1QN3A

Crystal structure of the c(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tata box-binding protein (tbp)
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn3A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn3A02
1TGHA 3ASMA 1QN9A 1PCZA 1KYDA 1AISA 1C9BB 1QN7A 1KYFA 3OCIA 2D0BA 1MP9A 1QNEA 4PY5A 3HS8A 1B9KA 1KY7A 2IV9A 2VJ0A 5IYDP 2IV8A 1RM1A 4ROEB 3H1ZA 1YTFA 1VOKA 1QN3A 1YTBA 1VTOA 2D0CA 1NVPA 2MJ7A 1E42A 1QTSA 1QTPA 4WZSD 1VTLE 1QNCA 1VOLB 2G30A 3EIKA 1QNAA 1QN8A 1TBAB 1TBPA 1D3UA 1JFIC 2D0AA 1R4XA 1KY6A 2Z8UA 4B0AA 1PZDA 5IYBP 4RODB 1QNBA 3HS9A 1NGMA 1CDWA 3VN5A 1NH2A 1KYUA 1W80A 5IYCP 3OC3C 4ROCB 1QN5A 1QN6A 1QN4A
chains in the Genus database with same CATH superfamily
3DPTA 2PWWA 1UT4A 1N3CA 1PCZA 2MZ8A 1AISA 3CVTA 2NOHA 1K35A 2NOBA 1KYFA 3I0WA 1MP9A 4PY5A 2QREA 1KY7A 2HZSA 1M5Q1 2IV8A 1YTFA 4TPSA 3OLPA 3T4NA 1NVPA 3UW2A 1XSZA 1E42A 1QNCA 1FN7A 3OH6A 3D7QA 1LWWA 2ZFDB 3TDHA 2JHJA 2V8QA 4Q11A 4EAKA 1QNAA 2O3OA 4D7QA 2Z8UA 3CWAA 1PZDA 4HJHA 4D7RA 3OSMA 1QNBA 2QR1A 2OOXA 1UL7A 1T6AA 2QRDA 3IH7A 1QN5A 2HKPA 1QN4A 3TE5A 3CVSA 3ENCA 1TUOA 2NLVA 3N89A 3D4VA 1QN9A 3RPJA 1V5SA 3NA5A 3OCIA 1PCMX 3CWUA 2NOFA 4EJYA 5IYDP 2IV9A 1YQMA 1YQKA 1LWVA 2HZMA 3H1ZA 1MPGA 1VOKA 3F0ZA 3I0XA 1QN3A 1VTOA 2FKFA 4WX8A 1YTBA 2Z0FA 2MJ7A 3PDKA 3OGDA 2XHIA 1KFQA 1C4GA 2JOIA 1VOLB 2NOEA 2FGTA 1TBAB 1JFIC 1PCJX 2D0AA 5JN5A 1LXTA 3KRMA 3OH9A 1VKLA 2JHNA 2QRCA 5AN4A 3CW7A 5KL0A 5BMNA 4EAIA 1NH2A 1KYUA 2EHBD 4ROCB 5EPCA 1TGHA 3ASMA 2V92A 2H4LX 4WXAA 1EBMA 1QN7A 3OSEA 3SNSA 4EALA 1UT7A 1EUVA 2D0BA 3KTUA 1B9KA 2OOYA 2VJ0A 1P5GX 1N39A 2R5XA 1WJWA 3I3WA 5F9CA 1J3MA 2DKDA 1YQLA 1QTSA 2JPIA 2YA3A 1VTLE 2NOZA 2Y8QA 2I5WA 2G30A 5HSHA 1PVSA 3OSTA 1D3UA 2NVMA 1C47A 1Q9UA 1R4XA 1P5DX 2FKMX 1M3QA 1NGMA 1WQAA 4EAJA 4QG5A 1DIZA 3RSMA 3DPUA 1QN6A 4I8OA 3OC3C 5IYCP 2Y8LA 1YQRA 2V9JA 1M3HA 1KYDA 4MRQA 1C9BB 2FUVA 4DULA 2NOIA 1QNEA 3HS8A 2H5AX 5BMPA 1JDYA 1RM1A 4ROEB 1LWYA 2NWVA 1KO9A 2D0CA 3PMGA 4CFFA 2YH5A 3ENOC 1QTPA 4WZSD 3EIKA 4EJZA 1QN8A 1TBPA 2F7LA 2LAEA 4BJUA 4IL8A 2NOLA 3CWSA 1KY6A 3EAYA 4B0AA 4RODB 5IYBP 2HL8A 1HU0A 3HS9A 3CWTA 4C7PA 1CDWA 1KFIA 3C04A 3VN5A 3BKQX 3F10A 1N3AA 4EAGA 3ULXA 2HL9A 1W80A 2DKCA 5JMVD 1K2YX 2DKAA 2QLVA
chains in the Genus database with same CATH topology
3DPTA 1UT4A 1N3CA 1PCZA 2MZ8A 1AISA 2NOHA 2NOBA 1KYFA 3I0WA 1MP9A 4PY5A 1KY7A 2HZSA 2IV8A 1YTFA 4TPSA 1NVPA 1E42A 1QNCA 1FN7A 1LWWA 1QNAA 4Q11A 2O3OA 2Z8UA 1PZDA 1QNBA 3OSMA 3IH7A 1QN5A 1QN4A 3N89A 1QN9A 3RPJA 3OCIA 2NOFA 4EJYA 5IYDP 2IV9A 1YQMA 1YQKA 1LWVA 2HZMA 3H1ZA 3F0ZA 1VOKA 3I0XA 1QN3A 1YTBA 1VTOA 2MJ7A 2XHIA 2JOIA 1VOLB 2NOEA 2FGTA 1TBAB 1JFIC 2D0AA 3KRMA 5AN4A 1NH2A 1KYUA 4ROCB 1TGHA 3ASMA 1EBMA 1QN7A 3SNSA 1UT7A 2D0BA 3KTUA 1B9KA 2VJ0A 1N39A 1YQLA 1QTSA 2NOZA 1VTLE 2I5WA 2G30A 3OSTA 1D3UA 1R4XA 1M3QA 1NGMA 3DPUA 1QN6A 4I8OA 3OC3C 5IYCP 1YQRA 1M3HA 1KYDA 1C9BB 4DULA 2NOIA 1QNEA 3HS8A 1RM1A 4ROEB 1LWYA 1KO9A 2D0CA 2YH5A 1QTPA 4WZSD 3EIKA 4EJZA 1QN8A 1TBPA 2LAEA 2NOLA 1KY6A 4B0AA 1HU0A 4RODB 5IYBP 3HS9A 1CDWA 3VN5A 3F10A 1N3AA 3ULXA 1W80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TGH A;  3ASM A;  1QN9 A;  1PCZ A;  1KYD A;  1AIS A;  1C9B B;  1QN7 A;  1KYF A;  3OCI A;  2D0B A;  1MP9 A;  1QNE A;  4PY5 A;  3HS8 A;  1B9K A;  1KY7 A;  2IV9 A;  2VJ0 A;  5IYD P;  2IV8 A;  1RM1 A;  4ROE B;  3H1Z A;  1YTF A;  1VOK A;  1QN3 A;  1YTB A;  1VTO A;  2D0C A;  1NVP A;  2MJ7 A;  1E42 A;  1QTS A;  1QTP A;  4WZS D;  1VTL E;  1QNC A;  1VOL B;  2G30 A;  3EIK A;  1QNA A;  1QN8 A;  1TBA B;  1TBP A;  1D3U A;  1JFI C;  2D0A A;  1R4X A;  1KY6 A;  2Z8U A;  4B0A A;  1PZD A;  5IYB P;  4ROD B;  1QNB A;  3HS9 A;  1NGM A;  1CDW A;  3VN5 A;  1NH2 A;  1KYU A;  1W80 A;  5IYC P;  3OC3 C;  4ROC B;  1QN5 A;  1QN6 A;  1QN4 A; 
#chains in the Genus database with same CATH topology
 3DPT A;  2PWW A;  1UT4 A;  1N3C A;  1PCZ A;  2MZ8 A;  1AIS A;  3CVT A;  2NOH A;  1K35 A;  2NOB A;  1KYF A;  3I0W A;  1MP9 A;  4PY5 A;  2QRE A;  1KY7 A;  2HZS A;  1M5Q 1;  2IV8 A;  1YTF A;  4TPS A;  3OLP A;  3T4N A;  1NVP A;  3UW2 A;  1XSZ A;  1E42 A;  1QNC A;  1FN7 A;  3OH6 A;  3D7Q A;  1LWW A;  2ZFD B;  3TDH A;  2JHJ A;  2V8Q A;  4Q11 A;  4EAK A;  1QNA A;  2O3O A;  4D7Q A;  2Z8U A;  3CWA A;  1PZD A;  4HJH A;  4D7R A;  3OSM A;  1QNB A;  2QR1 A;  2OOX A;  1UL7 A;  1T6A A;  2QRD A;  3IH7 A;  1QN5 A;  2HKP A;  1QN4 A;  3TE5 A;  3CVS A;  3ENC A;  1TUO A;  2NLV A;  3N89 A;  3D4V A;  1QN9 A;  3RPJ A;  1V5S A;  3NA5 A;  3OCI A;  1PCM X;  3CWU A;  2NOF A;  4EJY A;  5IYD P;  2IV9 A;  1YQM A;  1YQK A;  1LWV A;  2HZM A;  3H1Z A;  1MPG A;  1VOK A;  3F0Z A;  3I0X A;  1QN3 A;  1VTO A;  2FKF A;  4WX8 A;  1YTB A;  2Z0F A;  2MJ7 A;  3PDK A;  3OGD A;  2XHI A;  1KFQ A;  1C4G A;  2JOI A;  1VOL B;  2NOE A;  2FGT A;  1TBA B;  1JFI C;  1PCJ X;  2D0A A;  5JN5 A;  1LXT A;  3KRM A;  3OH9 A;  1VKL A;  2JHN A;  2QRC A;  5AN4 A;  3CW7 A;  5KL0 A;  5BMN A;  4EAI A;  1NH2 A;  1KYU A;  2EHB D;  4ROC B;  5EPC A;  1TGH A;  3ASM A;  2V92 A;  2H4L X;  4WXA A;  1EBM A;  1QN7 A;  3OSE A;  3SNS A;  4EAL A;  1UT7 A;  1EUV A;  2D0B A;  3KTU A;  1B9K A;  2OOY A;  2VJ0 A;  1P5G X;  1N39 A;  2R5X A;  1WJW A;  3I3W A;  5F9C A;  1J3M A;  2DKD A;  1YQL A;  1QTS A;  2JPI A;  2YA3 A;  1VTL E;  2NOZ A;  2Y8Q A;  2I5W A;  2G30 A;  5HSH A;  1PVS A;  3OST A;  1D3U A;  2NVM A;  1C47 A;  1Q9U A;  1R4X A;  1P5D X;  2FKM X;  1M3Q A;  1NGM A;  1WQA A;  4EAJ A;  4QG5 A;  1DIZ A;  3RSM A;  3DPU A;  1QN6 A;  4I8O A;  3OC3 C;  5IYC P;  2Y8L A;  1YQR A;  2V9J A;  1M3H A;  1KYD A;  4MRQ A;  1C9B B;  2FUV A;  4DUL A;  2NOI A;  1QNE A;  3HS8 A;  2H5A X;  5BMP A;  1JDY A;  1RM1 A;  4ROE B;  1LWY A;  2NWV A;  1KO9 A;  2D0C A;  3PMG A;  4CFF A;  2YH5 A;  3ENO C;  1QTP A;  4WZS D;  3EIK A;  4EJZ A;  1QN8 A;  1TBP A;  2F7L A;  2LAE A;  4BJU A;  4IL8 A;  2NOL A;  3CWS A;  1KY6 A;  3EAY A;  4B0A A;  4ROD B;  5IYB P;  2HL8 A;  1HU0 A;  3HS9 A;  3CWT A;  4C7P A;  1CDW A;  1KFI A;  3C04 A;  3VN5 A;  3BKQ X;  3F10 A;  1N3A A;  4EAG A;  3ULX A;  2HL9 A;  1W80 A;  2DKC A;  5JMV D;  1K2Y X;  2DKA A;  2QLV A; 
#chains in the Genus database with same CATH homology
 3DPT A;  1UT4 A;  1N3C A;  1PCZ A;  2MZ8 A;  1AIS A;  2NOH A;  2NOB A;  1KYF A;  3I0W A;  1MP9 A;  4PY5 A;  1KY7 A;  2HZS A;  2IV8 A;  1YTF A;  4TPS A;  1NVP A;  1E42 A;  1QNC A;  1FN7 A;  1LWW A;  1QNA A;  4Q11 A;  2O3O A;  2Z8U A;  1PZD A;  1QNB A;  3OSM A;  3IH7 A;  1QN5 A;  1QN4 A;  3N89 A;  1QN9 A;  3RPJ A;  3OCI A;  2NOF A;  4EJY A;  5IYD P;  2IV9 A;  1YQM A;  1YQK A;  1LWV A;  2HZM A;  3H1Z A;  3F0Z A;  1VOK A;  3I0X A;  1QN3 A;  1YTB A;  1VTO A;  2MJ7 A;  2XHI A;  2JOI A;  1VOL B;  2NOE A;  2FGT A;  1TBA B;  1JFI C;  2D0A A;  3KRM A;  5AN4 A;  1NH2 A;  1KYU A;  4ROC B;  1TGH A;  3ASM A;  1EBM A;  1QN7 A;  3SNS A;  1UT7 A;  2D0B A;  3KTU A;  1B9K A;  2VJ0 A;  1N39 A;  1YQL A;  1QTS A;  2NOZ A;  1VTL E;  2I5W A;  2G30 A;  3OST A;  1D3U A;  1R4X A;  1M3Q A;  1NGM A;  3DPU A;  1QN6 A;  4I8O A;  3OC3 C;  5IYC P;  1YQR A;  1M3H A;  1KYD A;  1C9B B;  4DUL A;  2NOI A;  1QNE A;  3HS8 A;  1RM1 A;  4ROE B;  1LWY A;  1KO9 A;  2D0C A;  2YH5 A;  1QTP A;  4WZS D;  3EIK A;  4EJZ A;  1QN8 A;  1TBP A;  2LAE A;  2NOL A;  1KY6 A;  4B0A A;  1HU0 A;  4ROD B;  5IYB P;  3HS9 A;  1CDW A;  3VN5 A;  3F10 A;  1N3A A;  3ULX A;  1W80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...