1QN3A

Crystal structure of the c(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn3A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn3A02
1KYDA 2D0AA 1QN3A 2VJ0A 3ASMA 1KY7A 1R4XA 5IYBP 1QN5A 2G30A 1VOLB 1QN7A 1KY6A 4ROEB 1JFIC 5IYCP 3OC3C 3HS8A 2D0BA 1QN4A 1QNBA 2MJ7A 1W80A 2Z8UA 1YTBA 1QNCA 1RM1A 4PY5A 1NH2A 1QN6A 1TBPA 1AISA 1QN9A 1VOKA 1QTSA 1YTFA 1CDWA 1D3UA 1VTOA 1MP9A 1QTPA 1QNAA 1VTLE 1TGHA 4RODB 2D0CA 1KYUA 3EIKA 1C9BB 5IYDP 1TBAB 3H1ZA 3HS9A 1KYFA 4B0AA 1B9KA 1NGMA 4WZSD 1E42A 1QN8A 3VN5A 4ROCB 2IV9A 1NVPA 1QNEA 1PZDA 2IV8A 3OCIA 1PCZA
chains in the Genus database with same CATH superfamily
3BKQX 5EPCA 2NOFA 1V5SA 1T6AA 2QR1A 4DULA 3CWTA 4I8OA 1VOLB 2YH5A 3RPJA 2NOEA 2FKFA 3I3WA 1YQRA 1QN7A 4WX8A 1N3CA 3OC3C 2FKMX 2I5WA 4MRQA 1K35A 2F7LA 4C7PA 1WJWA 4EAKA 2JOIA 3OH9A 1QNCA 2JHJA 2QRDA 1FN7A 2H5AX 2QREA 4IL8A 3OSEA 5JMVD 2NOHA 2R5XA 4HJHA 1KFIA 3I0WA 1D3UA 1DIZA 1QTPA 2HL8A 5JN5A 1VTLE 4RODB 1M3HA 1KYUA 2EHBD 3PMGA 3CVTA 1B9KA 1LWWA 1TUOA 1PVSA 5KL0A 3OGDA 2Y8QA 2HKPA 2FGTA 3F10A 1WQAA 1NVPA 3OCIA 3CWAA 1YQMA 3KRMA 1KYDA 5HSHA 1LWVA 2JPIA 3DPUA 1VKLA 3NA5A 3ASMA 1KY7A 1R4XA 2FUVA 5IYBP 2NOZA 1N3AA 4ROEB 1J3MA 3CWSA 4EJZA 2HZMA 3ULXA 5F9CA 4EAIA 1QN4A 2HL9A 3SNSA 1UT4A 2MJ7A 1W80A 2NVMA 1KO9A 2Z8UA 4Q11A 4CFFA 1NH2A 1YQKA 3CVSA 2DKCA 3IH7A 1JDYA 3ENOC 3TE5A 1QN9A 1CDWA 3ENCA 3F0ZA 1VTOA 2NOBA 2XHIA 1QNAA 4EALA 2H4LX 5IYDP 1TBAB 1KFQA 3H1ZA 3HS9A 3T4NA 4B0AA 1C47A 1PCMX 2QLVA 1P5DX 2IV8A 2PWWA 4QG5A 2NOIA 3RSMA 3C04A 2YA3A 3DPTA 2G30A 1LWYA 1KY6A 1XSZA 2NWVA 5AN4A 2LAEA 1C4GA 3OSTA 5IYCP 1JFIC 3HS8A 2D0BA 1QNBA 1P5GX 2OOYA 4EAGA 1QN6A 1TBPA 1VOKA 1QTSA 3EAYA 1HU0A 1EBMA 1TGHA 3UW2A 1N39A 1C9BB 2NOLA 1KYFA 1MPGA 3VN5A 5BMPA 4TPSA 4ROCB 2IV9A 3TDHA 1PZDA 1PCZA 3CW7A 2QRCA 2D0AA 1LXTA 1QN3A 2VJ0A 1PCJX 4WXAA 1QN5A 2NLVA 2V9JA 2DKAA 3I0XA 2HZSA 1K2YX 2JHNA 3KTUA 1YTBA 4EAJA 1RM1A 1M3QA 3D4VA 4PY5A 2OOXA 4BJUA 1AISA 3N89A 1YTFA 2MZ8A 5BMNA 3OSMA 2O3OA 1M5Q1 1MP9A 2Y8LA 3OLPA 4D7QA 1EUVA 3CWUA 1UT7A 2D0CA 1Q9UA 3EIKA 3OH6A 2Z0FA 4D7RA 1YQLA 1NGMA 2ZFDB 3D7QA 4WZSD 1E42A 1UL7A 2DKDA 3PDKA 1QN8A 2V8QA 4EJYA 1QNEA 2V92A
chains in the Genus database with same CATH topology
2NOFA 4DULA 4I8OA 1VOLB 2YH5A 3RPJA 2NOEA 1YQRA 1QN7A 1N3CA 3OC3C 2I5WA 2JOIA 1QNCA 1FN7A 2NOHA 3I0WA 1D3UA 1QTPA 1VTLE 4RODB 1M3HA 1KYUA 1B9KA 1LWWA 2FGTA 3F10A 1NVPA 3OCIA 1YQMA 3KRMA 1KYDA 1LWVA 3DPUA 3ASMA 1KY7A 1R4XA 5IYBP 2NOZA 1N3AA 4ROEB 4EJZA 2HZMA 3ULXA 1QN4A 3SNSA 1UT4A 2MJ7A 1W80A 2Z8UA 1KO9A 4Q11A 1NH2A 1YQKA 3IH7A 1QN9A 1CDWA 3F0ZA 1VTOA 2NOBA 2XHIA 1QNAA 5IYDP 1TBAB 3H1ZA 3HS9A 4B0AA 2IV8A 2NOIA 3DPTA 2G30A 1LWYA 1KY6A 1JFIC 5AN4A 2LAEA 3OSTA 5IYCP 3HS8A 2D0BA 1QNBA 1QN6A 1TBPA 1VOKA 1QTSA 1HU0A 1EBMA 1TGHA 1N39A 1C9BB 2NOLA 1KYFA 3VN5A 4TPSA 4ROCB 2IV9A 1PZDA 1PCZA 2D0AA 1QN3A 2VJ0A 1QN5A 3I0XA 2HZSA 3KTUA 1YTBA 1RM1A 1M3QA 4PY5A 1AISA 3N89A 1YTFA 2MZ8A 3OSMA 2O3OA 1MP9A 1UT7A 2D0CA 3EIKA 1YQLA 1NGMA 4WZSD 1E42A 1QN8A 4EJYA 1QNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYD A;  2D0A A;  1QN3 A;  2VJ0 A;  3ASM A;  1KY7 A;  1R4X A;  5IYB P;  1QN5 A;  2G30 A;  1VOL B;  1QN7 A;  1KY6 A;  4ROE B;  1JFI C;  5IYC P;  3OC3 C;  3HS8 A;  2D0B A;  1QN4 A;  1QNB A;  2MJ7 A;  1W80 A;  2Z8U A;  1YTB A;  1QNC A;  1RM1 A;  4PY5 A;  1NH2 A;  1QN6 A;  1TBP A;  1AIS A;  1QN9 A;  1VOK A;  1QTS A;  1YTF A;  1CDW A;  1D3U A;  1VTO A;  1MP9 A;  1QTP A;  1QNA A;  1VTL E;  1TGH A;  4ROD B;  2D0C A;  1KYU A;  3EIK A;  1C9B B;  5IYD P;  1TBA B;  3H1Z A;  3HS9 A;  1KYF A;  4B0A A;  1B9K A;  1NGM A;  4WZS D;  1E42 A;  1QN8 A;  3VN5 A;  4ROC B;  2IV9 A;  1NVP A;  1QNE A;  1PZD A;  2IV8 A;  3OCI A;  1PCZ A; 
#chains in the Genus database with same CATH topology
 3BKQ X;  5EPC A;  2NOF A;  1V5S A;  1T6A A;  2QR1 A;  4DUL A;  3CWT A;  4I8O A;  1VOL B;  2YH5 A;  3RPJ A;  2NOE A;  2FKF A;  3I3W A;  1YQR A;  1QN7 A;  4WX8 A;  1N3C A;  3OC3 C;  2FKM X;  2I5W A;  4MRQ A;  1K35 A;  2F7L A;  4C7P A;  1WJW A;  4EAK A;  2JOI A;  3OH9 A;  1QNC A;  2JHJ A;  2QRD A;  1FN7 A;  2H5A X;  2QRE A;  4IL8 A;  3OSE A;  5JMV D;  2NOH A;  2R5X A;  4HJH A;  1KFI A;  3I0W A;  1D3U A;  1DIZ A;  1QTP A;  2HL8 A;  5JN5 A;  1VTL E;  4ROD B;  1M3H A;  1KYU A;  2EHB D;  3PMG A;  3CVT A;  1B9K A;  1LWW A;  1TUO A;  1PVS A;  5KL0 A;  3OGD A;  2Y8Q A;  2HKP A;  2FGT A;  3F10 A;  1WQA A;  1NVP A;  3OCI A;  3CWA A;  1YQM A;  3KRM A;  1KYD A;  5HSH A;  1LWV A;  2JPI A;  3DPU A;  1VKL A;  3NA5 A;  3ASM A;  1KY7 A;  1R4X A;  2FUV A;  5IYB P;  2NOZ A;  1N3A A;  4ROE B;  1J3M A;  3CWS A;  4EJZ A;  2HZM A;  3ULX A;  5F9C A;  4EAI A;  1QN4 A;  2HL9 A;  3SNS A;  1UT4 A;  2MJ7 A;  1W80 A;  2NVM A;  1KO9 A;  2Z8U A;  4Q11 A;  4CFF A;  1NH2 A;  1YQK A;  3CVS A;  2DKC A;  3IH7 A;  1JDY A;  3ENO C;  3TE5 A;  1QN9 A;  1CDW A;  3ENC A;  3F0Z A;  1VTO A;  2NOB A;  2XHI A;  1QNA A;  4EAL A;  2H4L X;  5IYD P;  1TBA B;  1KFQ A;  3H1Z A;  3HS9 A;  3T4N A;  4B0A A;  1C47 A;  1PCM X;  2QLV A;  1P5D X;  2IV8 A;  2PWW A;  4QG5 A;  2NOI A;  3RSM A;  3C04 A;  2YA3 A;  3DPT A;  2G30 A;  1LWY A;  1KY6 A;  1XSZ A;  2NWV A;  5AN4 A;  2LAE A;  1C4G A;  3OST A;  5IYC P;  1JFI C;  3HS8 A;  2D0B A;  1QNB A;  1P5G X;  2OOY A;  4EAG A;  1QN6 A;  1TBP A;  1VOK A;  1QTS A;  3EAY A;  1HU0 A;  1EBM A;  1TGH A;  3UW2 A;  1N39 A;  1C9B B;  2NOL A;  1KYF A;  1MPG A;  3VN5 A;  5BMP A;  4TPS A;  4ROC B;  2IV9 A;  3TDH A;  1PZD A;  1PCZ A;  3CW7 A;  2QRC A;  2D0A A;  1LXT A;  1QN3 A;  2VJ0 A;  1PCJ X;  4WXA A;  1QN5 A;  2NLV A;  2V9J A;  2DKA A;  3I0X A;  2HZS A;  1K2Y X;  2JHN A;  3KTU A;  1YTB A;  4EAJ A;  1RM1 A;  1M3Q A;  3D4V A;  4PY5 A;  2OOX A;  4BJU A;  1AIS A;  3N89 A;  1YTF A;  2MZ8 A;  5BMN A;  3OSM A;  2O3O A;  1M5Q 1;  1MP9 A;  2Y8L A;  3OLP A;  4D7Q A;  1EUV A;  3CWU A;  1UT7 A;  2D0C A;  1Q9U A;  3EIK A;  3OH6 A;  2Z0F A;  4D7R A;  1YQL A;  1NGM A;  2ZFD B;  3D7Q A;  4WZS D;  1E42 A;  1UL7 A;  2DKD A;  3PDK A;  1QN8 A;  2V8Q A;  4EJY A;  1QNE A;  2V92 A; 
#chains in the Genus database with same CATH homology
 2NOF A;  4DUL A;  4I8O A;  1VOL B;  2YH5 A;  3RPJ A;  2NOE A;  1YQR A;  1QN7 A;  1N3C A;  3OC3 C;  2I5W A;  2JOI A;  1QNC A;  1FN7 A;  2NOH A;  3I0W A;  1D3U A;  1QTP A;  1VTL E;  4ROD B;  1M3H A;  1KYU A;  1B9K A;  1LWW A;  2FGT A;  3F10 A;  1NVP A;  3OCI A;  1YQM A;  3KRM A;  1KYD A;  1LWV A;  3DPU A;  3ASM A;  1KY7 A;  1R4X A;  5IYB P;  2NOZ A;  1N3A A;  4ROE B;  4EJZ A;  2HZM A;  3ULX A;  1QN4 A;  3SNS A;  1UT4 A;  2MJ7 A;  1W80 A;  2Z8U A;  1KO9 A;  4Q11 A;  1NH2 A;  1YQK A;  3IH7 A;  1QN9 A;  1CDW A;  3F0Z A;  1VTO A;  2NOB A;  2XHI A;  1QNA A;  5IYD P;  1TBA B;  3H1Z A;  3HS9 A;  4B0A A;  2IV8 A;  2NOI A;  3DPT A;  2G30 A;  1LWY A;  1KY6 A;  1JFI C;  5AN4 A;  2LAE A;  3OST A;  5IYC P;  3HS8 A;  2D0B A;  1QNB A;  1QN6 A;  1TBP A;  1VOK A;  1QTS A;  1HU0 A;  1EBM A;  1TGH A;  1N39 A;  1C9B B;  2NOL A;  1KYF A;  3VN5 A;  4TPS A;  4ROC B;  2IV9 A;  1PZD A;  1PCZ A;  2D0A A;  1QN3 A;  2VJ0 A;  1QN5 A;  3I0X A;  2HZS A;  3KTU A;  1YTB A;  1RM1 A;  1M3Q A;  4PY5 A;  1AIS A;  3N89 A;  1YTF A;  2MZ8 A;  3OSM A;  2O3O A;  1MP9 A;  1UT7 A;  2D0C A;  3EIK A;  1YQL A;  1NGM A;  4WZS D;  1E42 A;  1QN8 A;  4EJY A;  1QNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...