERNGEQLIYYYQVGLFDKNGDWVNQVISKKDVIESIHETLIRFHDFLQAAVSELEMTLVPDEKMSNFPLPLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Sigma factor-binding protein Crl
publication title Structural and functional features of Crl proteins and identification of conserved surface residues required for interaction with the RpoS/ sigma S subunit of RNA polymerase.
pubmed doi rcsb
source organism Proteus mirabilis
total genus 37
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07417 Crl Sigma factor-binding transcriptional regulator Crl
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.230 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 4q11A00
3RPJA 2MZ8A 4Q11A
chains in the Genus database with same CATH superfamily
2QR1A 3ENCA 1FN7A 2NOLA 1QNAA 2HL9A 2JHNA 3ASMA 3NA5A 4EALA 2V8QA 3OLPA 1EUVA 2NOBA 2NOIA 1WJWA 1K35A 1C9BB 2Y8LA 2FGTA 2NOHA 3SNSA 3CWTA 1WQAA 2O3OA 2R5XA 3N89A 2JHJA 2Z8UA 2F7LA 4WXAA 4MRQA 2D0CA 1HU0A 3ULXA 1EBMA 1PVSA 2NVMA 3OSTA 3CWSA 4I8OA 5JMVD 1J3MA 2JPIA 2NOZA 1XSZA 3OGDA 2G30A 1N3CA 4HJHA 2D0AA 1LWYA 2NOEA 2NWVA 4IL8A 5BMNA 1N3AA 4EJYA 1PZDA 5JN5A 4QG5A 1TBAB 4BJUA 3EIKA 1KY6A 5IYBP 5F9CA 3C04A 1QN4A 1YTFA 3EAYA 1YQKA 1C47A 4RODB 4WX8A 4EAKA 1W80A 1RM1A 1M3HA 3RSMA 2HL8A 1UL7A 5HSHA 2OOXA 4EAIA 3OCIA 4WZSD 1MP9A 1B9KA 1N39A 1QN8A 2MZ8A 3BKQX 1QTSA 2IV8A 1VTLE 4ROEB 1AISA 1V5SA 4EAGA 3I0WA 1NGMA 3OSEA 4ROCB 1NVPA 2MJ7A 1YTBA 4B0AA 3CWUA 1QTPA 4D7QA 2FKMX 2EHBD 5EPCA 1K2YX 1LWWA 2JOIA 1LXTA 1QNCA 2H4LX 3F0ZA 1PCZA 3TE5A 1P5DX 3PDKA 1YQMA 1UT4A 3OSMA 1YQRA 3CWAA 1QNBA 5IYCP 1VOKA 1PCJX 3CVSA 1NH2A 3DPTA 4EAJA 3DPUA 2XHIA 1MPGA 1M3QA 1VKLA 1E42A 4D7RA 4TPSA 3HS8A 1YQLA 1QN9A 1KYFA 3TDHA 3H1ZA 5KL0A 3VN5A 1VOLB 2NOFA 2HZSA 2HZMA 2DKCA 5IYDP 1QN5A 3D4VA 1PCMX 2VJ0A 2IV9A 2H5AX 2V9JA 1C4GA 2NLVA 3OC3C 3KRMA 2HKPA 3I3WA 2FUVA 2QRCA 3I0XA 1KYDA 1QNEA 2I5WA 1UT7A 2PWWA 2QREA 1Q9UA 2QLVA 2YH5A 3F10A 2FKFA 4CFFA 1KY7A 1JFIC 1QN6A 4C7PA 3IH7A 2YA3A 1KFQA 3CW7A 2Y8QA 1R4XA 1TUOA 4Q11A 4EJZA 1KFIA 3ENOC 3HS9A 1CDWA 1QN7A 1QN3A 2Z0FA 1JDYA 2V92A 4DULA 2ZFDB 1LWVA 5BMPA 3RPJA 3CVTA 2D0BA 2LAEA 3KTUA 2DKAA 3PMGA 2DKDA 3UW2A 1TBPA 3OH9A 1VTOA 3OH6A 1TGHA 5AN4A 2QRDA 2OOYA 3T4NA 1DIZA 1KO9A 1M5Q1 1P5GX 1T6AA 1D3UA 1KYUA 4PY5A 3D7QA
chains in the Genus database with same CATH topology
1FN7A 2NOLA 1QNAA 3ASMA 2NOBA 2NOIA 1C9BB 2FGTA 2NOHA 3SNSA 2O3OA 3N89A 2Z8UA 2D0CA 1HU0A 3ULXA 1EBMA 3OSTA 4I8OA 2NOZA 2G30A 1N3CA 2D0AA 1LWYA 2NOEA 1N3AA 4EJYA 1PZDA 1TBAB 3EIKA 1KY6A 5IYBP 1YTFA 1QN4A 1YQKA 4RODB 1W80A 1RM1A 1M3HA 4WZSD 3OCIA 1MP9A 1B9KA 1N39A 1QN8A 2MZ8A 1QTSA 2IV8A 1VTLE 4ROEB 1AISA 3I0WA 1NGMA 4ROCB 1NVPA 2MJ7A 1YTBA 4B0AA 1QTPA 1LWWA 2JOIA 1QNCA 3F0ZA 1PCZA 1YQMA 1UT4A 3OSMA 1YQRA 1QNBA 5IYCP 1VOKA 1NH2A 3DPTA 3DPUA 2XHIA 1M3QA 1E42A 1YQLA 4TPSA 3HS8A 1QN9A 1KYFA 3H1ZA 3VN5A 1VOLB 2NOFA 2HZSA 2HZMA 5IYDP 1QN5A 2VJ0A 2IV9A 3OC3C 3KRMA 3I0XA 1KYDA 1QNEA 2I5WA 1UT7A 1JFIC 3F10A 2YH5A 1QN6A 1KY7A 3IH7A 1R4XA 4Q11A 4EJZA 3HS9A 1CDWA 1QN7A 1QN3A 4DULA 1LWVA 3RPJA 2D0BA 2LAEA 3KTUA 1VTOA 1TBPA 1TGHA 5AN4A 1KO9A 1D3UA 1KYUA 4PY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPJ A;  2MZ8 A;  4Q11 A; 
#chains in the Genus database with same CATH topology
 2QR1 A;  3ENC A;  1FN7 A;  2NOL A;  1QNA A;  2HL9 A;  2JHN A;  3ASM A;  3NA5 A;  4EAL A;  2V8Q A;  3OLP A;  1EUV A;  2NOB A;  2NOI A;  1WJW A;  1K35 A;  1C9B B;  2Y8L A;  2FGT A;  2NOH A;  3SNS A;  3CWT A;  1WQA A;  2O3O A;  2R5X A;  3N89 A;  2JHJ A;  2Z8U A;  2F7L A;  4WXA A;  4MRQ A;  2D0C A;  1HU0 A;  3ULX A;  1EBM A;  1PVS A;  2NVM A;  3OST A;  3CWS A;  4I8O A;  5JMV D;  1J3M A;  2JPI A;  2NOZ A;  1XSZ A;  3OGD A;  2G30 A;  1N3C A;  4HJH A;  2D0A A;  1LWY A;  2NOE A;  2NWV A;  4IL8 A;  5BMN A;  1N3A A;  4EJY A;  1PZD A;  5JN5 A;  4QG5 A;  1TBA B;  4BJU A;  3EIK A;  1KY6 A;  5IYB P;  5F9C A;  3C04 A;  1QN4 A;  1YTF A;  3EAY A;  1YQK A;  1C47 A;  4ROD B;  4WX8 A;  4EAK A;  1W80 A;  1RM1 A;  1M3H A;  3RSM A;  2HL8 A;  1UL7 A;  5HSH A;  2OOX A;  4EAI A;  3OCI A;  4WZS D;  1MP9 A;  1B9K A;  1N39 A;  1QN8 A;  2MZ8 A;  3BKQ X;  1QTS A;  2IV8 A;  1VTL E;  4ROE B;  1AIS A;  1V5S A;  4EAG A;  3I0W A;  1NGM A;  3OSE A;  4ROC B;  1NVP A;  2MJ7 A;  1YTB A;  4B0A A;  3CWU A;  1QTP A;  4D7Q A;  2FKM X;  2EHB D;  5EPC A;  1K2Y X;  1LWW A;  2JOI A;  1LXT A;  1QNC A;  2H4L X;  3F0Z A;  1PCZ A;  3TE5 A;  1P5D X;  3PDK A;  1YQM A;  1UT4 A;  3OSM A;  1YQR A;  3CWA A;  1QNB A;  5IYC P;  1VOK A;  1PCJ X;  3CVS A;  1NH2 A;  3DPT A;  4EAJ A;  3DPU A;  2XHI A;  1MPG A;  1M3Q A;  1VKL A;  1E42 A;  4D7R A;  4TPS A;  3HS8 A;  1YQL A;  1QN9 A;  1KYF A;  3TDH A;  3H1Z A;  5KL0 A;  3VN5 A;  1VOL B;  2NOF A;  2HZS A;  2HZM A;  2DKC A;  5IYD P;  1QN5 A;  3D4V A;  1PCM X;  2VJ0 A;  2IV9 A;  2H5A X;  2V9J A;  1C4G A;  2NLV A;  3OC3 C;  3KRM A;  2HKP A;  3I3W A;  2FUV A;  2QRC A;  3I0X A;  1KYD A;  1QNE A;  2I5W A;  1UT7 A;  2PWW A;  2QRE A;  1Q9U A;  2QLV A;  2YH5 A;  3F10 A;  2FKF A;  4CFF A;  1KY7 A;  1JFI C;  1QN6 A;  4C7P A;  3IH7 A;  2YA3 A;  1KFQ A;  3CW7 A;  2Y8Q A;  1R4X A;  1TUO A;  4Q11 A;  4EJZ A;  1KFI A;  3ENO C;  3HS9 A;  1CDW A;  1QN7 A;  1QN3 A;  2Z0F A;  1JDY A;  2V92 A;  4DUL A;  2ZFD B;  1LWV A;  5BMP A;  3RPJ A;  3CVT A;  2D0B A;  2LAE A;  3KTU A;  2DKA A;  3PMG A;  2DKD A;  3UW2 A;  1TBP A;  3OH9 A;  1VTO A;  3OH6 A;  1TGH A;  5AN4 A;  2QRD A;  2OOY A;  3T4N A;  1DIZ A;  1KO9 A;  1M5Q 1;  1P5G X;  1T6A A;  1D3U A;  1KYU A;  4PY5 A;  3D7Q A; 
#chains in the Genus database with same CATH homology
 1FN7 A;  2NOL A;  1QNA A;  3ASM A;  2NOB A;  2NOI A;  1C9B B;  2FGT A;  2NOH A;  3SNS A;  2O3O A;  3N89 A;  2Z8U A;  2D0C A;  1HU0 A;  3ULX A;  1EBM A;  3OST A;  4I8O A;  2NOZ A;  2G30 A;  1N3C A;  2D0A A;  1LWY A;  2NOE A;  1N3A A;  4EJY A;  1PZD A;  1TBA B;  3EIK A;  1KY6 A;  5IYB P;  1YTF A;  1QN4 A;  1YQK A;  4ROD B;  1W80 A;  1RM1 A;  1M3H A;  4WZS D;  3OCI A;  1MP9 A;  1B9K A;  1N39 A;  1QN8 A;  2MZ8 A;  1QTS A;  2IV8 A;  1VTL E;  4ROE B;  1AIS A;  3I0W A;  1NGM A;  4ROC B;  1NVP A;  2MJ7 A;  1YTB A;  4B0A A;  1QTP A;  1LWW A;  2JOI A;  1QNC A;  3F0Z A;  1PCZ A;  1YQM A;  1UT4 A;  3OSM A;  1YQR A;  1QNB A;  5IYC P;  1VOK A;  1NH2 A;  3DPT A;  3DPU A;  2XHI A;  1M3Q A;  1E42 A;  1YQL A;  4TPS A;  3HS8 A;  1QN9 A;  1KYF A;  3H1Z A;  3VN5 A;  1VOL B;  2NOF A;  2HZS A;  2HZM A;  5IYD P;  1QN5 A;  2VJ0 A;  2IV9 A;  3OC3 C;  3KRM A;  3I0X A;  1KYD A;  1QNE A;  2I5W A;  1UT7 A;  1JFI C;  3F10 A;  2YH5 A;  1QN6 A;  1KY7 A;  3IH7 A;  1R4X A;  4Q11 A;  4EJZ A;  3HS9 A;  1CDW A;  1QN7 A;  1QN3 A;  4DUL A;  1LWV A;  3RPJ A;  2D0B A;  2LAE A;  3KTU A;  1VTO A;  1TBP A;  1TGH A;  5AN4 A;  1KO9 A;  1D3U A;  1KYU A;  4PY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...